F288159

General Info

Members Datasets Scaffolds Average Seq Length
187 137 374 280

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0046928|Ga0495650_0046928_566_1423
Length 285
Sequence VQIIRDLSTLRTALRELRAKGERIALVPTMGALHEGHMALVAEGARRADHVVVSIFVNPKQFGPNEDLAAYPRREAQDSAMLETAGVALLWIPAVKQMYPDGFSTTVSVTGVSDELDGAARPRHFDGVATVVSKLFNQVRPDVALFGEKDYQQLAVIRRMVADLDFGGEDGLEIVGVPTQRAEDGLALSSRNAYLSTEERAAALALPRALSEAAGRIVAGVDIAAVLEEAVDHLKAHGFGSVDYVSLRDAATLAPMTSLDRPGRLLAAARIGTTRLIDNLAVNPA

Samples

Sample ID Description Type Environment
1 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
37 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
38 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
39 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
40 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
91 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
92 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
93 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
94 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
95 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
96 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
97 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
98 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
99 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
100 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
101 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
102 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
103 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
104 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
105 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
106 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
117 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
118 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
119 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
120 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
121 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
122 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
123 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
127 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
128 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
129 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
130 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
131 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
132 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
133 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
134 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
135 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
136 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
137 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.86
Metatranscriptomes 0
Isolates 2.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.76
Nodule 0
Rhizoplane 0
Rhizosphere 79.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495650_0046928 3300046471 Bacteria 1809
2 JGI25165J46597_1000166 3300003214 Bacteria 103861
3 Ga0055536_1006424 3300003781 Bacteria 5495
4 Ga0055536_1013755 3300003781 Bacteria 2888
5 Ga0055530_10000115 3300003791 Bacteria 70229
6 Ga0055531_10006063 3300003794 Bacteria 6926
7 Ga0055531_10006683 3300003794 Bacteria 6467
8 Ga0070676_10088437 3300005328 Bacteria 1893
9 Ga0070683_100176972 3300005329 Bacteria 2025
10 Ga0070670_100249475 3300005331 Bacteria 1546
11 Ga0070666_10004555 3300005335 Bacteria 8451
12 Ga0068868_100000324 3300005338 Bacteria 32116
13 Ga0070661_100000155 3300005344 Bacteria 56344
14 Ga0070668_100000011 3300005347 Bacteria 123099
15 Ga0070668_100000081 3300005347 Bacteria 59959
16 Ga0070669_100000031 3300005353 Bacteria 154042
17 Ga0070675_100017569 3300005354 Bacteria 5686
18 Ga0070671_100000262 3300005355 Bacteria 35350
19 Ga0070671_100489678 3300005355 Bacteria 1057
20 Ga0070659_100000010 3300005366 Bacteria 188277
21 Ga0070667_100000211 3300005367 Bacteria 67927
22 Ga0070667_100002653 3300005367 Bacteria 15485
