F287572
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 187 | 146 | 374 | 288 |
Family's Representative Sequence
| Representative Sequence | 3300009098|Ga0105245_10216528|Ga0105245_102165281 |
| Length | 317 |
| Sequence | MDNNIEEVTMEFAPEIDAPNPTPLKDLDEWEDFLKMRYPEGSQPGALGNADAHAEFIRADKKEEEFRDYRKEARASVKEFYRLNHTYQTFDFVQEKRREFLGLNRRKMGVWEAMEYLNQLVDDSDPDTDLSQLEHLLQTAESVRRDGHPGWMVLTGLIHDLGKILCLWGEPQWAVVGDTFPTGCKYSEKVVYPEFFDFNPDSNDAKLQTPCGVYEEGGGLDKVFMSWGHDEYLYHVTKDYLPDPALYMIRYHSFYAAHRERAYEHLMNAKDKEMFDWVRKFNPYDLYSKSDVPPNSKELRPYYESLIAEYFPPVLNW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 3 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 4 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 26 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 27 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 48 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 50 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 51 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 52 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 53 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 54 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 77 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 78 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 79 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 80 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 81 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 82 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 83 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 84 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 85 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 86 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 87 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 88 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 89 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 90 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 91 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 92 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 93 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 94 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 95 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 96 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 97 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 98 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 105 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 106 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 107 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 108 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 109 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 110 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 111 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 112 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 113 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 114 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 115 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 116 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 117 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 118 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 119 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 120 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 121 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 123 