F286276

General Info

Members Datasets Scaffolds Average Seq Length
186 124 182 332

Family's Representative Sequence

Representative Sequence 3300033180|Ga0307510_10005081|Ga0307510_1000508112
Length 345
Sequence MDGEVTHPLEPQLAAYIATRMPGAAEIAIDSLERISGGASRETYRFRLIWREDGRTRERKLILRRDPPASLIDTERRVEFEAYRAFAGSAVPVPEMLWLEEGSEALGHPFFIAEELTGFQAAPQMLFAGGYEAVLQIVAERKWTILGEIARADPIALRLDKWMPTPTLDGCWSRELAHWEGILDRDEAEPLPIARAAIRWLKANPPPPAQKLSVVHGDYRTGNFLYDQAGDIHGVLDWEMAHLGDPLEDLGWGFNPVWQFGRGLEGGLVPRAQATAIWERASGLKADPAALHWWILFNCVKGQAIWVGSARAFIDGGNREPIMIYPAWWLLNAQDRAILKVMGRP

Samples

Sample ID Description Type Environment
1 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
2 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
3 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
4 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
47 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
49 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
76 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
83 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
84 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
94 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
95 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
96 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
97 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
98 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
99 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
100 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
101 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
120 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
121 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
122 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
123 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
124 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.31
Metatranscriptomes 0.54
Isolates 2.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.53
Nodule 0
Rhizoplane 2.69
Rhizosphere 82.26
Stem 0
Stem Tuber 0
Unclassified 7.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10008521 3300003320 Bacteria 52664
2 Ga0055530_10000045 3300003791 Bacteria 109202
3 Ga0055531_10001771 3300003794 Bacteria 15367
4 Ga0055531_10015298 3300003794 Bacteria 3392
5 Ga0065165_1000649 3300005262 Bacteria 50230
6 Ga0070658_10038723 3300005327 Bacteria 3844
7 Ga0070658_10080762 3300005327 Bacteria 2671
8 Ga0070658_10339214 3300005327 Bacteria 1285
9 Ga0070666_10052683 3300005335 Bacteria 2743
10 Ga0070680_100001013 3300005336 Bacteria 20035
11 Ga0070680_100026584 3300005336 Bacteria 4629
12 Ga0070660_100012060 3300005339 Bacteria 6168
13 Ga0070660_100195443 3300005339 Bacteria 1640
14 Ga0070691_10003810 3300005341 Bacteria 6812
15 Ga0070673_100037229 3300005364 Bacteria 3705
16 Ga0070659_100009207 3300005366 Bacteria 7247
17 Ga0070659_100029757 3300005366 Bacteria 4221
18 Ga0070659_100030805 3300005366 Bacteria 4152
19 Ga0070663_100021346 3300005455 Bacteria 4306
20 Ga0070678_100126950 3300005456 Bacteria 2021
21 Ga0070662_100205896 3300005457 Bacteria 1563
22 Ga0070681_10014054 3300005458 Bacteria 7967
23 Ga0070681_10037391 3300005458 Bacteria 4872
24 Ga0070681_10091267 3300005458 Bacteria 2996
25 Ga0070679_100014598 3300005530 Bacteria 7547
26 Ga0068853_100079831 3300005539 Bacteria 2862
27 Ga0068853_100187267 3300005539 Bacteria 1879
28 Ga0068853_100270747 3300005539 Bacteria 1564
29 Ga0070665_100000494 3300005548 Bacteria 56412
30 Ga0070665_100018885 3300005548 Bacteria 6914
31 Ga0068855_100055516 3300005563 Bacteria 4652
32 Ga0068855_100077906 3300005563 Bacteria 3846