23 Ga0070663_100361004 3300005455 Bacteria 1178
24 Ga0070679_100000001 3300005530 Bacteria 764811
25 Ga0070686_100001128 3300005544 Bacteria 15352
26 Ga0070665_100140179 3300005548 Bacteria 2421
27 Ga0070665_100185326 3300005548 Bacteria 2082
28 Ga0068857_100196405 3300005577 Bacteria 1838
29 Ga0068854_100026443 3300005578 Bacteria 3988
30 Ga0068859_100076956 3300005617 Bacteria 3377
31 Ga0068861_100013007 3300005719 Bacteria 5816
32 Ga0068863_100000178 3300005841 Bacteria 67693
33 Ga0068863_100000186 3300005841 Bacteria 65963
34 Ga0068863_100002215 3300005841 Bacteria 19306
35 Ga0068858_100000275 3300005842 Bacteria 55318
36 Ga0068860_100016001 3300005843 Bacteria 7318
37 Ga0068860_100018050 3300005843 Bacteria 6870
38 Ga0068860_100026835 3300005843 Bacteria 5550
39 Ga0068862_100000043 3300005844 Bacteria 164356
40 Ga0068862_100000287 3300005844 Bacteria 55746
41 Ga0068862_100034563 3300005844 Bacteria 4278
42 Ga0068862_100055653 3300005844 Bacteria 3389
43 Ga0097620_100076954 3300006931 Bacteria 3377
44 Ga0105245_10005786 3300009098 Bacteria 10848
45 Ga0105245_10028537 3300009098 Bacteria 4924
46 Ga0105238_10065129 3300009551 Bacteria 3645
47 Ga0105249_10000065 3300009553 Bacteria 151159
48 Ga0157372_10272301 3300013307 Bacteria 1968
49 Ga0157372_10610936 3300013307 Bacteria 1271
50 Ga0157375_10069429 3300013308 Bacteria 3530
51 Ga0213873_10000023 3300021358 Bacteria 102573
52 Ga0213876_10000091 3300021384 Bacteria 102527
53 Ga0213876_10003740 3300021384 Bacteria 8628
54 Ga0213875_10001550 3300021388 Bacteria 14740
55 Ga0209233_1000222 3300025261 Bacteria 103917
56 Ga0209675_1000104 3300025291 Bacteria 121249
57 Ga0209676_1000807 3300025292 Bacteria 41068
58 Ga0209676_1001060 3300025292 Bacteria 31500
59 Ga0209676_1001199 3300025292 Bacteria 27715
60 Ga0209050_1000286 3300025298 Bacteria 106566
61 Ga0209050_1039103 3300025298 Bacteria 1342
62 Ga0209257_1000245 3300025304 Bacteria 125987
63 Ga0209257_1000321 3300025304 Bacteria 100476
64 Ga0207680_10002537 3300025903 Bacteria 8513
65 Ga0207647_10100212 3300025904 Bacteria 1720
66 Ga0207645_10052493 3300025907 Bacteria 2605
67 Ga0207705_10228042 3300025909 Bacteria 1416
68 Ga0207695_10042473 3300025913 Bacteria 4855
69 Ga0207671_10165123 3300025914 Bacteria 1716
70 Ga0207657_10023431 3300025919 Bacteria 5748
71 Ga0207649_10000016 3300025920 Bacteria 243843
72 Ga0207649_10064614 3300025920 Bacteria 2314
73 Ga0207652_10000002 3300025921 Bacteria 878035
74 Ga0207681_10000014 3300025923 Bacteria 353422
75 Ga0207694_10043715 3300025924 Bacteria 3458
76 Ga0207650_10148957 3300025925 Bacteria 1845
77 Ga0207659_10017485 3300025926 Bacteria 4685
78 Ga0207687_10003268 3300025927 Bacteria 10972
79 Ga0207687_10122527 3300025927 Bacteria 1947
80 Ga0207644_10000032 3300025931 Bacteria 133759
81 Ga0207690_10000020 3300025932 Bacteria 218439
82 Ga0207706_10058097 3300025933 Bacteria 3408
83 Ga0207689_10140528 3300025942 Bacteria 1989
84 Ga0207679_10231194 3300025945 Bacteria 1561
85 Ga0207712_10000002 3300025961 Bacteria 706628
86 Ga0207668_10000034 3300025972 Bacteria 119274
87 Ga0207668_10000079 3300025972 Bacteria 72795
88 Ga0207668_10009274 3300025972 Bacteria 5889
89 Ga0207640_10037471 3300025981 Bacteria 3051
90 Ga0207658_10000180 3300025986 Bacteria 67969
91 Ga0207658_10002271 3300025986 Bacteria 14204
92 Ga0207677_10000193 3300026023 Bacteria 49439
93 Ga0207703_10000334 3300026035 Bacteria 51370
94 Ga0207678_10018913 3300026067 Bacteria 6053
95 Ga0207641_10000031 3300026088 Bacteria 224320
96 Ga0207641_10000256 3300026088 Bacteria 67708
97 Ga0207641_10001897 3300026088 Bacteria 20070
98 Ga0207675_100001954 3300026118 Bacteria 20590
99 Ga0207698_10110296 3300026142 Bacteria 2304
100 Ga0268266_10037158 3300028379 Bacteria 4149
101 Ga0268265_10000013 3300028380 Bacteria 341536
102 Ga0268265_10000141 3300028380 Bacteria 91426
103 Ga0268265_10014328 3300028380 Bacteria 5400
104 Ga0268264_10000785 3300028381 Bacteria 34613
105 Ga0268264_10000788 3300028381 Bacteria 34588
106 Ga0268264_10018796 3300028381 Bacteria 5650
