F288985

General Info

Members Datasets Scaffolds Average Seq Length
188 131 376 264

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100111672|Ga0070707_1001116722
Length 302
Sequence MLVIDFFTSSEDRVGREVESAVVPRSTHSSLLAPQSREAFAERFAHRPLFGMVHLRPLPGAPLFGGSLADVIDAALADARAVAAGGADGMLFENFGDRPFVKNRVGAETVAAMTRVIAEVIAEVKMPFGVNVLRNDARAAVAIAAATGAAFVRINIHTGAMLTDQGLIEGEAAETMRLRAALAPGLLVFADHMVKHAVTPAPVDEIRSARDLRLRGLADAIIVDGAETGQPADPDRLRAIREALPHVPLIIGSGLTPENAASYADADGAIAGTSIKERGEVEAPVDRDRVARLAATFKFDAQ

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
74 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
77 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
78 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
83 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
84 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
85 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
86 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
92 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
99 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
100 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
101 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
102 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
103 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
104 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
105 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
106 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
107 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
108 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
109 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
110 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
111 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
112 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
113 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
117 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
120 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
125 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
128 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
129 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
130 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
131 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 0.53
Rhizosphere 95.21
Stem 0
Stem Tuber 0
Unclassified 15.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100111672 3300005468 Bacteria 2651
2 MBSR1b_contig_13881467 2162886012 Bacteria 1000
3 Ga0070658_10237967 3300005327 Bacteria 1543
4 Ga0070658_10544260 3300005327 Bacteria 1004
5 Ga0070683_100000045 3300005329 Bacteria 97310
6 Ga0070670_100149650 3300005331 Bacteria 2020
7 Ga0070682_100000002 3300005337 Bacteria 506802
8 Ga0068868_100000058 3300005338 Bacteria 62047
9 Ga0070689_100000064 3300005340 Bacteria 65382
10 Ga0070689_100004516 3300005340 Bacteria 9424
11 Ga0070673_100299456 3300005364 Bacteria 1415
12 Ga0070688_100036940 3300005365 Bacteria 2974
13 Ga0070709_10196515 3300005434 Bacteria 1426
14 Ga0070714_100003605 3300005435 Bacteria 11583
15 Ga0070713_100094154 3300005436 Bacteria 2582
16 Ga0070710_10305133 3300005437 Bacteria 1040
17 Ga0070701_10002002 3300005438 Bacteria 7718
18 Ga0070708_100014336 3300005445 Bacteria 6519
19 Ga0070707_100477719 3300005468 Bacteria 1208
20 Ga0070698_100026592 3300005471 Bacteria 6023
21 Ga0070684_100000169 3300005535 Bacteria 44981
22 Ga0070697_100028831 3300005536 Bacteria 4447
23 Ga0070672_100000615 3300005543 Bacteria 20879
24 Ga0070693_100116022 3300005547 Bacteria 1654
25 Ga0068855_100053530 3300005563 Bacteria 4748
26 Ga0068855_100082359 3300005563 Bacteria 3729
27 Ga0068857_100077985 3300005577 Bacteria 2957
28 Ga0068857_100081846 3300005577 Bacteria 2883
29 Ga0068854_100039077 3300005578 Bacteria 3341
30 Ga0068854_100053020 3300005578 Bacteria 2911
31 Ga0068856_100000391 3300005614 Bacteria 47954
32 Ga0070702_100062402 3300005615 Bacteria 2173
33 Ga0068859_100595943 3300005617 Unclassified 1198