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 124 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 125 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 126 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 127 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 128 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 129 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 130 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 131 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 132 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 133 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 134 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 135 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 136 | 2833640130 | Mariniflexile sp. TRM1-10 | Isolate | Rhizosphere |
| 137 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 138 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 139 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 140 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 141 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 142 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 143 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 144 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 145 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 146 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.7 |
| Metatranscriptomes | 1.07 |
| Isolates | 11.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.28 |
| Nodule | 0 |
| Rhizoplane | 0.53 |
| Rhizosphere | 76.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105245_10216528 | 3300009098 | Unclassified | 1846 |
| 2 | JGI25154J39366_1000072 | 3300002738 | Bacteria | 93790 |
| 3 | JGI25157J39369_1004575 | 3300002741 | Bacteria | 2468 |
| 4 | JGI25160J50197_1010291 | 3300003354 | Bacteria | 3393 |
| 5 | Ga0065165_1039277 | 3300005262 | Bacteria | 1419 |
| 6 | Ga0065714_10145875 | 3300005288 | Bacteria | 1139 |
| 7 | Ga0065712_10217368 | 3300005290 | Bacteria | 1052 |
| 8 | Ga0065715_10360404 | 3300005293 | Bacteria | 936 |
| 9 | Ga0070658_10000043 | 3300005327 | Bacteria | 132337 |
| 10 | Ga0070658_10000279 | 3300005327 | Bacteria | 44799 |
| 11 | Ga0070676_10000002 | 3300005328 | Bacteria | 357662 |
| 12 | Ga0070689_100002536 | 3300005340 | Bacteria | 11966 |
| 13 | Ga0070661_100130794 | 3300005344 | Bacteria | 1885 |
| 14 | Ga0070668_100126165 | 3300005347 | Bacteria | 2050 |
| 15 | Ga0070674_100004998 | 3300005356 | Bacteria | 7606 |
| 16 | Ga0070673_100029235 | 3300005364 | Bacteria | 4108 |
| 17 | Ga0070688_100192483 | 3300005365 | Bacteria | 1422 |
| 18 | Ga0070700_100199245 | 3300005441 | Unclassified | 1405 |
| 19 | Ga0070694_100036824 | 3300005444 | Bacteria | 3243 |
| 20 | Ga0070697_100398907 | 3300005536 | Bacteria | 1193 |
| 21 | Ga0070686_100005554 | 3300005544 | Bacteria | 6977 |
| 22 | Ga0070686_100011942 | 3300005544 | Unclassified | 4939 |
| 23 | Ga0070695_100054782 | 3300005545 | Bacteria | 2568 |
| 24 | Ga0070665_100256117 | 3300005548 | Bacteria | 1751 |
| 25 | Ga0070704_100133582 | 3300005549 | Eukaryota | 1927 |
| 26 | Ga0070702_100134751 | 3300005615 | Bacteria | 1565 |
| 27 | Ga0081540_1003827 | 3300005983 | Bacteria | 11779 |
| 28 | Ga0075436_100005615 | 3300006914 | Bacteria | 8608 |
| 29 | Ga0105240_10000532 | 3300009093 | Bacteria | 70311 |
| 30 | Ga0105240_10003797 | 3300009093 | Bacteria | 23330 |
| 31 | Ga0105240_10016873 | 3300009093 | Bacteria | 9867 |
