F286497

General Info

Members Datasets Scaffolds Average Seq Length
186 150 372 324

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0000592|Ga0495650_0000592_10193_11263
Length 356
Sequence LPAPQDSAEDERVALRPVDTPTQPSLEELKMKYSKLGNTGLEVSPVCLGCMTYGVPERGTHPWTLNEEQSRPLIRQAIEAGINFFDTANVYSDGTSEEIVGRALKDFGRREELVIATKVHGRMHEGPNGAGLSRKSILQEADNSLRRLGTDYIDLYQIHRFDYGTPIEETLEALHDLVRAGKVRYIGASSMFAWQFATLLHTAKANGWTRFSTMQNYVNLLYREEEREMLPLCQAEGIGVMPWSPLARGRLTRPWDETSERAESDAFGKTLYAHTADADRKVVEAVASVAGARGVPPAQVALAWVLSRPAISAPIVGASRPAHLDDALAAIELKLSDDEIAELEAPYVPHAVVGFF

Samples

Sample ID Description Type Environment
1 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
11 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
12 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
13 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
14 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
15 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
16 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
17 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
18 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
19 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
21 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
22 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
25 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
26 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
27 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
28 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
29 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
30 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
31 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
46 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
48 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
49 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
50 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
51 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
52 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
53 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
54 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
55 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
56 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
57 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
58 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
59 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
60 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
61 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
62 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
63 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
64 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
65 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
66 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
67 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
68 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
69 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
70 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
71 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
72 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
73 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
74 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
75 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
76 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
77 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
78 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
79 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
80 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
81 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
82 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
83 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
84 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
85 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
86 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
87 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
88 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
89 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
90 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
91 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
92 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
93 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
94 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
95 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
96 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
97 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
98 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
99 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
107 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
108 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
109 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
110 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
111 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
112 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
116 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
117 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
118 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
119 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
120 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
121 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
122 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
123 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
124 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
125 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
126 2643221609 Acidovorax sp. Root217 Isolate Unclassified
127 2643221611 Acidovorax sp. Root219 Isolate Unclassified
128 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
129 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
130 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
131 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
132 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
133 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
134 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
135 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
136 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
137 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
138 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
139 2909042592 Labrys sp. LIt4 Isolate Nodule
140 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
141 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
142 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
143 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
144 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
145 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
146 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
147 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
148 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
149 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
150 8052494512 Pseudomonas putida LD6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 84.41
Metatranscriptomes 0
Isolates 15.59