33 Ga0068855_100115936 3300005563 Bacteria 3070
34 Ga0068855_100464521 3300005563 Bacteria 1380
35 Ga0070664_100219938 3300005564 Bacteria 1699
36 Ga0068854_100132550 3300005578 Bacteria 1904
37 Ga0068859_100220119 3300005617 Bacteria 1986
38 Ga0068864_100247911 3300005618 Bacteria 1652
39 Ga0068864_100299796 3300005618 Bacteria 1504
40 Ga0068863_100076458 3300005841 Bacteria 3167
41 Ga0068863_100159228 3300005841 Bacteria 2162
42 Ga0068862_100054826 3300005844 Bacteria 3413
43 Ga0075370_10008549 3300006353 Bacteria 5275
44 Ga0075430_100043980 3300006846 Bacteria 3777
45 Ga0068865_100017988 3300006881 Bacteria 4554
46 Ga0097620_100220107 3300006931 Bacteria 1986
47 Ga0105240_10008112 3300009093 Bacteria 15078
48 Ga0105240_10032437 3300009093 Bacteria 6762
49 Ga0105240_10079184 3300009093 Bacteria 4044
50 Ga0111539_10018680 3300009094 Bacteria 8586
51 Ga0114129_10339138 3300009147 Bacteria 1994
52 Ga0105241_10270186 3300009174 Bacteria 1448
53 Ga0105248_10002331 3300009177 Bacteria 21060
54 Ga0105237_10176959 3300009545 Bacteria 2134
55 Ga0105238_10018054 3300009551 Bacteria 7170
56 Ga0105238_10037410 3300009551 Bacteria 4934
57 Ga0105238_10623704 3300009551 Bacteria 1087
58 Ga0157373_10098821 3300013100 Bacteria 2054
59 Ga0157370_10101590 3300013104 Bacteria 2693
60 Ga0163162_10094850 3300013306 Bacteria 3070
61 Ga0157372_10034337 3300013307 Bacteria 5575
62 Ga0157372_10051330 3300013307 Bacteria 4589
63 Ga0163163_10030734 3300014325 Bacteria 5178
64 Ga0209026_1001832 3300025250 Bacteria 8716
65 Ga0209026_1011530 3300025250 Bacteria 1585
66 Ga0209148_1009285 3300025254 Bacteria 1924
67 Ga0209758_1005599 3300025297 Bacteria 9552
68 Ga0209050_1000121 3300025298 Bacteria 196019
69 Ga0209257_1000125 3300025304 Bacteria 218126
70 Ga0209257_1000706 3300025304 Bacteria 51722
71 Ga0207705_10000425 3300025909 Bacteria 36857
72 Ga0207705_10000478 3300025909 Bacteria 34357
73 Ga0207705_10280070 3300025909 Bacteria 1276
74 Ga0207707_10004093 3300025912 Bacteria 12918
75 Ga0207707_10010151 3300025912 Bacteria 8172
76 Ga0207707_10038840 3300025912 Bacteria 4161
77 Ga0207695_10000766 3300025913 Bacteria 61318
78 Ga0207695_10001045 3300025913 Bacteria 48612
79 Ga0207695_10129902 3300025913 Bacteria 2477
80 Ga0207695_10284795 3300025913 Bacteria 1546
81 Ga0207671_10055633 3300025914 Bacteria 2931
82 Ga0207660_10068316 3300025917 Bacteria 2577
83 Ga0207660_10079450 3300025917 Bacteria 2406
84 Ga0207657_10004646 3300025919 Bacteria 14504
85 Ga0207657_10004900 3300025919 Bacteria 14076
86 Ga0207657_10019178 3300025919 Bacteria 6503
87 Ga0207657_10241218 3300025919 Bacteria 1443
88 Ga0207652_10019452 3300025921 Bacteria 5586
89 Ga0207652_10129577 3300025921 Bacteria 2249
90 Ga0207694_10015496 3300025924 Bacteria 5748
91 Ga0207694_10090630 3300025924 Bacteria 2412
92 Ga0207644_10048165 3300025931 Bacteria 3045
93 Ga0207644_10270455 3300025931 Bacteria 1361
94 Ga0207690_10000158 3300025932 Bacteria 53051
95 Ga0207690_10010801 3300025932 Bacteria 5442
96 Ga0207690_10102922 3300025932 Bacteria 2043
97 Ga0207690_10246961 3300025932 Bacteria 1377
98 Ga0207704_10001023 3300025938 Bacteria 12414
99 Ga0207711_10001720 3300025941 Bacteria 20125
100 Ga0207711_10103010 3300025941 Bacteria 2527
101 Ga0207667_10034040 3300025949 Bacteria 5474
102 Ga0207667_10047990 3300025949 Bacteria 4517
103 Ga0207651_10027723 3300025960 Bacteria 3563
104 Ga0207640_10121006 3300025981 Bacteria 1875
105 Ga0207658_10161676 3300025986 Bacteria 1836
106 Ga0207677_10059624 3300026023 Bacteria 2633
107 Ga0207639_10018978 3300026041 Bacteria 4896