| 32 | Ga0105240_10200182 | 3300009093 | Bacteria | 2341 |
| 33 | Ga0105240_10638970 | 3300009093 | Bacteria | 1168 |
| 34 | Ga0111539_10037717 | 3300009094 | Bacteria | 5834 |
| 35 | Ga0111539_10231363 | 3300009094 | Unclassified | 2152 |
| 36 | Ga0114129_10323038 | 3300009147 | Bacteria | 2051 |
| 37 | Ga0105241_10269763 | 3300009174 | Unclassified | 1449 |
| 38 | Ga0105248_10078968 | 3300009177 | Bacteria | 3699 |
| 39 | Ga0105248_10487715 | 3300009177 | Unclassified | 1389 |
| 40 | Ga0105237_10001666 | 3300009545 | Bacteria | 28772 |
| 41 | Ga0105237_10132182 | 3300009545 | Unclassified | 2490 |
| 42 | Ga0105237_10269912 | 3300009545 | Bacteria | 1704 |
| 43 | Ga0105238_10400449 | 3300009551 | Unclassified | 1366 |
| 44 | Ga0105238_10512964 | 3300009551 | Bacteria | 1201 |
| 45 | Ga0105249_10280211 | 3300009553 | Unclassified | 1664 |
| 46 | Ga0105239_10013247 | 3300010375 | Bacteria | 9166 |
| 47 | Ga0157373_10000001 | 3300013100 | Bacteria | 864756 |
| 48 | Ga0157370_10000073 | 3300013104 | Bacteria | 109460 |
| 49 | Ga0157370_10254935 | 3300013104 | Bacteria | 1622 |
| 50 | Ga0157369_10010171 | 3300013105 | Bacteria | 10736 |
| 51 | Ga0157369_10086445 | 3300013105 | Bacteria | 3349 |
| 52 | Ga0157369_10219125 | 3300013105 | Bacteria | 1992 |
| 53 | Ga0157374_10101564 | 3300013296 | Bacteria | 2757 |
| 54 | Ga0157374_10177628 | 3300013296 | Bacteria | 2078 |
| 55 | Ga0157378_10244462 | 3300013297 | Bacteria | 1716 |
| 56 | Ga0157372_10171695 | 3300013307 | Unclassified | 2509 |
| 57 | Ga0157372_10282556 | 3300013307 | Bacteria | 1930 |
| 58 | Ga0157372_10625769 | 3300013307 | Bacteria | 1254 |
| 59 | Ga0157375_10120995 | 3300013308 | Bacteria | 2727 |
| 60 | Ga0163163_10197698 | 3300014325 | Bacteria | 2059 |
| 61 | Ga0163163_10325054 | 3300014325 | Unclassified | 1592 |
| 62 | Ga0157380_10377632 | 3300014326 | Bacteria | 1336 |
| 63 | Ga0157377_10139857 | 3300014745 | Bacteria | 1487 |
| 64 | Ga0157377_10234153 | 3300014745 | Unclassified | 1182 |
| 65 | Ga0157376_10177940 | 3300014969 | Unclassified | 1942 |
| 66 | Ga0182006_1000292 | 3300015261 | Bacteria | 44107 |
| 67 | Ga0182006_1014683 | 3300015261 | Bacteria | 3372 |
| 68 | Ga0163161_10000155 | 3300017792 | Bacteria | 63345 |
| 69 | Ga0206349_1932901 | 3300020075 | Bacteria | 993 |
| 70 | Ga0154015_1454391 | 3300020610 | Bacteria | 1489 |
| 71 | Ga0213875_10000094 | 3300021388 | Bacteria | 102400 |
| 72 | Ga0213875_10003034 | 3300021388 | Bacteria | 9736 |
| 73 | Ga0209646_1000037 | 3300025246 | Bacteria | 355116 |
| 74 | Ga0209026_1000860 | 3300025250 | Bacteria | 15846 |
| 75 | Ga0207426_1000193 | 3300025302 | Bacteria | 151669 |
| 76 | Ga0207688_10149555 | 3300025901 | Bacteria | 1378 |
| 77 | Ga0207680_10000699 | 3300025903 | Bacteria | 15770 |
| 78 | Ga0207645_10000002 | 3300025907 | Bacteria | 289099 |
| 79 | Ga0207645_10022050 | 3300025907 | Bacteria | 4148 |
| 80 | Ga0207705_10000034 | 3300025909 | Bacteria | 216943 |
| 81 | Ga0207705_10000311 | 3300025909 | Bacteria | 44823 |
| 82 | Ga0207695_10000407 | 3300025913 | Bacteria | 95753 |
| 83 | Ga0207695_10005624 | 3300025913 | Bacteria | 16548 |
| 84 | Ga0207695_10013318 | 3300025913 | Bacteria | 9812 |
| 85 | Ga0207695_10208688 | 3300025913 | Bacteria | 1865 |
| 86 | Ga0207671_10042025 | 3300025914 | Bacteria | 3384 |
| 87 | Ga0207671_10164297 | 3300025914 | Bacteria | 1720 |
| 88 | Ga0207657_10371811 | 3300025919 | Bacteria | 1126 |
