F288518

General Info

Members Datasets Scaffolds Average Seq Length
187 127 375 227

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2818991442|2819572791
Length 254
Sequence IKGRKNGKRSVEDLKFFLAAADHNYYLCGMSVNLPAYNKVIAELAPHKARLVAVSKVKPAADIQALYDAGQRIFGENYVQELQEKQPILPADIEWHFIGHLQSNKVKYIAPFVSMIHAVDSLRLLEEINKQAARHHRIIHCLLQVHIAEEETKFGLDETELTDLLTQWKDQADKFKNIRIAGFMGMATNTDNMEQVRAEFRHLKALQQQLKASFAPDGDQLTELSIGMSGDYTIALEEGSTMVRIGSMLFGARY

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
23 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
26 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
33 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
34 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
35 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
36 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
39 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
40 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
41 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
43 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
44 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
46 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
54 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
55 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
56 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
57 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
58 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
59 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
60 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
61 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
62 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
65 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
66 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
67 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
70 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
71 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
72 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
73 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
74 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
75 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
76 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
77 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
78 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
79 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
80 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
81 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
82 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
83 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
84 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
85 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
86 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
87 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
88 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
89 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
90 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
91 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
92 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
93 2738541283 Pedobacter sp. OK701 Isolate Unclassified
94 2738541284 Pedobacter sp. YR016 Isolate Unclassified
95 2738541302 Pedobacter sp. CF074 Isolate Unclassified
96 2738543023 Pedobacter sp. OK628 Isolate Unclassified
97 2739367651 Pedobacter sp. OK291 Isolate Unclassified
98 2739367656 Pedobacter sp. CF523 Isolate Unclassified
99 2739367663 Pedobacter sp. YR510 Isolate Unclassified
100 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
101 2818991437 Pedobacter terrae 518 Isolate Unclassified
102 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
103 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
104 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
105 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
106 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
107 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
108 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
109 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
110 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
111 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
112 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
113 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
114 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
115 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
116 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