108 Ga0207639_10200127 3300026041 Bacteria 1712
109 Ga0207678_10033072 3300026067 Bacteria 4506
110 Ga0207641_10103138 3300026088 Bacteria 2516
111 Ga0207641_10168941 3300026088 Bacteria 1994
112 Ga0207648_10258406 3300026089 Bacteria 1554
113 Ga0207676_10456856 3300026095 Bacteria 1205
114 Ga0207676_10501854 3300026095 Bacteria 1152
115 Ga0207683_10100164 3300026121 Bacteria 2587
116 Ga0268266_10000003 3300028379 Bacteria 1701703
117 Ga0307517_10002889 3300028786 Bacteria 27244
118 Ga0265760_10015138 3300031090 Unclassified 2210
119 Ga0265327_10005616 3300031251 Bacteria 10388
120 Ga0307513_10000698 3300031456 Bacteria 48179
121 Ga0307513_10005479 3300031456 Bacteria 16766
122 Ga0307513_10012220 3300031456 Bacteria 10616
123 Ga0307508_10129792 3300031616 Bacteria 2124
124 Ga0265314_10009532 3300031711 Bacteria 8183
125 Ga0307412_10187073 3300031911 Bacteria 1563
126 Ga0307510_10005081 3300033180 Bacteria 15616
127 Ga0373936_0016154 3300035113 Bacteria 2869
128 Ga0373943_0096234 3300035170 Bacteria 1541
129 Ga0373937_0220343 3300036401 Bacteria 1786
130 Ga0373925_0083639 3300037068 Bacteria 2431
131 Ga0395899_0002424 3300037312 Bacteria 15159
132 Ga0395900_0000567 3300037418 Bacteria 51172
133 Ga0395900_0015727 3300037418 Bacteria 7715
134 Ga0395898_0030920 3300037466 Bacteria 5355
135 Ga0395898_0049256 3300037466 Bacteria 4128
136 Ga0395898_0052323 3300037466 Bacteria 3989
137 Ga0395905_0007470 3300037471 Bacteria 10870
138 Ga0395905_0129970 3300037471 Bacteria 2369
139 Ga0395905_0307247 3300037471 Bacteria 1474
140 Ga0436364_0337955 3300037853 Bacteria 1698
141 Ga0395901_0000032 3300038443 Bacteria 235172
142 Ga0495650_0054760 3300046471 Bacteria 1626
143 Ga0495642_0003200 3300046528 Bacteria 6489
144 Ga0495645_0034670 3300046543 Bacteria 3680
145 Ga0495668_0067602 3300046616 Bacteria 1966
146 Ga0495668_0107352 3300046616 Bacteria 1527
147 Ga0495625_0006773 3300046660 Bacteria 10136
148 Ga0495669_0047442 3300046684 Bacteria 1919
149 Ga0495672_0045299 3300047320 Bacteria 2632
150 Ga0495686_0002801 3300047472 Bacteria 15832
151 Ga0495602_0111489 3300048088 Bacteria 2221
152 Ga0496104_0298075 3300048907 Bacteria 1524
153 Ga0496109_0051103 3300048912 Bacteria 3765
154 Ga0496112_0113216 3300048915 Bacteria 2684
155 Ga0496115_0002634 3300048918 Bacteria 12889
156 Ga0496115_0015506 3300048918 Bacteria 5782
157 Ga0501032_0022182 3300049569 Bacteria 4405
158 Ga0501033_0070680 3300049570 Bacteria 2564
159 Ga0501034_0414844 3300049571 Bacteria 1268
160 Ga0501036_0151936 3300049572 Bacteria 1953
161 Ga0501037_0073145 3300049573 Bacteria 2492
162 Ga0501038_0142896 3300049574 Bacteria 1956
163 Ga0501043_0043864 3300049579 Bacteria 3516
164 Ga0501047_0062124 3300049581 Bacteria 3604
165 Ga0501047_0195389 3300049581 Bacteria 1886
166 Ga0501047_0201030 3300049581 Bacteria 1854
167 Ga0501048_0045841 3300049582 Bacteria 3121
168 Ga0501070_0000014 3300049586 Bacteria 180454
169 Ga0501080_0018878 3300049742 Bacteria 6385
170 Ga0501035_0001780 3300049822 Bacteria 21770
171 Ga0501035_0047175 3300049822 Bacteria 3869
172 Ga0501035_0380509 3300049822 Bacteria 1177
173 Ga0501044_0008242 3300049823 Bacteria 11430
174 Ga0501044_0010542 3300049823 Bacteria 10025
175 Ga0501044_0012732 3300049823 Bacteria 9108
176 Ga0501044_0049023 3300049823 Bacteria 4359
177 nmdc:mga07m45_224101_c1 3300050496 Bacteria 1094
178 nmdc:mga0qj67_47506_c1 3300050509 Bacteria 3391
179 nmdc:mga08y16_303685_c1 3300050511 Bacteria 1645
180 Ga0500562_001867 3300053108 Bacteria 5288
181 Ga0500595_015443 3300053119 Bacteria 2865
182 Ga0500645_003505 3300053730 Bacteria 6342