| 89 | Ga0207652_10413170 | 3300025921 | Bacteria | 1217 |
| 90 | Ga0207694_10280380 | 3300025924 | Unclassified | 1369 |
| 91 | Ga0207650_10287316 | 3300025925 | Bacteria | 1340 |
| 92 | Ga0207659_10040332 | 3300025926 | Unclassified | 3264 |
| 93 | Ga0207659_10246942 | 3300025926 | Bacteria | 1446 |
| 94 | Ga0207690_10356178 | 3300025932 | Bacteria | 1158 |
| 95 | Ga0207670_10020144 | 3300025936 | Bacteria | 4092 |
| 96 | Ga0207669_10274243 | 3300025937 | Bacteria | 1268 |
| 97 | Ga0207691_10021879 | 3300025940 | Bacteria | 6035 |
| 98 | Ga0207691_10309597 | 3300025940 | Bacteria | 1356 |
| 99 | Ga0207667_10521810 | 3300025949 | Bacteria | 1203 |
| 100 | Ga0207651_10039838 | 3300025960 | Bacteria | 3102 |
| 101 | Ga0207641_10427343 | 3300026088 | Bacteria | 1277 |
| 102 | Ga0207674_10407547 | 3300026116 | Bacteria | 1314 |
| 103 | Ga0207698_10394033 | 3300026142 | Bacteria | 1321 |
| 104 | Ga0268266_10001046 | 3300028379 | Bacteria | 34719 |
| 105 | Ga0268266_10293339 | 3300028379 | Unclassified | 1515 |
| 106 | Ga0307515_10199229 | 3300028794 | Bacteria | 1884 |
| 107 | Ga0307408_100001353 | 3300031548 | Bacteria | 18332 |
| 108 | Ga0307413_10037692 | 3300031824 | Bacteria | 2794 |
| 109 | Ga0307410_10000223 | 3300031852 | Bacteria | 21373 |
| 110 | Ga0307406_10000114 | 3300031901 | Bacteria | 46700 |
| 111 | Ga0307407_10012251 | 3300031903 | Bacteria | 4114 |
| 112 | Ga0307409_100163553 | 3300031995 | Bacteria | 1950 |
| 113 | Ga0307414_10000079 | 3300032004 | Bacteria | 90645 |
| 114 | Ga0307411_10000011 | 3300032005 | Bacteria | 204666 |
| 115 | Ga0307411_10098723 | 3300032005 | Bacteria | 2059 |
| 116 | Ga0307510_10066542 | 3300033180 | Bacteria | 3637 |
| 117 | Ga0373927_0006925 | 3300035695 | Bacteria | 7699 |
| 118 | Ga0373927_0015411 | 3300035695 | Bacteria | 5052 |
| 119 | Ga0373937_0109697 | 3300036401 | Unclassified | 2566 |
| 120 | Ga0373925_0287783 | 3300037068 | Bacteria | 1324 |
| 121 | Ga0395900_0002222 | 3300037418 | Bacteria | 21676 |
| 122 | Ga0395900_0046006 | 3300037418 | Bacteria | 4495 |
| 123 | Ga0395898_0005709 | 3300037466 | Bacteria | 13411 |
| 124 | Ga0395898_0501599 | 3300037466 | Bacteria | 1154 |
| 125 | Ga0395905_0003393 | 3300037471 | Bacteria | 17050 |
| 126 | Ga0395905_0033106 | 3300037471 | Bacteria | 4858 |
| 127 | Ga0436364_1064665 | 3300037853 | Bacteria | 3311 |
| 128 | Ga0436364_1476447 | 3300037853 | Bacteria | 31338 |
| 129 | Ga0436365_1709814 | 3300039437 | Unclassified | 2667 |
| 130 | Ga0436363_0295773 | 3300039450 | Bacteria | 1022 |
| 131 | Ga0439447_003076 | 3300041407 | Bacteria | 5955 |
| 132 | Ga0439460_0037029 | 3300042461 | Bacteria | 1418 |
| 133 | Ga0451576_0019650 | 3300045051 | Bacteria | 7372 |
| 134 | Ga0495580_0214254 | 3300046472 | Bacteria | 1324 |
| 135 | Ga0495580_0384815 | 3300046472 | Unclassified | 947 |
| 136 | Ga0495610_0125108 | 3300046512 | Bacteria | 1122 |
| 137 | Ga0495645_0042822 | 3300046543 | Bacteria | 3302 |
| 138 | Ga0495625_0252962 | 3300046660 | Bacteria | 1143 |
| 139 | Ga0495671_0097976 | 3300046692 | Bacteria | 1434 |
| 140 | Ga0495684_0004388 | 3300047471 | Bacteria | 11027 |
| 141 | Ga0496112_0285491 | 3300048915 | Unclassified | 1597 |
| 142 | Ga0496116_0000032 | 3300048919 | Bacteria | 419997 |
| 143 | Ga0496118_0143003 | 3300048921 | Bacteria | 1512 |
| 144 | Ga0496121_0040442 | 3300048924 | Bacteria | 4090 |
| 145 | Ga0496124_0009820 | 3300048927 | Bacteria | 9789 |
