F286489

General Info

Members Datasets Scaffolds Average Seq Length
186 151 372 158

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0270980|Ga0495629_0270980_192_767
Length 191
Sequence MRLLVGRLRKTLRQGECRRQCACEQGWEAGMPKRSAGILLYRHAAAGLEVLLVHPGGPFWAYRDEGAWSIPKGEYQVGEAALDAARREFAEETGFGLDGEAVALGSFRQSRAKTVDVWAVQGDADPAKLVSNTFVMEWPPRSGRTQEFPEVDRAGWFALPEAACKLVNGQVAILEALDRCVRAGGDRPPSG

Samples

Sample ID Description Type Environment
1 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
60 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
79 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
80 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
81 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
84 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
94 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
95 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
96 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
97 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
98 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
99 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
100 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
101 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
102 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
103 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
104 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
105 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
106 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
107 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
108 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
109 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
110 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
111 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
112 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
113 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
114 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
115 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
116 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
130 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
135 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
136 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
137 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
140 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
143 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
144 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
145 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
146 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
147 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
148 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
149 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
150 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
151 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.23
Nodule 0
Rhizoplane 2.69
Rhizosphere 92.47
Stem 0
Stem Tuber 0
Unclassified 7.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495629_0270980 3300046459 Bacteria 1166
2 JGI25165J46597_1002188 3300003214 Bacteria 6950
3 Ga0070683_100004436 3300005329 Bacteria 11570
4 Ga0070683_100096685 3300005329 Bacteria 2778
5 Ga0070690_100686216 3300005330 Bacteria 785
6 Ga0068868_100041246 3300005338 Bacteria 3595
7 Ga0070660_100289311 3300005339 Bacteria 1342
8 Ga0070689_100553816 3300005340 Bacteria 991
9 Ga0070687_100358772 3300005343 Bacteria 943
10 Ga0070661_100028329 3300005344 Bacteria 4040
11 Ga0070661_100297223 3300005344 Bacteria 1256
12 Ga0070668_100103900 3300005347 Bacteria 2254
13 Ga0070675_101171833 3300005354 Bacteria 707
14 Ga0070714_101023275 3300005435 Bacteria 804
15 Ga0070713_100139024 3300005436 Bacteria 2149
16 Ga0070684_100035418 3300005535 Bacteria 4272
17 Ga0070684_101049293 3300005535 Bacteria 765
18 Ga0070697_100064516 3300005536 Bacteria 2991
19 Ga0068853_100000048 3300005539 Bacteria 93122
20 Ga0070672_101390535 3300005543 Bacteria 628
21 Ga0070695_100134308 3300005545 Bacteria 1708