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006353 Ga0075370_10008549 Ga0075370_100085494 257
2 3300050496 nmdc:mga07m45_224101_c1 nmdc:mga07m45_224101_c1_21_875 257
3 3300009551 Ga0105238_10623704 Ga0105238_106237041 278
4 3300005327 Ga0070658_10339214 Ga0070658_103392142 293
5 3300005548 Ga0070665_100000494 Ga0070665_10000049429 293
6 3300025909 Ga0207705_10280070 Ga0207705_102800702 293
7 3300025919 Ga0207657_10019178 Ga0207657_100191785 293
8 3300028379 Ga0268266_10000003 Ga0268266_10000003774 293
9 3300026023 Ga0207677_10059624 Ga0207677_100596244 294
10 3300048918 Ga0496115_0015506 Ga0496115_0015506_364_1323 295
11 3300005844 Ga0068862_100054826 Ga0068862_1000548263 296
12 3300031090 Ga0265760_10015138 Ga0265760_100151383 296
13 3300037853 Ga0436364_0337955 Ga0436364_0337955_434_1444 298
14 3300013306 Ga0163162_10094850 Ga0163162_100948503 301
15 3300037471 Ga0395905_0307247 Ga0395905_0307247_487_1464 301
16 3300005548 Ga0070665_100018885 Ga0070665_1000188852 302
17 3300046528 Ga0495642_0003200 Ga0495642_0003200_1054_2034 302
18 3300005339 Ga0070660_100012060 Ga0070660_1000120605 303
19 3300005341 Ga0070691_10003810 Ga0070691_100038106 303
20 3300005366 Ga0070659_100030805 Ga0070659_1000308055 303
21 3300005455 Ga0070663_100021346 Ga0070663_1000213464 303
22 3300005539 Ga0068853_100187267 Ga0068853_1001872673 303
23 3300005578 Ga0068854_100132550 Ga0068854_1001325503 303
24 3300009551 Ga0105238_10037410 Ga0105238_100374103 303
25 3300013307 Ga0157372_10034337 Ga0157372_100343376 303
26 3300025909 Ga0207705_10000425 Ga0207705_1000042514 303
27 3300025912 Ga0207707_10010151 Ga0207707_100101513 303
28 3300025917 Ga0207660_10068316 Ga0207660_100683163 303
29 3300025919 Ga0207657_10004646 Ga0207657_1000464611 303
30 3300025921 Ga0207652_10019452 Ga0207652_100194526 303
31 3300025924 Ga0207694_10090630 Ga0207694_100906303 303
32 3300025932 Ga0207690_10102922 Ga0207690_101029222 303
33 3300025949 Ga0207667_10034040 Ga0207667_100340402 303
34 3300026041 Ga0207639_10200127 Ga0207639_102001273 303
35 3300026067 Ga0207678_10033072 Ga0207678_100330723 303
36 3300031711 Ga0265314_10009532 Ga0265314_100095327 304
37 3300049822 Ga0501035_0380509 Ga0501035_0380509_25_1011 305
38 3300048088 Ga0495602_0111489 Ga0495602_0111489_184_1188 307
39 3300005457 Ga0070662_100205896 Ga0070662_1002058961 308
40 3300005617 Ga0068859_100220119 Ga0068859_1002201192 308
41 3300006931 Ga0097620_100220107 Ga0097620_1002201072 308
42 3300009093 Ga0105240_10032437 Ga0105240_100324372 308
43 3300009094 Ga0111539_10018680 Ga0111539_100186802 308
44 3300048915 Ga0496112_0113216 Ga0496112_0113216_1656_2657 308
45 3300050511 nmdc:mga08y16_303685_c1 nmdc:mga08y16_303685_c1_178_1203 308
46 iso_pu_bacteria 2643221598 2643998115 310
47 iso_pu_bacteria 2643221614 2644087023 310