| 146 | Ga0496124_0369150 | 3300048927 | Bacteria | 1008 |
| 147 | Ga0496125_0000111 | 3300048928 | Bacteria | 191489 |
| 148 | Ga0496126_0000792 | 3300048929 | Bacteria | 56862 |
| 149 | Ga0501034_0443419 | 3300049571 | Bacteria | 1217 |
| 150 | Ga0501034_0696475 | 3300049571 | Bacteria | 915 |
| 151 | Ga0501041_0210517 | 3300049577 | Bacteria | 1219 |
| 152 | Ga0501075_0098992 | 3300049591 | Bacteria | 2214 |
| 153 | Ga0501238_001008 | 3300049671 | Bacteria | 3213 |
| 154 | Ga0501249_000005 | 3300049679 | Bacteria | 225972 |
| 155 | Ga0501249_001259 | 3300049679 | Bacteria | 5316 |
| 156 | Ga0501241_006843 | 3300049758 | Bacteria | 2096 |
| 157 | Ga0501266_000006 | 3300049763 | Bacteria | 312183 |
| 158 | Ga0501280_000900 | 3300049776 | Bacteria | 6356 |
| 159 | Ga0501035_0237926 | 3300049822 | Bacteria | 1550 |
| 160 | nmdc:mga08x19_17303_c1 | 3300050514 | Bacteria | 4410 |
| 161 | Ga0495595_0087131 | 3300053084 | Bacteria | 1495 |
| 162 | Ga0500644_0018423 | 3300053088 | Bacteria | 2045 |
| 163 | Ga0500641_0000013 | 3300053096 | Bacteria | 156919 |
| 164 | Ga0500641_0000117 | 3300053096 | Bacteria | 30553 |
| 165 | Ga0500655_031320 | 3300053133 | Bacteria | 1025 |
| 166 | Ga0500658_0000007 | 3300053134 | Bacteria | 284115 |
| 167 | 2513233796 | 2513020052 | Bacteria | 5120511 |
| 168 | 2644008829 | 2643221600 | Bacteria | 5530138 |
| 169 | 2644372677 | 2643221667 | Bacteria | 5627472 |
| 170 | 2644683191 | 2643221725 | Bacteria | 5087956 |
| 171 | 2738736929 | 2738541279 | Bacteria | 6149495 |
| 172 | 2738769493 | 2738541285 | Bacteria | 6150075 |
| 173 | 2739218511 | 2738543007 | Bacteria | 6149845 |
| 174 | 2740001463 | 2739367857 | Bacteria | 5433684 |
| 175 | 2740006279 | 2739367858 | Bacteria | 5432813 |
| 176 | 2802652919 | 2802428842 | Bacteria | 4926114 |
| 177 | 2833642594 | 2833640130 | Bacteria | 4858325 |
| 178 | 2857616867 | 2857613821 | Bacteria | 4917088 |
| 179 | 2857620698 | 2857618242 | Bacteria | 5635925 |
| 180 | 2904421208 | 2904419702 | Bacteria | 5166287 |
| 181 | 2919687369 | 2919683626 | Bacteria | 5534354 |
| 182 | 2929152374 | 2929150217 | Bacteria | 5462483 |
| 183 | 2929925990 | 2929921140 | Bacteria | 8649150 |
| 184 | 2977270980 | 2977268062 | Bacteria | 5243061 |
| 185 | 8003153054 | 8003151029 | Bacteria | 8187759 |
| 186 | 8054310644 | 8054307821 | Bacteria | 5212224 |
| 187 | 8055595603 | 8055592153 | Bacteria | 5961247 |
| 188 | Ga0105245_10216528 | |||
| 189 | JGI25154J39366_1000072 | |||
| 190 | JGI25157J39369_1004575 | |||
| 191 | JGI25160J50197_1010291 | |||
| 192 | Ga0065165_1039277 | |||
| 193 | Ga0065714_10145875 | |||
| 194 | Ga0065712_10217368 | |||
| 195 | Ga0065715_10360404 | |||
| 196 | Ga0070658_10000043 | |||
| 197 | Ga0070658_10000279 | |||
| 198 | Ga0070676_10000002 | |||
| 199 | Ga0070689_100002536 | |||
| 200 | Ga0070661_100130794 | |||
| 201 | Ga0070668_100126165 | |||
| 202 | Ga0070674_100004998 | |||
| 203 | Ga0070673_100029235 | |||
| 204 | Ga0070688_100192483 | |||
| 205 | Ga0070700_100199245 | |||
| 206 | Ga0070694_100036824 | |||
| 207 | Ga0070697_100398907 | |||
| 208 | Ga0070686_100005554 | |||
| 209 | Ga0070686_100011942 | |||
| 210 | Ga0070695_100054782 | |||
| 211 | Ga0070665_100256117 | |||
| 212 | Ga0070704_100133582 | |||
| 213 | Ga0070702_100134751 | |||
| 214 | Ga0081540_1003827 | |||
| 215 | Ga0075436_100005615 | |||
| 216 | Ga0105240_10000532 | |||
| 217 | Ga0105240_10003797 | |||
| 218 | Ga0105240_10016873 | |||