117 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
118 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
119 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
120 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
121 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
122 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
123 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
124 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
125 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
126 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
127 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.68
Metatranscriptomes 0
Isolates 20.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.83
Nodule 0
Rhizoplane 1.6
Rhizosphere 64.71
Stem 0
Stem Tuber 0
Unclassified 2.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1947333 2162886007 Bacteria 1801
2 SwRhRL2b_contig_2019565 2162886007 Bacteria 1547
3 JGI25152J39213_1000867 3300002773 Bacteria 14936
4 JGI25150J39212_1000008 3300002774 Bacteria 253098
5 JGI25151J46595_10000014 3300003187 Bacteria 253098
6 JGI25153J46596_10000020 3300003215 Bacteria 252978
7 rootH1_10008908 3300003316 Bacteria 8519
8 rootH1_10008908 3300003323 Bacteria 11825
9 rootH1_10033040 3300003316 Unclassified 3292
10 rootH1_10147896 3300003316 Bacteria 2096
11 rootH2_10117493 3300003320 Bacteria 1621
12 rootL2_10014037 3300003322 Bacteria 6270
13 rootL2_10044014 3300003322 Bacteria 4665
14 rootL2_10228192 3300003322 Bacteria 2356
15 rootL2_10252524 3300003322 Bacteria 1504
16 rootH1_10094058 3300003323 Bacteria 3374
17 Ga0055536_1000226 3300003781 Bacteria 45469
18 Ga0055530_10003368 3300003791 Bacteria 9150
19 Ga0055531_10000204 3300003794 Bacteria 65068
20 Ga0055531_10000263 3300003794 Bacteria 55230
21 Ga0065165_1012270 3300005262 Bacteria 3501
22 Ga0065714_10002345 3300005288 Bacteria 23040
23 Ga0065714_10003329 3300005288 Bacteria 9982
24 Ga0065714_10010091 3300005288 Bacteria 2988
25 Ga0065714_10016138 3300005288 Bacteria 2287
26 Ga0065714_10068948 3300005288 Bacteria 4448
27 Ga0065714_10134391 3300005288 Bacteria 1220
28 Ga0065714_10198649 3300005288 Bacteria 903
29 Ga0065714_10265988 3300005288 Bacteria 748
30 Ga0065704_10001304 3300005289 Bacteria 9549
31 Ga0065704_10070382 3300005289 Bacteria 27921
32 Ga0065704_10155261 3300005289 Bacteria 1396
33 Ga0070679_100134548 3300005530 Unclassified 2453
34 Ga0068855_100180589 3300005563 Bacteria 2386
35 Ga0068857_100493649 3300005577 Bacteria 1148
36 Ga0075366_10004265 3300006195 Bacteria 7670
37 Ga0105240_10018276 3300009093 Bacteria 9423
38 Ga0105240_10153142 3300009093 Bacteria 2744
39 Ga0105243_10000007 3300009148 Bacteria 445042
40 Ga0105241_10988206 3300009174 Bacteria 787
41 Ga0105242_10219400 3300009176 Bacteria 1699
42 Ga0105237_10000369 3300009545 Bacteria 63892
43 Ga0105237_10004656 3300009545 Bacteria 15799
44 Ga0157373_10002419 3300013100 Bacteria 14191
45 Ga0157373_10006390 3300013100 Bacteria 8806
46 Ga0157373_10046469 3300013100 Bacteria 3098
47 Ga0157371_10000620 3300013102 Bacteria 42287
48 Ga0157371_10004223 3300013102 Bacteria 12636
49 Ga0157371_10005978 3300013102 Bacteria 10152
50 Ga0157370_10000207 3300013104 Bacteria 74451
51 Ga0157370_10011824 3300013104 Bacteria 9107
52 Ga0157370_10018370 3300013104 Bacteria 7033
53 Ga0157370_10019227 3300013104 Bacteria 6860
54 Ga0157370_10065460 3300013104 Bacteria 3439
55 Ga0157370_10460350 3300013104 Bacteria 1169
56 Ga0157369_10000071 3300013105 Bacteria 140377
57 Ga0157374_11417126 3300013296 Bacteria 718
58 Ga0163162_10001708 3300013306 Bacteria 20592
59 Ga0157375_10654780 3300013308 Bacteria 1206
60 Ga0182008_10000009 3300014497 Bacteria 331416
61 Ga0182008_10001007 3300014497 Bacteria 19580
62 Ga0182008_10001946 3300014497 Bacteria 13313
63 Ga0182008_10011417 3300014497 Bacteria 4724
64 Ga0182008_10088545 3300014497 Bacteria 1525
65 Ga0182006_1000332 3300015261 Bacteria 40804
66 Ga0182006_1000356 3300015261 Bacteria 38331
67 Ga0182006_1010749 3300015261 Bacteria 4054
68 Ga0182006_1022120 3300015261 Bacteria 2646
69 Ga0182006_1056465 3300015261 Bacteria 1496
70 Ga0182007_10000006 3300015262 Bacteria 427355
71 Ga0182007_10022679 3300015262 Bacteria 2214
72 Ga0182007_10025165 3300015262 Bacteria 2075
73 Ga0182005_1000056 3300015265 Bacteria 108603
74 Ga0183373_1001 3300015682 Bacteria 1410374
75 Ga0163161_10000309 3300017792 Bacteria 42593
76 Ga0163161_10000394 3300017792 Bacteria 36483
77 Ga0163161_10001366 3300017792 Bacteria 18108