48 iso_pu_bacteria 2643221661 2644341977 310
49 iso_pu_bacteria 2643221666 2644368264 310
50 3300025250 Ga0209026_1011530 Ga0209026_10115302 314
51 3300025254 Ga0209148_1009285 Ga0209148_10092852 314
52 3300031251 Ga0265327_10005616 Ga0265327_1000561615 314
53 3300031456 Ga0307513_10012220 Ga0307513_100122208 314
54 3300031911 Ga0307412_10187073 Ga0307412_101870732 314
55 3300049581 Ga0501047_0062124 Ga0501047_0062124_1800_2819 314
56 3300049823 Ga0501044_0008242 Ga0501044_0008242_6094_7113 314
57 3300003791 Ga0055530_10000045 Ga0055530_1000004591 315
58 3300003794 Ga0055531_10001771 Ga0055531_100017717 315
59 3300005262 Ga0065165_1000649 Ga0065165_100064917 315
60 3300025250 Ga0209026_1001832 Ga0209026_10018325 315
61 3300025297 Ga0209758_1005599 Ga0209758_10055993 315
62 3300025298 Ga0209050_1000121 Ga0209050_100012121 315
63 3300025304 Ga0209257_1000125 Ga0209257_100012545 315
64 3300005327 Ga0070658_10038723 Ga0070658_100387232 316
65 3300005336 Ga0070680_100001013 Ga0070680_10000101318 316
66 3300005336 Ga0070680_100026584 Ga0070680_1000265843 316
67 3300005339 Ga0070660_100195443 Ga0070660_1001954432 316
68 3300005366 Ga0070659_100009207 Ga0070659_1000092073 316
69 3300005366 Ga0070659_100029757 Ga0070659_1000297575 316
70 3300005458 Ga0070681_10014054 Ga0070681_100140543 316
71 3300005458 Ga0070681_10037391 Ga0070681_100373914 316
72 3300005458 Ga0070681_10091267 Ga0070681_100912671 316
73 3300005530 Ga0070679_100014598 Ga0070679_1000145983 316
74 3300005539 Ga0068853_100079831 Ga0068853_1000798312 316
75 3300005539 Ga0068853_100270747 Ga0068853_1002707472 316
76 3300005563 Ga0068855_100055516 Ga0068855_1000555164 316
77 3300005563 Ga0068855_100077906 Ga0068855_1000779062 316
78 3300005563 Ga0068855_100115936 Ga0068855_1001159363 316
79 3300005563 Ga0068855_100464521 Ga0068855_1004645212 316
80 3300005618 Ga0068864_100247911 Ga0068864_1002479112 316
81 3300005841 Ga0068863_100159228 Ga0068863_1001592282 316
82 3300006881 Ga0068865_100017988 Ga0068865_1000179884 316
83 3300009093 Ga0105240_10008112 Ga0105240_1000811212 316
84 3300009093 Ga0105240_10079184 Ga0105240_100791842 316
85 3300009147 Ga0114129_10339138 Ga0114129_103391383 316
86 3300009174 Ga0105241_10270186 Ga0105241_102701861 316
87 3300009177 Ga0105248_10002331 Ga0105248_100023314 316
88 3300009545 Ga0105237_10176959 Ga0105237_101769592 316
89 3300009551 Ga0105238_10018054 Ga0105238_100180545 316
90 3300013100 Ga0157373_10098821 Ga0157373_100988212 316
91 3300013104 Ga0157370_10101590 Ga0157370_101015903 316
92 3300013307 Ga0157372_10051330 Ga0157372_100513305 316
93 3300025909 Ga0207705_10000478 Ga0207705_100004788 316
94 3300025912 Ga0207707_10004093 Ga0207707_100040932 316
95 3300025912 Ga0207707_10038840 Ga0207707_100388406 316