| 219 | Ga0105240_10200182 | |||
| 220 | Ga0105240_10638970 | |||
| 221 | Ga0111539_10037717 | |||
| 222 | Ga0111539_10231363 | |||
| 223 | Ga0114129_10323038 | |||
| 224 | Ga0105241_10269763 | |||
| 225 | Ga0105248_10078968 | |||
| 226 | Ga0105248_10487715 | |||
| 227 | Ga0105237_10001666 | |||
| 228 | Ga0105237_10132182 | |||
| 229 | Ga0105237_10269912 | |||
| 230 | Ga0105238_10400449 | |||
| 231 | Ga0105238_10512964 | |||
| 232 | Ga0105249_10280211 | |||
| 233 | Ga0105239_10013247 | |||
| 234 | Ga0157373_10000001 | |||
| 235 | Ga0157370_10000073 | |||
| 236 | Ga0157370_10254935 | |||
| 237 | Ga0157369_10010171 | |||
| 238 | Ga0157369_10086445 | |||
| 239 | Ga0157369_10219125 | |||
| 240 | Ga0157374_10101564 | |||
| 241 | Ga0157374_10177628 | |||
| 242 | Ga0157378_10244462 | |||
| 243 | Ga0157372_10171695 | |||
| 244 | Ga0157372_10282556 | |||
| 245 | Ga0157372_10625769 | |||
| 246 | Ga0157375_10120995 | |||
| 247 | Ga0163163_10197698 | |||
| 248 | Ga0163163_10325054 | |||
| 249 | Ga0157380_10377632 | |||
| 250 | Ga0157377_10139857 | |||
| 251 | Ga0157377_10234153 | |||
| 252 | Ga0157376_10177940 | |||
| 253 | Ga0182006_1000292 | |||
| 254 | Ga0182006_1014683 | |||
| 255 | Ga0163161_10000155 | |||
| 256 | Ga0206349_1932901 | |||
| 257 | Ga0154015_1454391 | |||
| 258 | Ga0213875_10000094 | |||
| 259 | Ga0213875_10003034 | |||
| 260 | Ga0209646_1000037 | |||
| 261 | Ga0209026_1000860 | |||
| 262 | Ga0207426_1000193 | |||
| 263 | Ga0207688_10149555 | |||
| 264 | Ga0207680_10000699 | |||
| 265 | Ga0207645_10000002 | |||
| 266 | Ga0207645_10022050 | |||
| 267 | Ga0207705_10000034 | |||
| 268 | Ga0207705_10000311 | |||
| 269 | Ga0207695_10000407 | |||
| 270 | Ga0207695_10005624 | |||
| 271 | Ga0207695_10013318 | |||
| 272 | Ga0207695_10208688 | |||
| 273 | Ga0207671_10042025 | |||
| 274 | Ga0207671_10164297 | |||
| 275 | Ga0207657_10371811 | |||
| 276 | Ga0207652_10413170 | |||
| 277 | Ga0207694_10280380 | |||
| 278 | Ga0207650_10287316 | |||
| 279 | Ga0207659_10040332 | |||
| 280 | Ga0207659_10246942 | |||
| 281 | Ga0207690_10356178 | |||
| 282 | Ga0207670_10020144 | |||
| 283 | Ga0207669_10274243 | |||
| 284 | Ga0207691_10021879 | |||
| 285 | Ga0207691_10309597 | |||
| 286 | Ga0207667_10521810 | |||
| 287 | Ga0207651_10039838 | |||
| 288 | Ga0207641_10427343 | |||
| 289 | Ga0207674_10407547 | |||
| 290 | Ga0207698_10394033 | |||
| 291 | Ga0268266_10001046 | |||
| 292 | Ga0268266_10293339 | |||
| 293 | Ga0307515_10199229 | |||
| 294 | Ga0307408_100001353 | |||
| 295 | Ga0307413_10037692 | |||
| 296 | Ga0307410_10000223 | |||
| 297 | Ga0307406_10000114 | |||
| 298 | Ga0307407_10012251 | |||
| 299 | Ga0307409_100163553 | |||
| 300 | Ga0307414_10000079 | |||
| 301 | Ga0307411_10000011 | |||
| 302 | Ga0307411_10098723 | |||
| 303 | Ga0307510_10066542 | |||
| 304 | Ga0373927_0006925 | |||
| 305 | Ga0373927_0015411 | |||
| 306 | Ga0373937_0109697 | |||
| 307 | Ga0373925_0287783 | |||
| 308 | Ga0395900_0002222 | |||
| 309 | Ga0395900_0046006 | |||
| 310 | Ga0395898_0005709 | |||
| 311 | Ga0395898_0501599 | |||
| 312 | Ga0395905_0003393 | |||
| 313 | Ga0395905_0033106 | |||
| 314 | Ga0436364_1064665 | |||
| 315 | Ga0436364_1476447 | |||
| 316 | Ga0436365_1709814 | |||
| 317 | Ga0436363_0295773 | |||
| 318 | Ga0439447_003076 | |||
| 319 | Ga0439460_0037029 | |||
| 320 | Ga0451576_0019650 | |||
| 321 | Ga0495580_0214254 | |||
| 322 | Ga0495580_0384815 | |||
| 323 | Ga0495610_0125108 | |||