Biome Distribution

Category Percentage (%)
Aerial Root 1.08
Bulb 0
Endosphere 4.84
Nodule 3.23
Rhizoplane 2.15
Rhizosphere 67.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495650_0000592 3300046471 Bacteria 50128
2 JGI24739J22299_10037609 3300001989 Bacteria 1630
3 JGI25151J46595_10000321 3300003187 Bacteria 51966
4 Ga0065704_10077291 3300005289 Bacteria 4782
5 Ga0070668_100098910 3300005347 Bacteria 2309
6 Ga0070669_100087937 3300005353 Bacteria 2324
7 Ga0070711_100014166 3300005439 Bacteria 5020
8 Ga0068867_100315057 3300005459 Bacteria 1294
9 Ga0070665_100001121 3300005548 Bacteria 32946
10 Ga0068859_100339085 3300005617 Bacteria 1597
11 Ga0068859_100522929 3300005617 Bacteria 1281
12 Ga0068858_100151884 3300005842 Bacteria 2178
13 Ga0068858_100301327 3300005842 Bacteria 1529
14 Ga0068862_100004937 3300005844 Bacteria 11228
15 Ga0075369_10010773 3300006186 Bacteria 3582
16 Ga0097620_100522922 3300006931 Bacteria 1281
17 Ga0099823_1015214 3300006944 Bacteria 7646
18 Ga0105251_10020760 3300009011 Bacteria 3444
19 Ga0105244_10002839 3300009036 Bacteria 12856
20 Ga0105247_10181416 3300009101 Bacteria 1405
21 Ga0114129_10645433 3300009147 Bacteria 1367
22 Ga0105248_10052100 3300009177 Bacteria 4593
23 Ga0105248_10261623 3300009177 Bacteria 1948
24 Ga0105248_10271789 3300009177 Bacteria 1908
25 Ga0105237_10071955 3300009545 Bacteria 3451
26 Ga0105249_10000061 3300009553 Bacteria 153313
27 Ga0157369_10002973 3300013105 Bacteria 20287
28 Ga0163162_10008656 3300013306 Bacteria 9907
29 Ga0163162_10114394 3300013306 Bacteria 2797
30 Ga0157372_10219626 3300013307 Bacteria 2203
31 Ga0157372_10220516 3300013307 Bacteria 2198
32 Ga0157372_10401251 3300013307 Bacteria 1598
33 Ga0163163_10037085 3300014325 Bacteria 4741
34 Ga0163163_10363195 3300014325 Bacteria 1504
35 Ga0182008_10004310 3300014497 Bacteria 8328
36 Ga0183363_1008 3300015690 Bacteria 194027
37 Ga0209025_1000224 3300025294 Bacteria 133328
38 Ga0209758_1009842 3300025297 Bacteria 5845
39 Ga0207655_1000795 3300025728 Bacteria 34442
40 Ga0207713_1002898 3300025735 Bacteria 12019
41 Ga0207705_10035342 3300025909 Bacteria 3575
42 Ga0207684_10079646 3300025910 Bacteria 2787
43 Ga0207695_10043698 3300025913 Bacteria 4774
44 Ga0207671_10194807 3300025914 Bacteria 1581
45 Ga0207663_10076677 3300025916 Bacteria 2173
46 Ga0207646_10156528 3300025922 Bacteria 2055
47 Ga0207691_10076202 3300025940 Bacteria 3023
48 Ga0207711_10007999 3300025941 Bacteria 8845
49 Ga0207712_10000154 3300025961 Bacteria 70578
50 Ga0207703_10444943 3300026035 Bacteria 1209
51 Ga0207648_10488870 3300026089 Bacteria 1125
52 Ga0207683_10360161 3300026121 Bacteria 1336
53 Ga0209389_1012676 3300027296 Bacteria 7654
54 Ga0268266_10000726 3300028379 Bacteria 44249
55 Ga0265327_10002235 3300031251 Bacteria 21020
56 Ga0265327_10081978 3300031251 Bacteria 1591
57 Ga0265316_10148502 3300031344 Bacteria 1757
58 Ga0307408_100038983 3300031548 Bacteria 3355
59 Ga0316576_10021081 3300031727 Bacteria 4500
60 Ga0316578_10102542 3300031728 Bacteria 1716
61 Ga0439436_0023744 3300041404 Bacteria 1813
62 Ga0450911_000265 3300042115 Bacteria 19523
63 Ga0466966_0113139 3300044684 Bacteria 1672
64 Ga0466970_0194496 3300044765 Bacteria 1128
65 Ga0495590_0000988 3300046457 Bacteria 12529
66 Ga0495653_0011880 3300046463 Bacteria 7113
67 Ga0495580_0164166 3300046472 Bacteria 1536
68 Ga0495582_0086005 3300046473 Bacteria 1749
69 Ga0495605_0001127 3300046474 Bacteria 17733
70 Ga0495639_0179592 3300046475 Bacteria 1030
71 Ga0495594_0012660 3300046499 Bacteria 4398
72 Ga0495606_0044444 3300046507 Bacteria 2954