22 Ga0070704_100335662 3300005549 Bacteria 1271
23 Ga0068855_100009223 3300005563 Bacteria 11919
24 Ga0068855_100051917 3300005563 Bacteria 4829
25 Ga0068855_100171210 3300005563 Bacteria 2459
26 Ga0068854_100012780 3300005578 Bacteria 5497
27 Ga0068856_100002877 3300005614 Bacteria 17612
28 Ga0068852_100000076 3300005616 Bacteria 69262
29 Ga0068852_100166028 3300005616 Bacteria 2065
30 Ga0068859_101048946 3300005617 Bacteria 896
31 Ga0068866_10397228 3300005718 Bacteria 888
32 Ga0068861_100128506 3300005719 Bacteria 2054
33 Ga0068851_10034436 3300005834 Bacteria 2528
34 Ga0068851_10102884 3300005834 Bacteria 1517
35 Ga0068860_101435856 3300005843 Bacteria 711
36 Ga0070717_10005692 3300006028 Bacteria 9112
37 Ga0070717_10586599 3300006028 Unclassified 1011
38 Ga0075364_10019588 3300006051 Bacteria 4247
39 Ga0097621_100033330 3300006237 Bacteria 4101
40 Ga0068871_100032626 3300006358 Unclassified 4116
41 Ga0068871_100150887 3300006358 Bacteria 1982
42 Ga0068871_100387933 3300006358 Bacteria 1242
43 Ga0075433_10046575 3300006852 Bacteria 3771
44 Ga0075434_100620509 3300006871 Bacteria 1100
45 Ga0097620_101048988 3300006931 Bacteria 896
46 Ga0105240_10001837 3300009093 Bacteria 35573
47 Ga0105240_10222180 3300009093 Bacteria 2200
48 Ga0105245_10122470 3300009098 Bacteria 2431
49 Ga0105245_10144066 3300009098 Bacteria 2247
50 Ga0105243_10098818 3300009148 Bacteria 2418
51 Ga0105242_10645867 3300009176 Bacteria 1028
52 Ga0105248_11202511 3300009177 Unclassified 857
53 Ga0105237_10512191 3300009545 Bacteria 1206
54 Ga0105238_10024940 3300009551 Bacteria 6095
55 Ga0105249_10477406 3300009553 Bacteria 1289
56 Ga0105249_11031495 3300009553 Bacteria 892
57 Ga0105239_10188438 3300010375 Bacteria 2309
58 Ga0157370_10002345 3300013104 Bacteria 22860
59 Ga0157369_10951160 3300013105 Bacteria 880
60 Ga0157374_10458095 3300013296 Bacteria 1277
61 Ga0157374_10780124 3300013296 Bacteria 971
62 Ga0157378_10046418 3300013297 Bacteria 3862
63 Ga0163162_10180376 3300013306 Bacteria 2238
64 Ga0163162_10257689 3300013306 Bacteria 1876
65 Ga0157372_10060481 3300013307 Unclassified 4239
66 Ga0157372_10077671 3300013307 Bacteria 3751
67 Ga0157372_11842750 3300013307 Bacteria 696
68 Ga0157375_10007482 3300013308 Bacteria 9552
69 Ga0157375_10104988 3300013308 Bacteria 2915
70 Ga0157375_10164701 3300013308 Bacteria 2361
71 Ga0157375_10333146 3300013308 Bacteria 1683
72 Ga0163163_10040790 3300014325 Unclassified 4535
73 Ga0157380_10039759 3300014326 Bacteria 3659
74 Ga0157380_10753247 3300014326 Bacteria 986
75 Ga0157380_12108724 3300014326 Bacteria 627
76 Ga0157379_10133635 3300014968 Bacteria 2235
77 Ga0157379_11459105 3300014968 Bacteria 665
78 Ga0157376_10074196 3300014969 Bacteria 2899
79 Ga0157376_10108675 3300014969 Bacteria 2437
80 Ga0157376_10298252 3300014969 Bacteria 1524
81 Ga0213872_10002905 3300021361 Bacteria 9745
82 Ga0213876_10001248 3300021384 Bacteria 16062
83 Ga0207427_104965 3300025231 Bacteria 2018
84 Ga0209233_1000377 3300025261 Bacteria 39032
85 Ga0207656_10054257 3300025321 Bacteria 1742
86 Ga0207642_10607615 3300025899 Bacteria 681
87 Ga0207707_11075847 3300025912 Bacteria 657
88 Ga0207695_10075527 3300025913 Unclassified 3429
89 Ga0207671_10213858 3300025914 Bacteria 1509
90 Ga0207662_10153985 3300025918 Bacteria 1464
91 Ga0207694_10228244 3300025924 Bacteria 1520
92 Ga0207664_10079337 3300025929 Bacteria 2665
93 Ga0207691_10333255 3300025940 Bacteria 1300
94 Ga0207711_11086689 3300025941 Bacteria 741
95 Ga0207661_10022485 3300025944 Bacteria 4751
96 Ga0207667_10015068 3300025949 Bacteria 8793
97 Ga0207712_10597079 3300025961 Unclassified 954
98 Ga0207677_10002930 3300026023 Bacteria 9015
99 Ga0207677_10045728 3300026023 Bacteria 2925
100 Ga0207639_10318994 3300026041 Bacteria 1379
101 Ga0207675_101051226 3300026118 Bacteria 833
102 Ga0207698_10412005 3300026142 Unclassified 1294
103 Ga0207698_10749600 3300026142 Bacteria 975
104 Ga0265338_10014116 3300028800 Bacteria 8935
105 Ga0265328_10011776 3300031239 Bacteria 3489
106 Ga0265329_10141357 3300031242 Bacteria 778