| 324 | Ga0495645_0042822 | |||
| 325 | Ga0495625_0252962 | |||
| 326 | Ga0495671_0097976 | |||
| 327 | Ga0495684_0004388 | |||
| 328 | Ga0496112_0285491 | |||
| 329 | Ga0496116_0000032 | |||
| 330 | Ga0496118_0143003 | |||
| 331 | Ga0496121_0040442 | |||
| 332 | Ga0496124_0009820 | |||
| 333 | Ga0496124_0369150 | |||
| 334 | Ga0496125_0000111 | |||
| 335 | Ga0496126_0000792 | |||
| 336 | Ga0501034_0443419 | |||
| 337 | Ga0501034_0696475 | |||
| 338 | Ga0501041_0210517 | |||
| 339 | Ga0501075_0098992 | |||
| 340 | Ga0501238_001008 | |||
| 341 | Ga0501249_000005 | |||
| 342 | Ga0501249_001259 | |||
| 343 | Ga0501241_006843 | |||
| 344 | Ga0501266_000006 | |||
| 345 | Ga0501280_000900 | |||
| 346 | Ga0501035_0237926 | |||
| 347 | nmdc:mga08x19_17303_c1 | |||
| 348 | Ga0495595_0087131 | |||
| 349 | Ga0500644_0018423 | |||
| 350 | Ga0500641_0000013 | |||
| 351 | Ga0500641_0000117 | |||
| 352 | Ga0500655_031320 | |||
| 353 | Ga0500658_0000007 | |||
| 354 | 2513233796 | |||
| 355 | 2644008829 | |||
| 356 | 2644372677 | |||
| 357 | 2644683191 | |||
| 358 | 2738736929 | |||
| 359 | 2738769493 | |||
| 360 | 2739218511 | |||
| 361 | 2740001463 | |||
| 362 | 2740006279 | |||
| 363 | 2802652919 | |||
| 364 | 2833642594 | |||
| 365 | 2857616867 | |||
| 366 | 2857620698 | |||
| 367 | 2904421208 | |||
| 368 | 2919687369 | |||
| 369 | 2929152374 | |||
| 370 | 2929925990 | |||
| 371 | 2977270980 | |||
| 372 | 8003153054 | |||
| 373 | 8054310644 | |||
| 374 | 8055595603 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2huo-assembly1.cif.gz_A | crystal structure of mouse myo-inositol oxygenase in complex with substrate | 0.968 | 43 | 293 |
| 2ibn-assembly1.cif.gz_A | crystal structure of human myo-inositol oxygenase (miox) | 0.9468 | 51 | 293 |
| 2ibn-assembly2.cif.gz_B | crystal structure of human myo-inositol oxygenase (miox) | 0.9399 | 51 | 293 |
| 2huo-assembly1.cif.gz_A | crystal structure of mouse myo-inositol oxygenase in complex with substrate | 0.9387 | 43 | 293 |
| 2ibn-assembly1.cif.gz_A | crystal structure of human myo-inositol oxygenase (miox) | 0.9352 | 51 | 293 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9QXN4_37_285_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.9771 | 51 | 293 | 1.10.3210.10 |
| af_A0A1D6P1M6_55_306_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.9759 | 51 | 293 | 1.10.3210.10 |
| af_Q9QXN4_37_285_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.9502 | 51 | 293 | 1.10.3210.10 |
| af_A0A1D6P1M6_55_306_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.9379 | 51 | 293 | 1.10.3210.10 |
| 4mlnB00 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.5154 | 86 | 284 | 1.10.3210.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W0BBD3-F1-model_v4 | Inositol oxygenase | 0.9904 | 111 | 293 |
GO:0005506
GO:0005737 GO:0019310 GO:0050113 |
| AF-A0A2N1MRT8-F1-model_v4 | Inositol oxygenase (EC 1.13.99.1) (Myo-inositol oxygenase) | 0.9878 | 84 | 291 |
GO:0005506
GO:0005737 GO:0019310 GO:0050113 |
| AF-A0A1Q2YFQ0-F1-model_v4 | Inositol oxygenase (EC 1.13.99.1) (Myo-inositol oxygenase) | 0.9877 | 109 | 288 |
GO:0005506
GO:0005737 GO:0019310 GO:0050113 |
| AF-A0A4S4KQN7-F1-model_v4 | Inositol oxygenase (EC 1.13.99.1) (Myo-inositol oxygenase) | 0.9869 | 109 | 293 |
GO:0005506
GO:0005737 GO:0019310 GO:0050113 |
| AF-A0A3B8U6H5-F1-model_v4 | Inositol oxygenase | 0.9856 | 67 | 293 |
GO:0005506
GO:0005737 GO:0019310 GO:0050113 |