78 Ga0163161_10004577 3300017792 Bacteria 9628
79 Ga0163161_10026670 3300017792 Bacteria 4093
80 Ga0163161_10172453 3300017792 Bacteria 1655
81 Ga0209436_110815 3300025208 Bacteria 1643
82 Ga0207425_1000007 3300025245 Bacteria 777411
83 Ga0209129_1000006 3300025258 Bacteria 777761
84 Ga0209676_1000090 3300025292 Bacteria 256336
85 Ga0209025_1000089 3300025294 Bacteria 254130
86 Ga0209758_1000016 3300025297 Bacteria 778557
87 Ga0209050_1000091 3300025298 Bacteria 253049
88 Ga0207426_1009866 3300025302 Bacteria 3743
89 Ga0209257_1000006 3300025304 Bacteria 1570111
90 Ga0209257_1000025 3300025304 Bacteria 724838
91 Ga0207654_10330651 3300025911 Bacteria 1044
92 Ga0207671_10003237 3300025914 Bacteria 16384
93 Ga0207671_10011917 3300025914 Bacteria 7030
94 Ga0207652_10218636 3300025921 Unclassified 1717
95 Ga0207686_10147471 3300025934 Bacteria 1634
96 Ga0207709_10000049 3300025935 Bacteria 237124
97 Ga0207667_10279974 3300025949 Bacteria 1704
98 Ga0307515_10088611 3300028794 Bacteria 3909
99 Ga0316177_1106149 3300030731 Bacteria 6319
100 Ga0316176_1037419 3300030732 Bacteria 4346
101 Ga0316183_1205599 3300030742 Bacteria 27167
102 Ga0316181_1034648 3300030744 Unclassified 2367
103 Ga0316181_1062778 3300030744 Bacteria 2050
104 Ga0316182_1274545 3300030745 Bacteria 1571
105 Ga0307405_10000012 3300031731 Bacteria 233774
106 Ga0307405_10073848 3300031731 Bacteria 2203
107 Ga0307413_10290913 3300031824 Bacteria 1234
108 Ga0307407_10000013 3300031903 Bacteria 165614
109 Ga0307412_10000084 3300031911 Bacteria 90908
110 Ga0307416_100000028 3300032002 Bacteria 165572
111 Ga0307414_10005153 3300032004 Bacteria 7169
112 Ga0307414_10036437 3300032004 Bacteria 3284
113 Ga0307414_10154396 3300032004 Bacteria 1815
114 Ga0307414_10246754 3300032004 Bacteria 1481
115 Ga0307414_10277780 3300032004 Bacteria 1406
116 Ga0307414_10353094 3300032004 Bacteria 1263
117 Ga0307411_10035740 3300032005 Unclassified 3106
118 Ga0451855_2021065 3300041511 Bacteria 661
119 Ga0451577_0022385 3300042876 Bacteria 5770
120 Ga0453684_0108567 3300044712 Bacteria 3377
121 Ga0453684_0430273 3300044712 Bacteria 1472
122 Ga0495627_010375 3300046453 Bacteria 3389
123 Ga0495606_0036741 3300046507 Bacteria 3333
124 Ga0495606_0146215 3300046507 Bacteria 1391
125 Ga0495610_0000060 3300046512 Bacteria 131116
126 Ga0495610_0002356 3300046512 Bacteria 15967
127 Ga0495644_0011577 3300046523 Bacteria 3395
128 Ga0495609_0084453 3300046538 Bacteria 1385
129 Ga0495633_0000529 3300046558 Bacteria 38115
130 Ga0495633_0139061 3300046558 Bacteria 1123
131 Ga0495681_0129640 3300047470 Bacteria 1074
132 Ga0496100_0557150 3300048903 Bacteria 887
133 Ga0496101_0597812 3300048904 Bacteria 872
134 Ga0496115_0071722 3300048918 Bacteria 2809
135 Ga0496116_0006790 3300048919 Bacteria 10295
136 Ga0496117_0007250 3300048920 Bacteria 10899
137 Ga0496118_0038305 3300048921 Bacteria 3845
138 Ga0496121_0000028 3300048924 Bacteria 439193
139 Ga0496122_0001846 3300048925 Bacteria 32295
140 Ga0496122_0011826 3300048925 Bacteria 8775
141 Ga0496123_0002062 3300048926 Bacteria 25924
142 Ga0496123_0016849 3300048926 Bacteria 5907
143 Ga0496126_0538289 3300048929 Bacteria 928
144 Ga0501252_018798 3300049682 Bacteria 888
145 Ga0501241_000400 3300049758 Bacteria 9516
146 Ga0501241_002366 3300049758 Bacteria 3648
147 Ga0500651_0002353 3300053093 Bacteria 9943
148 Ga0500651_0064640 3300053093 Bacteria 2281
149 Ga0500622_0001257 3300053156 Bacteria 20711
150 Ga0500622_0004747 3300053156 Bacteria 8376
151 2819572791 2818991442 Bacteria 8318214
152 2586208601 2585427687 Bacteria 5544917
153 2722728448 2721755487 Bacteria 6357185
154 2738757177 2738541283 Bacteria 7222293
155 2738762791 2738541284 Bacteria 5199923
156 2738852995 2738541302 Bacteria 5944758
157 2739300468 2738543023 Bacteria 6767879
158 2739586367 2739367651 Bacteria 6359826
159 2739617760 2739367656 Bacteria 5152243
160 2739644864 2739367663 Bacteria 5040914
161 2776614355 2775506987 Bacteria 5373360
162 2819549127 2818991437 Bacteria 5805520
163 2821139796 2821136567 Bacteria 8080116
164 2833644146 2833640130 Bacteria 4858325
165 2842725623 2842722452 Bacteria 6263924
166 2842914447 2842909656 Bacteria 6185908
167 2849283019 2849281842 Bacteria 6065644
168 2852630265 2852627209 Bacteria 5896285
169 2857630649 2857627736 Bacteria 5625397
170 2883069419 2883068021 Bacteria 6192739
171 2890740492 2890737413 Bacteria 4269751
172 2896088150 2896085136 Bacteria 6129793
173 2896318058 2896317667 Bacteria 4606601
174 2896345035 2896344016 Bacteria 3811746