107 Ga0307513_10007346 3300031456 Bacteria 14298
108 Ga0307408_100107995 3300031548 Bacteria 2132
109 Ga0307408_100327888 3300031548 Bacteria 1292
110 Ga0307508_10000286 3300031616 Bacteria 62006
111 Ga0307410_10127009 3300031852 Bacteria 1868
112 Ga0307406_10128387 3300031901 Bacteria 1775
113 Ga0307412_10000811 3300031911 Bacteria 17991
114 Ga0307412_10119017 3300031911 Bacteria 1898
115 Ga0307412_10371831 3300031911 Bacteria 1154
116 Ga0307409_100154710 3300031995 Bacteria 1996
117 Ga0307416_100174482 3300032002 Bacteria 2006
118 Ga0307416_100328907 3300032002 Bacteria 1535
119 Ga0307416_100451268 3300032002 Bacteria 1338
120 Ga0307414_10000197 3300032004 Bacteria 40591
121 Ga0307414_10011075 3300032004 Bacteria 5274
122 Ga0307414_10106642 3300032004 Bacteria 2121
123 Ga0307414_10121507 3300032004 Bacteria 2009
124 Ga0307411_10013116 3300032005 Bacteria 4557
125 Ga0307415_100055483 3300032126 Bacteria 2711
126 Ga0436364_1172297 3300037853 Bacteria 30221
127 Ga0395901_0010466 3300038443 Bacteria 9395
128 Ga0395901_0135155 3300038443 Bacteria 2592
129 Ga0436365_1312492 3300039437 Bacteria 36510
130 Ga0436363_0143140 3300039450 Bacteria 1752
131 Ga0436362_0265247 3300039453 Bacteria 102026
132 Ga0439443_005285 3300042003 Bacteria 1719
133 Ga0450923_039542 3300042125 Bacteria 987
134 Ga0495650_0002748 3300046471 Bacteria 13582
135 Ga0495606_0071702 3300046507 Bacteria 2180
136 Ga0495616_0000010 3300046513 Bacteria 224378
137 Ga0495643_0030244 3300046522 Bacteria 3026
138 Ga0495648_0021887 3300046524 Bacteria 4416
139 Ga0495663_0028496 3300046525 Bacteria 1644
140 Ga0495668_0002391 3300046616 Bacteria 15550
141 Ga0495625_0000031 3300046660 Bacteria 238193
142 Ga0495625_0001182 3300046660 Bacteria 33512
143 Ga0495625_0095947 3300046660 Bacteria 2043
144 Ga0495625_0117488 3300046660 Bacteria 1813
145 Ga0495625_0189530 3300046660 Bacteria 1363
146 Ga0495671_0024508 3300046692 Bacteria 3142
147 Ga0496117_0032449 3300048920 Bacteria 3967
148 Ga0496118_0023444 3300048921 Bacteria 5360
149 Ga0496121_0047067 3300048924 Bacteria 3683
150 Ga0496124_0202854 3300048927 Bacteria 1506
151 Ga0496126_0051044 3300048929 Bacteria 3768
152 Ga0496126_0317125 3300048929 Bacteria 1282
153 Ga0501031_0020490 3300049568 Bacteria 4311
154 Ga0501032_0051756 3300049569 Bacteria 2768
155 Ga0501034_0003849 3300049571 Bacteria 16909
156 Ga0501034_0031934 3300049571 Bacteria 5349
157 Ga0501034_0354514 3300049571 Bacteria 1395
158 Ga0501036_0021382 3300049572 Bacteria 5438
159 Ga0501037_0044515 3300049573 Bacteria 3259
160 Ga0501038_0081016 3300049574 Bacteria 2735
161 Ga0501038_0094475 3300049574 Bacteria 2499
162 Ga0501039_0035868 3300049575 Bacteria 3827
163 Ga0501043_0090826 3300049579 Bacteria 2401
164 Ga0501047_0039638 3300049581 Bacteria 4555
165 Ga0501069_0003312 3300049585 Bacteria 8267
166 Ga0501223_000075 3300049663 Bacteria 30250
167 Ga0501224_000007 3300049664 Bacteria 127654
168 Ga0501233_000179 3300049668 Bacteria 9197
169 Ga0501235_002264 3300049669 Bacteria 4143
170 Ga0501225_0000113 3300049705 Bacteria 25146
171 Ga0501234_002871 3300049707 Bacteria 2710
172 Ga0501241_003849 3300049758 Bacteria 2830
173 Ga0501035_0012295 3300049822 Bacteria 7913
174 Ga0501044_0197744 3300049823 Bacteria 1969
175 Ga0501226_000061 3300049853 Bacteria 36545
176 nmdc:mga0qj67_16344_c1 3300050509 Bacteria 5626
177 Ga0500595_023066 3300053119 Bacteria 2192
178 Ga0500559_0021895 3300053136 Bacteria 2711
179 Ga0500559_0027954 3300053136 Bacteria 2408
180 Ga0500604_0001486 3300053151 Bacteria 6555
181 Ga0500616_0000326 3300053153 Bacteria 68250
182 Ga0500624_000011 3300053157 Bacteria 168125
183 Ga0500627_0001047 3300053158 Bacteria 7536
184 2643835005 2643221563 Bacteria 4726935
185 2644055932 2643221608 Bacteria 4724829
186 2753766610 2751185897 Bacteria 5322941
187 2852655798 2852653556 Bacteria 4050083
188 Ga0495650_0046928
189 JGI25165J46597_1000166
190 Ga0055536_1006424
191 Ga0055536_1013755
192 Ga0055530_10000115
193 Ga0055531_10006063
194 Ga0055531_10006683
195 Ga0070676_10088437
196 Ga0070683_100176972