96 3300025913 Ga0207695_10000766 Ga0207695_1000076620 316
97 3300025913 Ga0207695_10001045 Ga0207695_1000104522 316
98 3300025913 Ga0207695_10129902 Ga0207695_101299022 316
99 3300025913 Ga0207695_10284795 Ga0207695_102847952 316
100 3300025914 Ga0207671_10055633 Ga0207671_100556332 316
101 3300025917 Ga0207660_10079450 Ga0207660_100794502 316
102 3300025919 Ga0207657_10004900 Ga0207657_100049008 316
103 3300025919 Ga0207657_10241218 Ga0207657_102412182 316
104 3300025921 Ga0207652_10129577 Ga0207652_101295772 316
105 3300025924 Ga0207694_10015496 Ga0207694_100154966 316
106 3300025932 Ga0207690_10000158 Ga0207690_1000015812 316
107 3300025932 Ga0207690_10010801 Ga0207690_100108015 316
108 3300025932 Ga0207690_10246961 Ga0207690_102469612 316
109 3300025938 Ga0207704_10001023 Ga0207704_1000102313 316
110 3300025941 Ga0207711_10001720 Ga0207711_100017204 316
111 3300025949 Ga0207667_10047990 Ga0207667_100479902 316
112 3300025981 Ga0207640_10121006 Ga0207640_101210062 316
113 3300026041 Ga0207639_10018978 Ga0207639_100189785 316
114 3300026088 Ga0207641_10103138 Ga0207641_101031382 316
115 3300026089 Ga0207648_10258406 Ga0207648_102584062 316
116 3300026095 Ga0207676_10456856 Ga0207676_104568561 316
117 3300028786 Ga0307517_10002889 Ga0307517_1000288913 316
118 3300031456 Ga0307513_10005479 Ga0307513_1000547911 316
119 3300031616 Ga0307508_10129792 Ga0307508_101297922 316
120 3300033180 Ga0307510_10005081 Ga0307510_1000508112 316
121 3300035113 Ga0373936_0016154 Ga0373936_0016154_1440_2465 316
122 3300035170 Ga0373943_0096234 Ga0373943_0096234_220_1245 316
123 3300037068 Ga0373925_0083639 Ga0373925_0083639_1357_2382 316
124 3300037418 Ga0395900_0015727 Ga0395900_0015727_259_1284 316
125 3300037466 Ga0395898_0049256 Ga0395898_0049256_2480_3505 316
126 3300037466 Ga0395898_0052323 Ga0395898_0052323_1480_2505 316
127 3300037471 Ga0395905_0129970 Ga0395905_0129970_12_1040 316
128 3300046471 Ga0495650_0054760 Ga0495650_0054760_236_1264 316
129 3300046543 Ga0495645_0034670 Ga0495645_0034670_925_1950 316
130 3300047320 Ga0495672_0045299 Ga0495672_0045299_356_1381 316
131 3300048918 Ga0496115_0002634 Ga0496115_0002634_6904_7929 316
132 3300049582 Ga0501048_0045841 Ga0501048_0045841_603_1628 316
133 3300053119 Ga0500595_015443 Ga0500595_015443_40_1068 316
134 3300003794 Ga0055531_10015298 Ga0055531_100152984 317
135 3300005327 Ga0070658_10080762 Ga0070658_100807622 317
136 3300005335 Ga0070666_10052683 Ga0070666_100526832 317
137 3300005364 Ga0070673_100037229 Ga0070673_1000372292 317
138 3300005456 Ga0070678_100126950 Ga0070678_1001269501 317
139 3300005564 Ga0070664_100219938 Ga0070664_1002199382 317
140 3300005618 Ga0068864_100299796 Ga0068864_1002997962 317
141 3300005841 Ga0068863_100076458 Ga0068863_1000764582 317
142 3300014325 Ga0163163_10030734 Ga0163163_100307342 317