175 2902048892 2902048731 Bacteria 4976191
176 2904449203 2904445276 Bacteria 5310396
177 2904473453 2904467357 Bacteria 8057758
178 2904785219 2904780799 Bacteria 5840761
179 2919181039 2919177583 Bacteria 5641607
180 2919190032 2919186247 Bacteria 6244071
181 2929244695 2929239360 Bacteria 7745570
182 2939668313 2939664404 Bacteria 6364494
183 2946001142 2945997725 Bacteria 6404843
184 2954018042 2954016120 Bacteria 6446024
185 2958512608 2958512119 Bacteria 4528530
186 2977233222 2977232053 Bacteria 5485925
187 3003233870 3003233435 Bacteria 4458031
188 8036738088 8036736890 Bacteria 2944828
189 SwRhRL2b_contig_1947333
190 SwRhRL2b_contig_2019565
191 JGI25152J39213_1000867
192 JGI25150J39212_1000008
193 JGI25151J46595_10000014
194 JGI25153J46596_10000020
195 rootH1_10008908
196 rootH1_10033040
197 rootH1_10147896
198 rootH2_10117493
199 rootL2_10014037
200 rootL2_10044014
201 rootL2_10228192
202 rootL2_10252524
203 rootH1_10094058
204 Ga0055536_1000226
205 Ga0055530_10003368
206 Ga0055531_10000204
207 Ga0055531_10000263
208 Ga0065165_1012270
209 Ga0065714_10002345
210 Ga0065714_10003329
211 Ga0065714_10010091
212 Ga0065714_10016138
213 Ga0065714_10068948
214 Ga0065714_10134391
215 Ga0065714_10198649
216 Ga0065714_10265988
217 Ga0065704_10001304
218 Ga0065704_10070382
219 Ga0065704_10155261
220 Ga0070679_100134548
221 Ga0068855_100180589
222 Ga0068857_100493649
223 Ga0075366_10004265
224 Ga0105240_10018276
225 Ga0105240_10153142
226 Ga0105243_10000007
227 Ga0105241_10988206
228 Ga0105242_10219400
229 Ga0105237_10000369
230 Ga0105237_10004656
231 Ga0157373_10002419
232 Ga0157373_10006390
233 Ga0157373_10046469
234 Ga0157371_10000620
235 Ga0157371_10004223
236 Ga0157371_10005978
237 Ga0157370_10000207
238 Ga0157370_10011824
239 Ga0157370_10018370
240 Ga0157370_10019227
241 Ga0157370_10065460
242 Ga0157370_10460350
243 Ga0157369_10000071
244 Ga0157374_11417126
245 Ga0163162_10001708
246 Ga0157375_10654780
247 Ga0182008_10000009
248 Ga0182008_10001007
249 Ga0182008_10001946
250 Ga0182008_10011417
251 Ga0182008_10088545
252 Ga0182006_1000332
253 Ga0182006_1000356
254 Ga0182006_1010749
255 Ga0182006_1022120
256 Ga0182006_1056465
257 Ga0182007_10000006
258 Ga0182007_10022679
259 Ga0182007_10025165
260 Ga0182005_1000056
261 Ga0183373_1001
262 Ga0163161_10000309
263 Ga0163161_10000394
264 Ga0163161_10001366
265 Ga0163161_10004577
266 Ga0163161_10026670
267 Ga0163161_10172453
268 Ga0209436_110815
269 Ga0207425_1000007
270 Ga0209129_1000006
271 Ga0209676_1000090
272 Ga0209025_1000089
273 Ga0209758_1000016
274 Ga0209050_1000091
275 Ga0207426_1009866
276 Ga0209257_1000006
277 Ga0209257_1000025
278 Ga0207654_10330651
279 Ga0207671_10003237
280 Ga0207671_10011917
281 Ga0207652_10218636
282 Ga0207686_10147471
283 Ga0207709_10000049
284 Ga0207667_10279974
285 Ga0307515_10088611
286 Ga0316177_1106149
287 Ga0316176_1037419
288 Ga0316183_1205599
289 Ga0316181_1034648
290 Ga0316181_1062778
291 Ga0316182_1274545
292 Ga0307405_10000012
293 Ga0307405_10073848
294 Ga0307413_10290913
295 Ga0307407_10000013
296 Ga0307412_10000084
297 Ga0307416_100000028
298 Ga0307414_10005153
299 Ga0307414_10036437
300 Ga0307414_10154396
301 Ga0307414_10246754
302 Ga0307414_10277780
303 Ga0307414_10353094
304 Ga0307411_10035740
305 Ga0451855_2021065
306 Ga0451577_0022385
307 Ga0453684_0108567
308 Ga0453684_0430273
309 Ga0495627_010375
310 Ga0495606_0036741
311 Ga0495606_0146215
312 Ga0495610_0000060
313 Ga0495610_0002356
314 Ga0495644_0011577
315 Ga0495609_0084453
316 Ga0495633_0000529
317 Ga0495633_0139061
318 Ga0495681_0129640
319 Ga0496100_0557150
320 Ga0496101_0597812
321 Ga0496115_0071722
322 Ga0496116_0006790
323 Ga0496117_0007250
324 Ga0496118_0038305
325 Ga0496121_0000028
326 Ga0496122_0001846
327 Ga0496122_0011826
328 Ga0496123_0002062
329 Ga0496123_0016849
330 Ga0496126_0538289
331 Ga0501252_018798
332 Ga0501241_000400
333 Ga0501241_002366
334 Ga0500651_0002353
335 Ga0500651_0064640
336 Ga0500622_0001257
337 Ga0500622_0004747
338 2819572791
339 2586208601
340 2722728448
341 2738757177
342 2738762791
343 2738852995
344 2739300468
345 2739586367
346 2739617760
347 2739644864
348 2776614355
349 2819549127
350 2821139796
351 2833644146
352 2842725623
353 2842914447
354 2849283019
355 2852630265
356 2857630649
357 2883069419
358 2890740492
359 2896088150
360 2896318058
361 2896345035
362 2902048892
363 2904449203
364 2904473453
365 2904785219
366 2919181039
367 2919190032
368 2929244695
369 2939668313
370 2946001142
371 2954018042
372 2958512608
373 2977233222
374 3003233870
375 8036738088

