F287572

General Info

Members Datasets Scaffolds Average Seq Length
187 146 374 288

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10216528|Ga0105245_102165281
Length 317
Sequence MDNNIEEVTMEFAPEIDAPNPTPLKDLDEWEDFLKMRYPEGSQPGALGNADAHAEFIRADKKEEEFRDYRKEARASVKEFYRLNHTYQTFDFVQEKRREFLGLNRRKMGVWEAMEYLNQLVDDSDPDTDLSQLEHLLQTAESVRRDGHPGWMVLTGLIHDLGKILCLWGEPQWAVVGDTFPTGCKYSEKVVYPEFFDFNPDSNDAKLQTPCGVYEEGGGLDKVFMSWGHDEYLYHVTKDYLPDPALYMIRYHSFYAAHRERAYEHLMNAKDKEMFDWVRKFNPYDLYSKSDVPPNSKELRPYYESLIAEYFPPVLNW

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
52 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
53 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
54 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
55 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
85 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
86 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
95 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
96 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
101 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
102 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
103 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
106 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
107 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
108 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
109 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
110 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
114 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
115 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
116 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
117 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
118 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
119 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
121 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
122 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
123 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
124 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
125 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
126 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
127 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
128 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
129 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
130 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
131 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
132 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
133 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
134 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
135 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
136 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
137 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
138 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
139 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
140 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
141 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
142 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
143 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
144 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
145 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
146 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.7
Metatranscriptomes 1.07
Isolates 11.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.28
Nodule 0
Rhizoplane 0.53
Rhizosphere 76.47
Stem 0
Stem Tuber 0
Unclassified 10.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10216528 3300009098 Unclassified 1846
2 JGI25154J39366_1000072 3300002738 Bacteria 93790
3 JGI25157J39369_1004575 3300002741 Bacteria 2468
4 JGI25160J50197_1010291 3300003354 Bacteria 3393
5 Ga0065165_1039277 3300005262 Bacteria 1419
6 Ga0065714_10145875 3300005288 Bacteria 1139
7 Ga0065712_10217368 3300005290 Bacteria 1052
8 Ga0065715_10360404 3300005293 Bacteria 936
9 Ga0070658_10000043 3300005327 Bacteria 132337
10 Ga0070658_10000279 3300005327 Bacteria 44799
11 Ga0070676_10000002 3300005328 Bacteria 357662
12 Ga0070689_100002536 3300005340 Bacteria 11966