73 Ga0495606_0113585 3300046507 Bacteria 1630
74 Ga0495610_0011438 3300046512 Bacteria 5426
75 Ga0495620_0000006 3300046515 Bacteria 273098
76 Ga0495630_0005642 3300046517 Bacteria 8841
77 Ga0495632_0008614 3300046519 Bacteria 6232
78 Ga0495643_0002355 3300046522 Bacteria 15142
79 Ga0495643_0002436 3300046522 Bacteria 14773
80 Ga0495648_0000267 3300046524 Bacteria 58885
81 Ga0495666_0016135 3300046526 Bacteria 3718
82 Ga0495665_0008627 3300046531 Bacteria 5532
83 Ga0495587_0027560 3300046536 Bacteria 3459
84 Ga0495668_0015561 3300046616 Bacteria 4439
85 Ga0495634_0007788 3300046642 Bacteria 8008
86 Ga0495661_0001770 3300046665 Bacteria 17370
87 Ga0495588_0020507 3300046674 Bacteria 3250
88 Ga0495588_0049432 3300046674 Bacteria 2162
89 Ga0495623_0013029 3300046679 Bacteria 5386
90 Ga0495669_0003069 3300046684 Bacteria 6870
91 Ga0495671_0017383 3300046692 Bacteria 3829
92 Ga0495604_0001463 3300047317 Bacteria 19424
93 Ga0495675_0005286 3300047444 Bacteria 7864
94 Ga0495673_0001589 3300047469 Bacteria 17721
95 Ga0495686_0000080 3300047472 Bacteria 201665
96 Ga0495602_0021370 3300048088 Bacteria 6373
97 Ga0496108_0212916 3300048911 Bacteria 1678
98 Ga0496110_0030840 3300048913 Bacteria 4624
99 Ga0496110_0037671 3300048913 Bacteria 4204
100 Ga0496114_0005080 3300048917 Bacteria 10254
101 Ga0496116_0028314 3300048919 Bacteria 4062
102 Ga0496117_0000492 3300048920 Bacteria 65349
103 Ga0496117_0011358 3300048920 Bacteria 7982
104 Ga0496117_0093652 3300048920 Bacteria 1926
105 Ga0496118_0008246 3300048921 Bacteria 10806
106 Ga0496118_0008849 3300048921 Bacteria 10301
107 Ga0496119_0000016 3300048922 Bacteria 309806
108 Ga0496120_0000310 3300048923 Bacteria 81092
109 Ga0496121_0000237 3300048924 Bacteria 118615
110 Ga0496121_0011603 3300048924 Bacteria 9749
111 Ga0496121_0113539 3300048924 Bacteria 2061
112 Ga0496122_0018996 3300048925 Bacteria 6305
113 Ga0496123_0005893 3300048926 Bacteria 12108
114 Ga0496124_0004805 3300048927 Bacteria 15558
115 Ga0496124_0010970 3300048927 Bacteria 9109
116 Ga0496124_0049676 3300048927 Bacteria 3577
117 Ga0496124_0139369 3300048927 Bacteria 1916
118 Ga0496124_0151045 3300048927 Bacteria 1822
119 Ga0496125_0038116 3300048928 Bacteria 4166
120 Ga0496125_0050082 3300048928 Bacteria 3462
121 Ga0496125_0101470 3300048928 Bacteria 2117
122 Ga0496125_0151750 3300048928 Bacteria 1590
123 Ga0496126_0012319 3300048929 Bacteria 8774
124 Ga0496126_0015089 3300048929 Bacteria 7783
125 Ga0496126_0060498 3300048929 Bacteria 3406
126 Ga0501031_0016181 3300049568 Bacteria 4845
127 Ga0501032_0002034 3300049569 Bacteria 15958
128 Ga0501033_0000137 3300049570 Bacteria 70576
129 Ga0501033_0088401 3300049570 Bacteria 2267
130 Ga0501034_0003889 3300049571 Bacteria 16799
131 Ga0501034_0111982 3300049571 Bacteria 2720
132 Ga0501037_0000085 3300049573 Bacteria 85731
133 Ga0501043_0000045 3300049579 Bacteria 114003
134 Ga0501047_0123478 3300049581 Bacteria 2470
135 Ga0501047_0289287 3300049581 Bacteria 1482
136 Ga0501068_0057349 3300049584 Bacteria 2361
137 Ga0501069_0000007 3300049585 Bacteria 182820
138 Ga0501070_0002412 3300049586 Bacteria 16397
139 Ga0501071_0022389 3300049587 Bacteria 4406
140 Ga0501074_0000248 3300049590 Bacteria 30421
141 Ga0501080_0001245 3300049742 Bacteria 21213
142 Ga0501080_0001715 3300049742 Bacteria 18725
143 Ga0501080_0321003 3300049742 Bacteria 1402
144 Ga0501083_0000029 3300049744 Bacteria 107507
145 Ga0501083_0096685 3300049744 Bacteria 1949
146 Ga0501035_0000060 3300049822 Bacteria 132293
147 Ga0501035_0004185 3300049822 Bacteria 13712