107 Ga0265339_10000166 3300031249 Bacteria 55317
108 Ga0265316_10001544 3300031344 Bacteria 24695
109 Ga0265314_10005227 3300031711 Bacteria 11766
110 Ga0265314_10350688 3300031711 Bacteria 812
111 Ga0265342_10094936 3300031712 Bacteria 1705
112 Ga0373935_0910437 3300035692 Bacteria 652
113 Ga0373937_0646187 3300036401 Bacteria 1003
114 Ga0395901_1245972 3300038443 Bacteria 708
115 Ga0436365_0073102 3300039437 Bacteria 4039
116 Ga0436365_0495986 3300039437 Bacteria 71581
117 Ga0436361_1143030 3300039447 Bacteria 3117
118 Ga0466961_0151038 3300044693 Bacteria 1450
119 Ga0453684_0418232 3300044712 Bacteria 1498
120 Ga0466959_0381598 3300045049 Bacteria 959
121 Ga0466959_0827853 3300045049 Unclassified 618
122 Ga0466958_0436677 3300045836 Unclassified 847
123 Ga0495617_025040 3300046452 Bacteria 2013
124 Ga0495603_0000410 3300046455 Bacteria 23691
125 Ga0495590_0303576 3300046457 Bacteria 601
126 Ga0495580_0052758 3300046472 Bacteria 2871
127 Ga0495605_0067646 3300046474 Bacteria 1694
128 Ga0495585_0014833 3300046492 Bacteria 4532
129 Ga0495594_0000139 3300046499 Bacteria 34499
130 Ga0495583_0012817 3300046506 Bacteria 4717
131 Ga0495631_0026089 3300046518 Bacteria 2686
132 Ga0495644_0000001 3300046523 Bacteria 229227
133 Ga0495648_0073535 3300046524 Bacteria 1973
134 Ga0495642_0006879 3300046528 Bacteria 4360
135 Ga0495609_0028078 3300046538 Bacteria 2569
136 Ga0495633_0026284 3300046558 Bacteria 2857
137 Ga0495656_0301635 3300046615 Bacteria 821
138 Ga0495668_0008837 3300046616 Bacteria 6243
139 Ga0495611_0017191 3300046648 Bacteria 3092
140 Ga0495625_0366267 3300046660 Bacteria 907
141 Ga0495623_0307179 3300046679 Unclassified 875
142 Ga0495669_0042114 3300046684 Bacteria 2029
143 Ga0495670_0169734 3300046691 Bacteria 1148
144 Ga0495673_0023476 3300047469 Bacteria 2999
145 Ga0495686_0043682 3300047472 Bacteria 2840
146 Ga0495593_0528599 3300047673 Bacteria 591
147 Ga0496108_0023306 3300048911 Bacteria 5092
148 Ga0496110_0140603 3300048913 Bacteria 2182
149 Ga0496111_0011933 3300048914 Bacteria 5872
150 Ga0496111_0051984 3300048914 Bacteria 2958
151 Ga0496112_0267312 3300048915 Bacteria 1659
152 Ga0501034_1296515 3300049571 Bacteria 605
153 Ga0501036_1402769 3300049572 Bacteria 566
154 Ga0501038_0041629 3300049574 Unclassified 4005
155 Ga0501039_0004224 3300049575 Bacteria 10824
156 Ga0501040_0001017 3300049576 Bacteria 17791
157 Ga0501041_0006265 3300049577 Bacteria 6957
158 Ga0501042_0007893 3300049578 Bacteria 7000
159 Ga0501043_0128677 3300049579 Bacteria 1985
160 Ga0501067_0104192 3300049583 Unclassified 1576
161 Ga0501068_0027577 3300049584 Bacteria 3354
162 Ga0501070_0615232 3300049586 Bacteria 865
163 Ga0501071_0001643 3300049587 Bacteria 13118
164 Ga0501072_0000274 3300049588 Bacteria 37244
165 Ga0501075_0000535 3300049591 Bacteria 23011
166 Ga0501076_0000673 3300049592 Bacteria 21925
167 Ga0501077_0000139 3300049593 Bacteria 39525
168 Ga0501079_0007460 3300049741 Bacteria 8273
169 Ga0501079_1061148 3300049741 Bacteria 638
170 Ga0501080_0008249 3300049742 Bacteria 9435
171 Ga0501080_0065861 3300049742 Bacteria 3369
172 Ga0501081_0000679 3300049743 Bacteria 19576
173 Ga0501083_0010465 3300049744 Bacteria 6530
174 Ga0501044_0497083 3300049823 Bacteria 1121
175 Ga0501045_0007030 3300049824 Bacteria 7802
176 nmdc:mga00v17_173055_c1 3300050491 Bacteria 1393
177 nmdc:mga0n895_297422_c1 3300050512 Bacteria 1636
178 nmdc:mga0rr50_505496_c1 3300050513 Bacteria 1028
179 nmdc:mga0rr50_509888_c1 3300050513 Bacteria 1023
180 nmdc:mga08x19_1153_c1 3300050514 Bacteria 16497
181 nmdc:mga0a205_226489_c1 3300050515 Bacteria 1754
182 Ga0500614_055184 3300053123 Bacteria 1054
183 Ga0501084_0013145 3300054114 Bacteria 6848
184 Ga0501084_0066482 3300054114 Bacteria 3016
185 Ga0501082_0480091 3300060353 Unclassified 1086
186 Ga0530510_0002944 3300061734 Bacteria 11677
187 Ga0495629_0270980
188 JGI25165J46597_1002188
189 Ga0070683_100004436
190 Ga0070683_100096685
191 Ga0070690_100686216
192 Ga0068868_100041246
193 Ga0070660_100289311
194 Ga0070689_100553816
195 Ga0070687_100358772
196 Ga0070661_100028329