13 Ga0070661_100130794 3300005344 Bacteria 1885
14 Ga0070668_100126165 3300005347 Bacteria 2050
15 Ga0070674_100004998 3300005356 Bacteria 7606
16 Ga0070673_100029235 3300005364 Bacteria 4108
17 Ga0070688_100192483 3300005365 Bacteria 1422
18 Ga0070700_100199245 3300005441 Unclassified 1405
19 Ga0070694_100036824 3300005444 Bacteria 3243
20 Ga0070697_100398907 3300005536 Bacteria 1193
21 Ga0070686_100005554 3300005544 Bacteria 6977
22 Ga0070686_100011942 3300005544 Unclassified 4939
23 Ga0070695_100054782 3300005545 Bacteria 2568
24 Ga0070665_100256117 3300005548 Bacteria 1751
25 Ga0070704_100133582 3300005549 Eukaryota 1927
26 Ga0070702_100134751 3300005615 Bacteria 1565
27 Ga0081540_1003827 3300005983 Bacteria 11779
28 Ga0075436_100005615 3300006914 Bacteria 8608
29 Ga0105240_10000532 3300009093 Bacteria 70311
30 Ga0105240_10003797 3300009093 Bacteria 23330
31 Ga0105240_10016873 3300009093 Bacteria 9867
32 Ga0105240_10200182 3300009093 Bacteria 2341
33 Ga0105240_10638970 3300009093 Bacteria 1168
34 Ga0111539_10037717 3300009094 Bacteria 5834
35 Ga0111539_10231363 3300009094 Unclassified 2152
36 Ga0114129_10323038 3300009147 Bacteria 2051
37 Ga0105241_10269763 3300009174 Unclassified 1449
38 Ga0105248_10078968 3300009177 Bacteria 3699
39 Ga0105248_10487715 3300009177 Unclassified 1389
40 Ga0105237_10001666 3300009545 Bacteria 28772
41 Ga0105237_10132182 3300009545 Unclassified 2490
42 Ga0105237_10269912 3300009545 Bacteria 1704
43 Ga0105238_10400449 3300009551 Unclassified 1366
44 Ga0105238_10512964 3300009551 Bacteria 1201
45 Ga0105249_10280211 3300009553 Unclassified 1664
46 Ga0105239_10013247 3300010375 Bacteria 9166
47 Ga0157373_10000001 3300013100 Bacteria 864756
48 Ga0157370_10000073 3300013104 Bacteria 109460
49 Ga0157370_10254935 3300013104 Bacteria 1622
50 Ga0157369_10010171 3300013105 Bacteria 10736
51 Ga0157369_10086445 3300013105 Bacteria 3349
52 Ga0157369_10219125 3300013105 Bacteria 1992
53 Ga0157374_10101564 3300013296 Bacteria 2757
54 Ga0157374_10177628 3300013296 Bacteria 2078
55 Ga0157378_10244462 3300013297 Bacteria 1716
56 Ga0157372_10171695 3300013307 Unclassified 2509
57 Ga0157372_10282556 3300013307 Bacteria 1930
58 Ga0157372_10625769 3300013307 Bacteria 1254
59 Ga0157375_10120995 3300013308 Bacteria 2727
60 Ga0163163_10197698 3300014325 Bacteria 2059
61 Ga0163163_10325054 3300014325 Unclassified 1592
62 Ga0157380_10377632 3300014326 Bacteria 1336
63 Ga0157377_10139857 3300014745 Bacteria 1487
64 Ga0157377_10234153 3300014745 Unclassified 1182
65 Ga0157376_10177940 3300014969 Unclassified 1942
66 Ga0182006_1000292 3300015261 Bacteria 44107
67 Ga0182006_1014683 3300015261 Bacteria 3372
68 Ga0163161_10000155 3300017792 Bacteria 63345
69 Ga0206349_1932901 3300020075 Bacteria 993
70 Ga0154015_1454391 3300020610 Bacteria 1489
71 Ga0213875_10000094 3300021388 Bacteria 102400
72 Ga0213875_10003034 3300021388 Bacteria 9736
73 Ga0209646_1000037 3300025246 Bacteria 355116
74 Ga0209026_1000860 3300025250 Bacteria 15846
75 Ga0207426_1000193 3300025302 Bacteria 151669
76 Ga0207688_10149555 3300025901 Bacteria 1378
77 Ga0207680_10000699 3300025903 Bacteria 15770
78 Ga0207645_10000002 3300025907 Bacteria 289099
79 Ga0207645_10022050 3300025907 Bacteria 4148
80 Ga0207705_10000034 3300025909 Bacteria 216943
81 Ga0207705_10000311 3300025909 Bacteria 44823
82 Ga0207695_10000407 3300025913 Bacteria 95753
83 Ga0207695_10005624 3300025913 Bacteria 16548
84 Ga0207695_10013318 3300025913 Bacteria 9812
85 Ga0207695_10208688 3300025913 Bacteria 1865
86 Ga0207671_10042025 3300025914 Bacteria 3384
87 Ga0207671_10164297 3300025914 Bacteria 1720
88 Ga0207657_10371811 3300025919 Bacteria 1126
89 Ga0207652_10413170 3300025921 Bacteria 1217
90 Ga0207694_10280380 3300025924 Unclassified 1369
91 Ga0207650_10287316 3300025925 Bacteria 1340
92 Ga0207659_10040332 3300025926 Unclassified 3264
93 Ga0207659_10246942 3300025926 Bacteria 1446
94 Ga0207690_10356178 3300025932 Bacteria 1158
95 Ga0207670_10020144 3300025936 Bacteria 4092
96 Ga0207669_10274243 3300025937 Bacteria 1268
97 Ga0207691_10021879 3300025940 Bacteria 6035
98 Ga0207691_10309597 3300025940 Bacteria 1356