197 Ga0070670_100249475
198 Ga0070666_10004555
199 Ga0068868_100000324
200 Ga0070661_100000155
201 Ga0070668_100000011
202 Ga0070668_100000081
203 Ga0070669_100000031
204 Ga0070675_100017569
205 Ga0070671_100000262
206 Ga0070671_100489678
207 Ga0070659_100000010
208 Ga0070667_100000211
209 Ga0070667_100002653
210 Ga0070663_100361004
211 Ga0070679_100000001
212 Ga0070686_100001128
213 Ga0070665_100140179
214 Ga0070665_100185326
215 Ga0068857_100196405
216 Ga0068854_100026443
217 Ga0068859_100076956
218 Ga0068861_100013007
219 Ga0068863_100000178
220 Ga0068863_100000186
221 Ga0068863_100002215
222 Ga0068858_100000275
223 Ga0068860_100016001
224 Ga0068860_100018050
225 Ga0068860_100026835
226 Ga0068862_100000043
227 Ga0068862_100000287
228 Ga0068862_100034563
229 Ga0068862_100055653
230 Ga0097620_100076954
231 Ga0105245_10005786
232 Ga0105245_10028537
233 Ga0105238_10065129
234 Ga0105249_10000065
235 Ga0157372_10272301
236 Ga0157372_10610936
237 Ga0157375_10069429
238 Ga0213873_10000023
239 Ga0213876_10000091
240 Ga0213876_10003740
241 Ga0213875_10001550
242 Ga0209233_1000222
243 Ga0209675_1000104
244 Ga0209676_1000807
245 Ga0209676_1001060
246 Ga0209676_1001199
247 Ga0209050_1000286
248 Ga0209050_1039103
249 Ga0209257_1000245
250 Ga0209257_1000321
251 Ga0207680_10002537
252 Ga0207647_10100212
253 Ga0207645_10052493
254 Ga0207705_10228042
255 Ga0207695_10042473
256 Ga0207671_10165123
257 Ga0207657_10023431
258 Ga0207649_10000016
259 Ga0207649_10064614
260 Ga0207652_10000002
261 Ga0207681_10000014
262 Ga0207694_10043715
263 Ga0207650_10148957
264 Ga0207659_10017485
265 Ga0207687_10003268
266 Ga0207687_10122527
267 Ga0207644_10000032
268 Ga0207690_10000020
269 Ga0207706_10058097
270 Ga0207689_10140528
271 Ga0207679_10231194
272 Ga0207712_10000002
273 Ga0207668_10000034
274 Ga0207668_10000079
275 Ga0207668_10009274
276 Ga0207640_10037471
277 Ga0207658_10000180
278 Ga0207658_10002271
279 Ga0207677_10000193
280 Ga0207703_10000334
281 Ga0207678_10018913
282 Ga0207641_10000031
283 Ga0207641_10000256
284 Ga0207641_10001897
285 Ga0207675_100001954
286 Ga0207698_10110296
287 Ga0268266_10037158
288 Ga0268265_10000013
289 Ga0268265_10000141
290 Ga0268265_10014328
291 Ga0268264_10000785
292 Ga0268264_10000788
293 Ga0268264_10018796
294 Ga0307513_10007346
295 Ga0307408_100107995
296 Ga0307408_100327888
297 Ga0307508_10000286
298 Ga0307410_10127009
299 Ga0307406_10128387
300 Ga0307412_10000811
301 Ga0307412_10119017
302 Ga0307412_10371831
303 Ga0307409_100154710
304 Ga0307416_100174482
305 Ga0307416_100328907
306 Ga0307416_100451268
307 Ga0307414_10000197
308 Ga0307414_10011075
309 Ga0307414_10106642
310 Ga0307414_10121507
311 Ga0307411_10013116
312 Ga0307415_100055483
313 Ga0436364_1172297
314 Ga0395901_0010466
315 Ga0395901_0135155
316 Ga0436365_1312492
317 Ga0436363_0143140
318 Ga0436362_0265247
319 Ga0439443_005285
320 Ga0450923_039542
321 Ga0495650_0002748
322 Ga0495606_0071702
323 Ga0495616_0000010
324 Ga0495643_0030244
325 Ga0495648_0021887
326 Ga0495663_0028496
327 Ga0495668_0002391
328 Ga0495625_0000031
329 Ga0495625_0001182
330 Ga0495625_0095947
331 Ga0495625_0117488
332 Ga0495625_0189530
333 Ga0495671_0024508
334 Ga0496117_0032449
335 Ga0496118_0023444
336 Ga0496121_0047067
337 Ga0496124_0202854
338 Ga0496126_0051044
339 Ga0496126_0317125
340 Ga0501031_0020490
341 Ga0501032_0051756
342 Ga0501034_0003849
343 Ga0501034_0031934
344 Ga0501034_0354514
345 Ga0501036_0021382
346 Ga0501037_0044515
347 Ga0501038_0081016
348 Ga0501038_0094475
349 Ga0501039_0035868
350 Ga0501043_0090826
351 Ga0501047_0039638
352 Ga0501069_0003312
353 Ga0501223_000075
354 Ga0501224_000007
355 Ga0501233_000179
356 Ga0501235_002264
357 Ga0501225_0000113
358 Ga0501234_002871
359 Ga0501241_003849
360 Ga0501035_0012295
361 Ga0501044_0197744
362 Ga0501226_000061
363 nmdc:mga0qj67_16344_c1
364 Ga0500595_023066
365 Ga0500559_0021895
366 Ga0500559_0027954
367 Ga0500604_0001486
368 Ga0500616_0000326
369 Ga0500624_000011
370 Ga0500627_0001047
371 2643835005
372 2644055932
373 2753766610
374 2852655798