197 Ga0070661_100297223
198 Ga0070668_100103900
199 Ga0070675_101171833
200 Ga0070714_101023275
201 Ga0070713_100139024
202 Ga0070684_100035418
203 Ga0070684_101049293
204 Ga0070697_100064516
205 Ga0068853_100000048
206 Ga0070672_101390535
207 Ga0070695_100134308
208 Ga0070704_100335662
209 Ga0068855_100009223
210 Ga0068855_100051917
211 Ga0068855_100171210
212 Ga0068854_100012780
213 Ga0068856_100002877
214 Ga0068852_100000076
215 Ga0068852_100166028
216 Ga0068859_101048946
217 Ga0068866_10397228
218 Ga0068861_100128506
219 Ga0068851_10034436
220 Ga0068851_10102884
221 Ga0068860_101435856
222 Ga0070717_10005692
223 Ga0070717_10586599
224 Ga0075364_10019588
225 Ga0097621_100033330
226 Ga0068871_100032626
227 Ga0068871_100150887
228 Ga0068871_100387933
229 Ga0075433_10046575
230 Ga0075434_100620509
231 Ga0097620_101048988
232 Ga0105240_10001837
233 Ga0105240_10222180
234 Ga0105245_10122470
235 Ga0105245_10144066
236 Ga0105243_10098818
237 Ga0105242_10645867
238 Ga0105248_11202511
239 Ga0105237_10512191
240 Ga0105238_10024940
241 Ga0105249_10477406
242 Ga0105249_11031495
243 Ga0105239_10188438
244 Ga0157370_10002345
245 Ga0157369_10951160
246 Ga0157374_10458095
247 Ga0157374_10780124
248 Ga0157378_10046418
249 Ga0163162_10180376
250 Ga0163162_10257689
251 Ga0157372_10060481
252 Ga0157372_10077671
253 Ga0157372_11842750
254 Ga0157375_10007482
255 Ga0157375_10104988
256 Ga0157375_10164701
257 Ga0157375_10333146
258 Ga0163163_10040790
259 Ga0157380_10039759
260 Ga0157380_10753247
261 Ga0157380_12108724
262 Ga0157379_10133635
263 Ga0157379_11459105
264 Ga0157376_10074196
265 Ga0157376_10108675
266 Ga0157376_10298252
267 Ga0213872_10002905
268 Ga0213876_10001248
269 Ga0207427_104965
270 Ga0209233_1000377
271 Ga0207656_10054257
272 Ga0207642_10607615
273 Ga0207707_11075847
274 Ga0207695_10075527
275 Ga0207671_10213858
276 Ga0207662_10153985
277 Ga0207694_10228244
278 Ga0207664_10079337
279 Ga0207691_10333255
280 Ga0207711_11086689
281 Ga0207661_10022485
282 Ga0207667_10015068
283 Ga0207712_10597079
284 Ga0207677_10002930
285 Ga0207677_10045728
286 Ga0207639_10318994
287 Ga0207675_101051226
288 Ga0207698_10412005
289 Ga0207698_10749600
290 Ga0265338_10014116
291 Ga0265328_10011776
292 Ga0265329_10141357
293 Ga0265339_10000166
294 Ga0265316_10001544
295 Ga0265314_10005227
296 Ga0265314_10350688
297 Ga0265342_10094936
298 Ga0373935_0910437
299 Ga0373937_0646187
300 Ga0395901_1245972
301 Ga0436365_0073102
302 Ga0436365_0495986
303 Ga0436361_1143030
304 Ga0466961_0151038
305 Ga0453684_0418232
306 Ga0466959_0381598
307 Ga0466959_0827853
308 Ga0466958_0436677
309 Ga0495617_025040
310 Ga0495603_0000410
311 Ga0495590_0303576
312 Ga0495580_0052758
313 Ga0495605_0067646
314 Ga0495585_0014833
315 Ga0495594_0000139
316 Ga0495583_0012817
317 Ga0495631_0026089
318 Ga0495644_0000001
319 Ga0495648_0073535
320 Ga0495642_0006879
321 Ga0495609_0028078
322 Ga0495633_0026284
323 Ga0495656_0301635
324 Ga0495668_0008837
325 Ga0495611_0017191
326 Ga0495625_0366267
327 Ga0495623_0307179
328 Ga0495669_0042114
329 Ga0495670_0169734
330 Ga0495673_0023476
331 Ga0495686_0043682
332 Ga0495593_0528599
333 Ga0496108_0023306
334 Ga0496110_0140603
335 Ga0496111_0011933
336 Ga0496111_0051984
337 Ga0496112_0267312
338 Ga0501034_1296515
339 Ga0501036_1402769
340 Ga0501038_0041629
341 Ga0501039_0004224
342 Ga0501040_0001017
343 Ga0501041_0006265
344 Ga0501042_0007893
345 Ga0501043_0128677
346 Ga0501067_0104192
347 Ga0501068_0027577
348 Ga0501070_0615232
349 Ga0501071_0001643
350 Ga0501072_0000274
351 Ga0501075_0000535
352 Ga0501076_0000673
353 Ga0501077_0000139
354 Ga0501079_0007460
355 Ga0501079_1061148
356 Ga0501080_0008249
357 Ga0501080_0065861
358 Ga0501081_0000679
359 Ga0501083_0010465
360 Ga0501044_0497083
361 Ga0501045_0007030
362 nmdc:mga00v17_173055_c1
363 nmdc:mga0n895_297422_c1
364 nmdc:mga0rr50_505496_c1
365 nmdc:mga0rr50_509888_c1
366 nmdc:mga08x19_1153_c1
367 nmdc:mga0a205_226489_c1
368 Ga0500614_055184
369 Ga0501084_0013145
370 Ga0501084_0066482
371 Ga0501082_0480091
372 Ga0530510_0002944