99 Ga0207667_10521810 3300025949 Bacteria 1203
100 Ga0207651_10039838 3300025960 Bacteria 3102
101 Ga0207641_10427343 3300026088 Bacteria 1277
102 Ga0207674_10407547 3300026116 Bacteria 1314
103 Ga0207698_10394033 3300026142 Bacteria 1321
104 Ga0268266_10001046 3300028379 Bacteria 34719
105 Ga0268266_10293339 3300028379 Unclassified 1515
106 Ga0307515_10199229 3300028794 Bacteria 1884
107 Ga0307408_100001353 3300031548 Bacteria 18332
108 Ga0307413_10037692 3300031824 Bacteria 2794
109 Ga0307410_10000223 3300031852 Bacteria 21373
110 Ga0307406_10000114 3300031901 Bacteria 46700
111 Ga0307407_10012251 3300031903 Bacteria 4114
112 Ga0307409_100163553 3300031995 Bacteria 1950
113 Ga0307414_10000079 3300032004 Bacteria 90645
114 Ga0307411_10000011 3300032005 Bacteria 204666
115 Ga0307411_10098723 3300032005 Bacteria 2059
116 Ga0307510_10066542 3300033180 Bacteria 3637
117 Ga0373927_0006925 3300035695 Bacteria 7699
118 Ga0373927_0015411 3300035695 Bacteria 5052
119 Ga0373937_0109697 3300036401 Unclassified 2566
120 Ga0373925_0287783 3300037068 Bacteria 1324
121 Ga0395900_0002222 3300037418 Bacteria 21676
122 Ga0395900_0046006 3300037418 Bacteria 4495
123 Ga0395898_0005709 3300037466 Bacteria 13411
124 Ga0395898_0501599 3300037466 Bacteria 1154
125 Ga0395905_0003393 3300037471 Bacteria 17050
126 Ga0395905_0033106 3300037471 Bacteria 4858
127 Ga0436364_1064665 3300037853 Bacteria 3311
128 Ga0436364_1476447 3300037853 Bacteria 31338
129 Ga0436365_1709814 3300039437 Unclassified 2667
130 Ga0436363_0295773 3300039450 Bacteria 1022
131 Ga0439447_003076 3300041407 Bacteria 5955
132 Ga0439460_0037029 3300042461 Bacteria 1418
133 Ga0451576_0019650 3300045051 Bacteria 7372
134 Ga0495580_0214254 3300046472 Bacteria 1324
135 Ga0495580_0384815 3300046472 Unclassified 947
136 Ga0495610_0125108 3300046512 Bacteria 1122
137 Ga0495645_0042822 3300046543 Bacteria 3302
138 Ga0495625_0252962 3300046660 Bacteria 1143
139 Ga0495671_0097976 3300046692 Bacteria 1434
140 Ga0495684_0004388 3300047471 Bacteria 11027
141 Ga0496112_0285491 3300048915 Unclassified 1597
142 Ga0496116_0000032 3300048919 Bacteria 419997
143 Ga0496118_0143003 3300048921 Bacteria 1512
144 Ga0496121_0040442 3300048924 Bacteria 4090
145 Ga0496124_0009820 3300048927 Bacteria 9789
146 Ga0496124_0369150 3300048927 Bacteria 1008
147 Ga0496125_0000111 3300048928 Bacteria 191489
148 Ga0496126_0000792 3300048929 Bacteria 56862
149 Ga0501034_0443419 3300049571 Bacteria 1217
150 Ga0501034_0696475 3300049571 Bacteria 915
151 Ga0501041_0210517 3300049577 Bacteria 1219
152 Ga0501075_0098992 3300049591 Bacteria 2214
153 Ga0501238_001008 3300049671 Bacteria 3213
154 Ga0501249_000005 3300049679 Bacteria 225972
155 Ga0501249_001259 3300049679 Bacteria 5316
156 Ga0501241_006843 3300049758 Bacteria 2096
157 Ga0501266_000006 3300049763 Bacteria 312183
158 Ga0501280_000900 3300049776 Bacteria 6356
159 Ga0501035_0237926 3300049822 Bacteria 1550
160 nmdc:mga08x19_17303_c1 3300050514 Bacteria 4410
161 Ga0495595_0087131 3300053084 Bacteria 1495
162 Ga0500644_0018423 3300053088 Bacteria 2045
163 Ga0500641_0000013 3300053096 Bacteria 156919
164 Ga0500641_0000117 3300053096 Bacteria 30553
165 Ga0500655_031320 3300053133 Bacteria 1025
166 Ga0500658_0000007 3300053134 Bacteria 284115
167 2513233796 2513020052 Bacteria 5120511
168 2644008829 2643221600 Bacteria 5530138
169 2644372677 2643221667 Bacteria 5627472
170 2644683191 2643221725 Bacteria 5087956
171 2738736929 2738541279 Bacteria 6149495
172 2738769493 2738541285 Bacteria 6150075
173 2739218511 2738543007 Bacteria 6149845
174 2740001463 2739367857 Bacteria 5433684
175 2740006279 2739367858 Bacteria 5432813
176 2802652919 2802428842 Bacteria 4926114
177 2833642594 2833640130 Bacteria 4858325
178 2857616867 2857613821 Bacteria 4917088
179 2857620698 2857618242 Bacteria 5635925
180 2904421208 2904419702 Bacteria 5166287
181 2919687369 2919683626 Bacteria 5534354
182 2929152374 2929150217 Bacteria 5462483
183 2929925990 2929921140 Bacteria 8649150
184 2977270980 2977268062 Bacteria 5243061
185 8003153054 8003151029 Bacteria 8187759
186 8054310644 8054307821 Bacteria 5212224