148 Ga0501035_0045756 3300049822 Bacteria 3936
149 Ga0501044_0000009 3300049823 Bacteria 270072
150 Ga0501044_0025319 3300049823 Bacteria 6288
151 nmdc:mga0sz30_20344_c1 3300050516 Bacteria 2009
152 Ga0500643_003982 3300053087 Bacteria 6833
153 Ga0500618_002398 3300053125 Bacteria 7131
154 Ga0500659_0026202 3300053135 Bacteria 3178
155 Ga0500637_0038939 3300053178 Bacteria 2680
156 Ga0501082_0104334 3300060353 Bacteria 2452
157 Ga0466962_0226646 3300061719 Bacteria 916
158 2510282839 2510065053 Bacteria 5005518
159 2510293510 2510065055 Bacteria 5037935
160 2510310881 2510065058 Bacteria 5005894
161 2523469136 2523231067 Bacteria 5230452
162 2644058479 2643221609 Bacteria 6756331
163 2644075939 2643221611 Bacteria 6820941
164 2753037656 2751185725 Bacteria 5740550
165 2753325524 2751185792 Bacteria 5739090
166 2774129325 2773857672 Bacteria 4993178
167 2810365855 2808606700 Bacteria 3482157
168 2842330831 2842324504 Bacteria 9364110
169 2842355170 2842348783 Bacteria 9002918
170 2842456156 2842454564 Bacteria 8730687
171 2852656644 2852653556 Bacteria 4050083
172 2862289245 2862281513 Bacteria 9621493
173 2889051570 2889049205 Bacteria 7524325
174 2905928388 2905926851 Bacteria 4423176
175 2909044692 2909042592 Bacteria 6499737
176 2917836755 2917832318 Bacteria 5346010
177 2919126011 2919125081 Bacteria 5385106
178 2919156395 2919155634 Bacteria 4860545
179 2974302466 2974298342 Bacteria 4840922
180 2984499982 2984499530 Bacteria 5020881
181 2984506400 2984504281 Bacteria 5262371
182 2995395341 2995392953 Bacteria 4539380
183 8002323932 8002317523 Bacteria 8051857
184 8016731597 8016728285 Bacteria 5263933
185 8045866399 8045864390 Bacteria 5043873
186 8052497032 8052494512 Bacteria 5765634
187 Ga0495650_0000592
188 JGI24739J22299_10037609
189 JGI25151J46595_10000321
190 Ga0065704_10077291
191 Ga0070668_100098910
192 Ga0070669_100087937
193 Ga0070711_100014166
194 Ga0068867_100315057
195 Ga0070665_100001121
196 Ga0068859_100339085
197 Ga0068859_100522929
198 Ga0068858_100151884
199 Ga0068858_100301327
200 Ga0068862_100004937
201 Ga0075369_10010773
202 Ga0097620_100522922
203 Ga0099823_1015214
204 Ga0105251_10020760
205 Ga0105244_10002839
206 Ga0105247_10181416
207 Ga0114129_10645433
208 Ga0105248_10052100
209 Ga0105248_10261623
210 Ga0105248_10271789
211 Ga0105237_10071955
212 Ga0105249_10000061
213 Ga0157369_10002973
214 Ga0163162_10008656
215 Ga0163162_10114394
216 Ga0157372_10219626
217 Ga0157372_10220516
218 Ga0157372_10401251
219 Ga0163163_10037085
220 Ga0163163_10363195
221 Ga0182008_10004310
222 Ga0183363_1008
223 Ga0209025_1000224
224 Ga0209758_1009842
225 Ga0207655_1000795
226 Ga0207713_1002898
227 Ga0207705_10035342
228 Ga0207684_10079646
229 Ga0207695_10043698
230 Ga0207671_10194807
231 Ga0207663_10076677
232 Ga0207646_10156528
233 Ga0207691_10076202
234 Ga0207711_10007999
235 Ga0207712_10000154
236 Ga0207703_10444943
237 Ga0207648_10488870
238 Ga0207683_10360161
239 Ga0209389_1012676
240 Ga0268266_10000726
241 Ga0265327_10002235
242 Ga0265327_10081978
243 Ga0265316_10148502
244 Ga0307408_100038983
245 Ga0316576_10021081
246 Ga0316578_10102542
247 Ga0439436_0023744
248 Ga0450911_000265
249 Ga0466966_0113139
250 Ga0466970_0194496
251 Ga0495590_0000988
252 Ga0495653_0011880
253 Ga0495580_0164166
254 Ga0495582_0086005
255 Ga0495605_0001127
256 Ga0495639_0179592
257 Ga0495594_0012660
258 Ga0495606_0044444
259 Ga0495606_0113585
260 Ga0495610_0011438
261 Ga0495620_0000006
262 Ga0495630_0005642
263 Ga0495632_0008614
264 Ga0495643_0002355
265 Ga0495643_0002436
266 Ga0495648_0000267
267 Ga0495666_0016135