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

31

177

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gg5-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 0.7566 2 148
5ggc-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with phosphate and magnesium ions (excess magnesium, i) 0.7527 1 148
5deq-assembly1.cif.gz_A crystal structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi in complex with l-arabinose 0.7482 1 92
5xd4-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with atp (ii) 0.7437 1 148
6m72-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with 8-oxo-dgdp 0.7429 1 148
ID Description Score Start End Superfamily
af_O69700_2_149_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9606 2 144 3.90.79.10
af_O69700_2_149_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.923 2 144 3.90.79.10
af_Q95XC4_8_150_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7508 4 144 3.90.79.10
4v14B00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7424 3 142 3.90.79.10
af_Q19427_210_368_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.7197 3 130 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A6B9YV49-F1-model_v4 NUDIX domain-containing protein 0.9832 1 147 GO:0004081
GO:0006167
GO:0006754
AF-A0A526RQ06-F1-model_v4 NUDIX domain-containing protein 0.9824 1 140 GO:0004081
GO:0006167
GO:0006754
GO:0020037
AF-A0A257MJX0-F1-model_v4 NUDIX family hydrolase 0.982 1 145 GO:0004081
GO:0006167
GO:0006754
AF-A0A520IGE4-F1-model_v4 NUDIX domain-containing protein 0.9801 3 145 GO:0004081
GO:0006167
GO:0006754
AF-A0A5Q8CDL4-F1-model_v4 NUDIX domain-containing protein 0.9789 1 146 GO:0004081
GO:0006167
GO:0006754
GO:0020037

Map