187 8055595603 8055592153 Bacteria 5961247
188 Ga0105245_10216528
189 JGI25154J39366_1000072
190 JGI25157J39369_1004575
191 JGI25160J50197_1010291
192 Ga0065165_1039277
193 Ga0065714_10145875
194 Ga0065712_10217368
195 Ga0065715_10360404
196 Ga0070658_10000043
197 Ga0070658_10000279
198 Ga0070676_10000002
199 Ga0070689_100002536
200 Ga0070661_100130794
201 Ga0070668_100126165
202 Ga0070674_100004998
203 Ga0070673_100029235
204 Ga0070688_100192483
205 Ga0070700_100199245
206 Ga0070694_100036824
207 Ga0070697_100398907
208 Ga0070686_100005554
209 Ga0070686_100011942
210 Ga0070695_100054782
211 Ga0070665_100256117
212 Ga0070704_100133582
213 Ga0070702_100134751
214 Ga0081540_1003827
215 Ga0075436_100005615
216 Ga0105240_10000532
217 Ga0105240_10003797
218 Ga0105240_10016873
219 Ga0105240_10200182
220 Ga0105240_10638970
221 Ga0111539_10037717
222 Ga0111539_10231363
223 Ga0114129_10323038
224 Ga0105241_10269763
225 Ga0105248_10078968
226 Ga0105248_10487715
227 Ga0105237_10001666
228 Ga0105237_10132182
229 Ga0105237_10269912
230 Ga0105238_10400449
231 Ga0105238_10512964
232 Ga0105249_10280211
233 Ga0105239_10013247
234 Ga0157373_10000001
235 Ga0157370_10000073
236 Ga0157370_10254935
237 Ga0157369_10010171
238 Ga0157369_10086445
239 Ga0157369_10219125
240 Ga0157374_10101564
241 Ga0157374_10177628
242 Ga0157378_10244462
243 Ga0157372_10171695
244 Ga0157372_10282556
245 Ga0157372_10625769
246 Ga0157375_10120995
247 Ga0163163_10197698
248 Ga0163163_10325054
249 Ga0157380_10377632
250 Ga0157377_10139857
251 Ga0157377_10234153
252 Ga0157376_10177940
253 Ga0182006_1000292
254 Ga0182006_1014683
255 Ga0163161_10000155
256 Ga0206349_1932901
257 Ga0154015_1454391
258 Ga0213875_10000094
259 Ga0213875_10003034
260 Ga0209646_1000037
261 Ga0209026_1000860
262 Ga0207426_1000193
263 Ga0207688_10149555
264 Ga0207680_10000699
265 Ga0207645_10000002
266 Ga0207645_10022050
267 Ga0207705_10000034
268 Ga0207705_10000311
269 Ga0207695_10000407
270 Ga0207695_10005624
271 Ga0207695_10013318
272 Ga0207695_10208688
273 Ga0207671_10042025
274 Ga0207671_10164297
275 Ga0207657_10371811
276 Ga0207652_10413170
277 Ga0207694_10280380
278 Ga0207650_10287316
279 Ga0207659_10040332
280 Ga0207659_10246942
281 Ga0207690_10356178
282 Ga0207670_10020144
283 Ga0207669_10274243
284 Ga0207691_10021879
285 Ga0207691_10309597
286 Ga0207667_10521810
287 Ga0207651_10039838
288 Ga0207641_10427343
289 Ga0207674_10407547
290 Ga0207698_10394033
291 Ga0268266_10001046
292 Ga0268266_10293339
293 Ga0307515_10199229
294 Ga0307408_100001353
295 Ga0307413_10037692
296 Ga0307410_10000223
297 Ga0307406_10000114
298 Ga0307407_10012251
299 Ga0307409_100163553
300 Ga0307414_10000079
301 Ga0307411_10000011
302 Ga0307411_10098723
303 Ga0307510_10066542
304 Ga0373927_0006925
305 Ga0373927_0015411
306 Ga0373937_0109697
307 Ga0373925_0287783
308 Ga0395900_0002222
309 Ga0395900_0046006
310 Ga0395898_0005709
311 Ga0395898_0501599
312 Ga0395905_0003393
313 Ga0395905_0033106
314 Ga0436364_1064665
315 Ga0436364_1476447
316 Ga0436365_1709814
317 Ga0436363_0295773
318 Ga0439447_003076
319 Ga0439460_0037029
320 Ga0451576_0019650
321 Ga0495580_0214254
322 Ga0495580_0384815
323 Ga0495610_0125108
324 Ga0495645_0042822
325 Ga0495625_0252962
326 Ga0495671_0097976
327 Ga0495684_0004388
328 Ga0496112_0285491
329 Ga0496116_0000032
330 Ga0496118_0143003
331 Ga0496121_0040442
332 Ga0496124_0009820
333 Ga0496124_0369150
334 Ga0496125_0000111
335 Ga0496126_0000792
336 Ga0501034_0443419
337 Ga0501034_0696475
338 Ga0501041_0210517
339 Ga0501075_0098992
340 Ga0501238_001008
341 Ga0501249_000005
342 Ga0501249_001259
343 Ga0501241_006843
344 Ga0501266_000006
345 Ga0501280_000900
346 Ga0501035_0237926
347 nmdc:mga08x19_17303_c1
348 Ga0495595_0087131
349 Ga0500644_0018423
350 Ga0500641_0000013
351 Ga0500641_0000117
352 Ga0500655_031320
353 Ga0500658_0000007
354 2513233796
355 2644008829
356 2644372677
357 2644683191
358 2738736929
359 2738769493
360 2739218511
361 2740001463
362 2740006279
363 2802652919
364 2833642594
365 2857616867
366 2857620698
367 2904421208
368 2919687369
369 2929152374
370 2929925990
371 2977270980
372 8003153054
373 8054310644
374 8055595603