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

35

254

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ygf-assembly3.cif.gz_C crystal structure of yggs from fusobacterium nucleatum 0.9328 1 218
7f8e-assembly3.cif.gz_C crystal structure of yggs from fusobacterium nucleatum 0.9327 1 218
5nlc-assembly2.cif.gz_B structure of pipy, the cog0325 family member of synechococcus elongatus pcc7942,without plp 0.922 2 219
5nlc-assembly2.cif.gz_B structure of pipy, the cog0325 family member of synechococcus elongatus pcc7942,without plp 0.9179 2 219
7uat-assembly1.cif.gz_A the crystal structure of the k36a mutant of e. coli yggs in complex with plp 0.9125 2 220
ID Description Score Start End Superfamily
1w8gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9116 2 220 3.20.20.10
5nm8B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9089 2 219 3.20.20.10
5nm8B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9048 2 219 3.20.20.10
af_Q2FZ87_1_222_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8837 4 221 3.20.20.10
af_A0A1D8PE30_36_277_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8827 2 221 3.20.20.10
ID Description Score Start End GO Terms
AF-A0A1H7WDK4-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9995 1 221 GO:0030170
AF-A0A7C5M204-F1-model_v4 YggS family pyridoxal phosphate-dependent enzyme 0.9966 23 221 GO:0030170
AF-A0A1H7WDK4-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.995 1 221 GO:0030170
AF-A0A258KE01-F1-model_v4 YggS family pyridoxal phosphate enzyme 0.9929 48 226 GO:0030170
AF-A0A7D4BKV5-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9928 1 222 GO:0030170

Map