143 3300025304 Ga0209257_1000706 Ga0209257_100070637 317
144 3300025931 Ga0207644_10048165 Ga0207644_100481653 317
145 3300025931 Ga0207644_10270455 Ga0207644_102704551 317
146 3300025941 Ga0207711_10103010 Ga0207711_101030104 317
147 3300025960 Ga0207651_10027723 Ga0207651_100277234 317
148 3300025986 Ga0207658_10161676 Ga0207658_101616762 317
149 3300026088 Ga0207641_10168941 Ga0207641_101689413 317
150 3300026095 Ga0207676_10501854 Ga0207676_105018541 317
151 3300026121 Ga0207683_10100164 Ga0207683_101001642 317
152 3300031456 Ga0307513_10000698 Ga0307513_1000069819 317
153 3300036401 Ga0373937_0220343 Ga0373937_0220343_659_1693 317
154 3300037312 Ga0395899_0002424 Ga0395899_0002424_4292_5320 317
155 3300037418 Ga0395900_0000567 Ga0395900_0000567_22007_23035 317
156 3300037466 Ga0395898_0030920 Ga0395898_0030920_3723_4751 317
157 3300037471 Ga0395905_0007470 Ga0395905_0007470_1855_2883 317
158 3300038443 Ga0395901_0000032 Ga0395901_0000032_45585_46613 317
159 3300046616 Ga0495668_0067602 Ga0495668_0067602_88_1116 317
160 3300046616 Ga0495668_0107352 Ga0495668_0107352_381_1409 317
161 3300046660 Ga0495625_0006773 Ga0495625_0006773_2028_3056 317
162 3300046684 Ga0495669_0047442 Ga0495669_0047442_439_1467 317
163 3300047472 Ga0495686_0002801 Ga0495686_0002801_7961_8989 317
164 3300048907 Ga0496104_0298075 Ga0496104_0298075_360_1388 317
165 3300048912 Ga0496109_0051103 Ga0496109_0051103_1050_2078 317
166 3300049572 Ga0501036_0151936 Ga0501036_0151936_619_1641 317
167 3300049574 Ga0501038_0142896 Ga0501038_0142896_508_1530 317
168 3300049579 Ga0501043_0043864 Ga0501043_0043864_2223_3245 317
169 3300049581 Ga0501047_0201030 Ga0501047_0201030_453_1475 317
170 3300049586 Ga0501070_0000014 Ga0501070_0000014_52097_53119 317
171 3300049742 Ga0501080_0018878 Ga0501080_0018878_820_1842 317
172 3300049822 Ga0501035_0001780 Ga0501035_0001780_6128_7150 317
173 3300049823 Ga0501044_0010542 Ga0501044_0010542_4186_5208 317
174 3300053108 Ga0500562_001867 Ga0500562_001867_2796_3824 317
175 3300053730 Ga0500645_003505 Ga0500645_003505_4981_6009 317
176 3300006846 Ga0075430_100043980 Ga0075430_1000439804 318
177 3300050509 nmdc:mga0qj67_47506_c1 nmdc:mga0qj67_47506_c1_1931_2968 318
178 3300003320 rootH2_10008521 rootH2_100085218 319
179 3300049569 Ga0501032_0022182 Ga0501032_0022182_3037_4059 319
180 3300049570 Ga0501033_0070680 Ga0501033_0070680_865_1887 319
181 3300049571 Ga0501034_0414844 Ga0501034_0414844_52_1074 319
182 3300049573 Ga0501037_0073145 Ga0501037_0073145_693_1715 319
183 3300049581 Ga0501047_0195389 Ga0501047_0195389_421_1443 319
184 3300049822 Ga0501035_0047175 Ga0501035_0047175_462_1484 319
185 3300049823 Ga0501044_0012732 Ga0501044_0012732_2862_3884 319
186 3300049823 Ga0501044_0049023 Ga0501044_0049023_2012_3034 319