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05153

MIOX

Myo-inositol oxygenase

74

317

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2huo-assembly1.cif.gz_A crystal structure of mouse myo-inositol oxygenase in complex with substrate 0.968 43 293
2ibn-assembly1.cif.gz_A crystal structure of human myo-inositol oxygenase (miox) 0.9468 51 293
2ibn-assembly2.cif.gz_B crystal structure of human myo-inositol oxygenase (miox) 0.9399 51 293
2huo-assembly1.cif.gz_A crystal structure of mouse myo-inositol oxygenase in complex with substrate 0.9387 43 293
2ibn-assembly1.cif.gz_A crystal structure of human myo-inositol oxygenase (miox) 0.9352 51 293
ID Description Score Start End Superfamily
af_Q9QXN4_37_285_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9771 51 293 1.10.3210.10
af_A0A1D6P1M6_55_306_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9759 51 293 1.10.3210.10
af_Q9QXN4_37_285_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9502 51 293 1.10.3210.10
af_A0A1D6P1M6_55_306_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9379 51 293 1.10.3210.10
4mlnB00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5154 86 284 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A2W0BBD3-F1-model_v4 Inositol oxygenase 0.9904 111 293 GO:0005506
GO:0005737
GO:0019310
GO:0050113
AF-A0A2N1MRT8-F1-model_v4 Inositol oxygenase (EC 1.13.99.1) (Myo-inositol oxygenase) 0.9878 84 291 GO:0005506
GO:0005737
GO:0019310
GO:0050113
AF-A0A1Q2YFQ0-F1-model_v4 Inositol oxygenase (EC 1.13.99.1) (Myo-inositol oxygenase) 0.9877 109 288 GO:0005506
GO:0005737
GO:0019310
GO:0050113
AF-A0A4S4KQN7-F1-model_v4 Inositol oxygenase (EC 1.13.99.1) (Myo-inositol oxygenase) 0.9869 109 293 GO:0005506
GO:0005737
GO:0019310
GO:0050113
AF-A0A3B8U6H5-F1-model_v4 Inositol oxygenase 0.9856 67 293 GO:0005506
GO:0005737
GO:0019310
GO:0050113

Map