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02569

Pantoate_ligase

Pantoate-beta-alanine ligase

2

281

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ejc-assembly1.cif.gz_A-2 crystal structure of pantoate--beta-alanine ligase (panc) from thermotoga maritima 0.9531 1 278
2a86-assembly1.cif.gz_B crystal structure of a pantothenate synthetase complexed with amp and beta-alanine 0.9525 1 277
3imc-assembly2.cif.gz_B-2 crystal structure of mycobacterium tuberculosis pantothenate synthetase at 1.6 ang resolution in complex with fragment compound 5-methoxyindole, sulfate and glycerol 0.9525 1 277
3mxt-assembly1.cif.gz_A crystal structure of pantoate-beta-alanine ligase from campylobacter jejuni 0.952 1 281
3coy-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis pantothenate synthetase at 2.05 ang resolution- in complex with sulphonamide inhibitor 3 0.9511 1 277
ID Description Score Start End Superfamily
3imeB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9535 1 174 3.40.50.620
af_Q54I80_8_191_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9486 5 176 3.40.50.620
3innA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9443 2 177 3.40.50.620
3innA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9392 2 177 3.40.50.620
3uy4A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9349 2 177 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A259D9B4-F1-model_v4 pantoate--beta-alanine ligase (AMP-forming) (EC 6.3.2.1) (Pantoate-activating enzyme) 0.9804 105 277 GO:0004592
GO:0005524
GO:0005829
GO:0015940
AF-A0A526YZS4-F1-model_v4 pantoate--beta-alanine ligase (AMP-forming) (EC 6.3.2.1) (Pantoate-activating enzyme) 0.9777 93 216 GO:0004592
GO:0005524
GO:0005829
GO:0015940
AF-Q2PVQ4-F1-model_v4 pantoate--beta-alanine ligase (AMP-forming) (EC 6.3.2.1) (Pantoate-activating enzyme) 0.9745 103 218 GO:0004592
GO:0005524
GO:0005829
GO:0015940
AF-A0A2G6JVK7-F1-model_v4 pantoate--beta-alanine ligase (AMP-forming) (EC 6.3.2.1) (Pantoate-activating enzyme) 0.9721 82 280 GO:0004592
GO:0005524
GO:0005829
GO:0015940
AF-A0A2E7UY26-F1-model_v4 Pantothenate synthetase (PS) (EC 6.3.2.1) (Pantoate--beta-alanine ligase) (Pantoate-activating enzyme) 0.9719 2 277 GO:0004592
GO:0005524
GO:0005829
GO:0015940
GO:0035556

Map