268 Ga0495665_0008627
269 Ga0495587_0027560
270 Ga0495668_0015561
271 Ga0495634_0007788
272 Ga0495661_0001770
273 Ga0495588_0020507
274 Ga0495588_0049432
275 Ga0495623_0013029
276 Ga0495669_0003069
277 Ga0495671_0017383
278 Ga0495604_0001463
279 Ga0495675_0005286
280 Ga0495673_0001589
281 Ga0495686_0000080
282 Ga0495602_0021370
283 Ga0496108_0212916
284 Ga0496110_0030840
285 Ga0496110_0037671
286 Ga0496114_0005080
287 Ga0496116_0028314
288 Ga0496117_0000492
289 Ga0496117_0011358
290 Ga0496117_0093652
291 Ga0496118_0008246
292 Ga0496118_0008849
293 Ga0496119_0000016
294 Ga0496120_0000310
295 Ga0496121_0000237
296 Ga0496121_0011603
297 Ga0496121_0113539
298 Ga0496122_0018996
299 Ga0496123_0005893
300 Ga0496124_0004805
301 Ga0496124_0010970
302 Ga0496124_0049676
303 Ga0496124_0139369
304 Ga0496124_0151045
305 Ga0496125_0038116
306 Ga0496125_0050082
307 Ga0496125_0101470
308 Ga0496125_0151750
309 Ga0496126_0012319
310 Ga0496126_0015089
311 Ga0496126_0060498
312 Ga0501031_0016181
313 Ga0501032_0002034
314 Ga0501033_0000137
315 Ga0501033_0088401
316 Ga0501034_0003889
317 Ga0501034_0111982
318 Ga0501037_0000085
319 Ga0501043_0000045
320 Ga0501047_0123478
321 Ga0501047_0289287
322 Ga0501068_0057349
323 Ga0501069_0000007
324 Ga0501070_0002412
325 Ga0501071_0022389
326 Ga0501074_0000248
327 Ga0501080_0001245
328 Ga0501080_0001715
329 Ga0501080_0321003
330 Ga0501083_0000029
331 Ga0501083_0096685
332 Ga0501035_0000060
333 Ga0501035_0004185
334 Ga0501035_0045756
335 Ga0501044_0000009
336 Ga0501044_0025319
337 nmdc:mga0sz30_20344_c1
338 Ga0500643_003982
339 Ga0500618_002398
340 Ga0500659_0026202
341 Ga0500637_0038939
342 Ga0501082_0104334
343 Ga0466962_0226646
344 2510282839
345 2510293510
346 2510310881
347 2523469136
348 2644058479
349 2644075939
350 2753037656
351 2753325524
352 2774129325
353 2810365855
354 2842330831
355 2842355170
356 2842456156
357 2852656644
358 2862289245
359 2889051570
360 2905928388
361 2909044692
362 2917836755
363 2919126011
364 2919156395
365 2974302466
366 2984499982
367 2984506400
368 2995395341
369 8002323932
370 8016731597
371 8045866399
372 8052497032

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

45

347

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7utf-assembly2.cif.gz_B structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.936 1 417
7utf-assembly2.cif.gz_D structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9334 1 417
7utf-assembly1.cif.gz_A structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9279 1 417
3erp-assembly1.cif.gz_B-5 structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium 0.9198 1 412
4xk2-assembly2.cif.gz_B crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9178 1 412
ID Description Score Start End Superfamily
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9778 1 420 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9748 1 420 3.20.20.100
4xk2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9092 1 412 3.20.20.100
4xapA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9042 1 416 3.20.20.100
af_Q02895_4_341_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8963 1 416 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A2N5AB19-F1-model_v4 Aldo/keto reductase 0.9952 1 84 GO:0005829
AF-A0A257RV75-F1-model_v4 Alcohol dehydrogenase 0.9926 1 132 GO:0005829
AF-A0A257RV75-F1-model_v4 Alcohol dehydrogenase 0.9852 1 132 GO:0005829
AF-A0A5V0FK04-F1-model_v4 Aldo/keto reductase 0.9805 1 314 GO:0005829
AF-A0A3S4H1K3-F1-model_v4 Oxidoreductase (EC 1.1.1.-) 0.9795 1 80 GO:0005829
GO:0016491

Map