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01636

APH

Phosphotransferase enzyme family

31

294

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tp6-assembly1.cif.gz_A 1.5 a crystal structure of a ntf-2 like protein of unknown function pa1314 from pseudomonas aeruginosa 0.8269 22 61
1opy-assembly1.cif.gz_A-2 ksi 0.7924 22 61
1dmm-assembly1.cif.gz_A-2 crystal structures of mutant enzymes y57f of ketosteroid isomerase from pseudomonas putida biotype b 0.7899 22 61
1e97-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase from pseudomonas putida ; triple mutant y16f/y32f/y57f 0.7879 22 61
1ea2-assembly1.cif.gz_A-2 pseudoreversion of the catalytic activity of y14f by the additional tyrosine-to-phenylalanine substitution(s) in the hydrogen bond network of delta-5-3-ketosteroid isomerase from pheudomonas putida biotype b 0.7877 22 59
ID Description Score Start End Superfamily
1tp6A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8269 22 61 3.10.450.50
af_Q93XN8_284_409_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7992 22 62 3.10.450.50
af_B3DMA2_17_122_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.799 26 111 3.30.200.20
3attA01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7758 5 112 3.30.200.20
af_Q6YXW6_281_410_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.76 22 66 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A7Y3DDW4-F1-model_v4 Phosphotransferase family protein 0.8806 5 112 GO:0016301
AF-A0A523FII6-F1-model_v4 Phosphotransferase family protein 0.8649 1 118 GO:0016740
AF-A0A522AK23-F1-model_v4 Aminoglycoside phosphotransferase domain-containing protein 0.8467 1 112
AF-A0A7Y3GY72-F1-model_v4 Phosphotransferase family protein 0.843 4 112 GO:0016740
AF-A0A661GSX0-F1-model_v4 Phosphotransferase family protein 0.8299 1 111 GO:0016740

Feature Viewer

pLDDT pTM Quality
82.29 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map