34 Ga0068864_100000013 3300005618 Bacteria 326235
35 Ga0068863_100091508 3300005841 Unclassified 2885
36 Ga0068858_100000090 3300005842 Bacteria 94699
37 Ga0068858_100433455 3300005842 Unclassified 1265
38 Ga0081455_10068698 3300005937 Bacteria 2948
39 Ga0070716_100050543 3300006173 Bacteria 2360
40 Ga0075428_100021761 3300006844 Bacteria 7099
41 Ga0075428_100187877 3300006844 Bacteria 2235
42 Ga0075433_10508241 3300006852 Unclassified 1060
43 Ga0075429_100105865 3300006880 Unclassified 2457
44 Ga0068865_100102411 3300006881 Unclassified 2098
45 Ga0097620_100596015 3300006931 Unclassified 1198
46 Ga0075435_100184761 3300007076 Unclassified 1763
47 Ga0111539_10000016 3300009094 Bacteria 276730
48 Ga0111539_10404064 3300009094 Unclassified 1591
49 Ga0105245_10000028 3300009098 Bacteria 161027
50 Ga0105245_10003612 3300009098 Bacteria 13804
51 Ga0105245_10013812 3300009098 Bacteria 7034
52 Ga0105238_10000001 3300009551 Bacteria 2036163
53 Ga0105238_10003243 3300009551 Bacteria 16247
54 Ga0105238_10079565 3300009551 Bacteria 3267
55 Ga0105239_10027759 3300010375 Bacteria 6228
56 Ga0157374_10000022 3300013296 Bacteria 270307
57 Ga0157374_10183755 3300013296 Bacteria 2043
58 Ga0157378_10000034 3300013297 Bacteria 120274
59 Ga0163162_10025111 3300013306 Bacteria 5889
60 Ga0157375_10000030 3300013308 Bacteria 199141
61 Ga0157375_10000049 3300013308 Bacteria 139586
62 Ga0157375_10000054 3300013308 Bacteria 126807
63 Ga0157375_10000329 3300013308 Bacteria 42630
64 Ga0163163_10740238 3300014325 Unclassified 1046
65 Ga0157380_10016781 3300014326 Bacteria 5407
66 Ga0157377_10000009 3300014745 Bacteria 385287
67 Ga0157376_10000024 3300014969 Bacteria 220018
68 Ga0213873_10000001 3300021358 Bacteria 1657979
69 Ga0213876_10000002 3300021384 Bacteria 1168769
70 Ga0213876_10007442 3300021384 Bacteria 5954
71 Ga0207699_10169993 3300025906 Bacteria 1458
72 Ga0207643_10082125 3300025908 Bacteria 1868
73 Ga0207684_10209047 3300025910 Bacteria 1683
74 Ga0207646_10019005 3300025922 Bacteria 6398
75 Ga0207646_10421776 3300025922 Bacteria 1204
76 Ga0207694_10000001 3300025924 Bacteria 4078485
77 Ga0207694_10015321 3300025924 Bacteria 5784
78 Ga0207694_10119279 3300025924 Unclassified 2105
79 Ga0207687_10000002 3300025927 Bacteria 975489
80 Ga0207687_10002480 3300025927 Bacteria 12535
81 Ga0207687_10006243 3300025927 Bacteria 7884
82 Ga0207700_10141738 3300025928 Bacteria 1976
83 Ga0207664_10005474 3300025929 Bacteria 8685
84 Ga0207670_10000137 3300025936 Bacteria 48112
85 Ga0207704_10576443 3300025938 Archaea 918
86 Ga0207691_10003668 3300025940 Bacteria 14897
87 Ga0207661_10000007 3300025944 Bacteria 471636
88 Ga0207640_10002045 3300025981 Bacteria 10908
89 Ga0207640_10091689 3300025981 Bacteria 2106
90 Ga0207677_10000004 3300026023 Bacteria 299062
91 Ga0207677_10000433 3300026023 Bacteria 28244
92 Ga0207703_10000242 3300026035 Bacteria 61824
93 Ga0207702_10001937 3300026078 Bacteria 20207
94 Ga0207648_10232625 3300026089 Bacteria 1639
95 Ga0207676_10000014 3300026095 Bacteria 339896
96 Ga0207674_10083804 3300026116 Bacteria 3187
97 Ga0207674_10095160 3300026116 Bacteria 2965
98 Ga0207674_10276868 3300026116 Bacteria 1626
99 Ga0207428_10000020 3300027907 Bacteria 276713
100 Ga0265337_1008246 3300028556 Bacteria 3805
101 Ga0265326_10056340 3300028558 Unclassified 1112
102 Ga0265338_10000101 3300028800 Bacteria 159323
103 Ga0265338_10000561 3300028800 Bacteria 65218
104 Ga0265338_10031110 3300028800 Bacteria 5237
105 Ga0265324_10002095 3300029957 Bacteria 10557
106 Ga0265324_10007787 3300029957 Bacteria 4308
107 Ga0307511_10009189 3300030521 Bacteria 9849
108 Ga0265340_10118590 3300031247 Bacteria 1219
109 Ga0265339_10185472 3300031249 Unclassified 1034
110 Ga0265331_10157715 3300031250 Bacteria 1029
111 Ga0265327_10001688 3300031251 Bacteria 26394
112 Ga0265316_10182341 3300031344 Unclassified 1563
113 Ga0265342_10079980 3300031712 Unclassified 1890
114 Ga0373944_0013292 3300035089 Bacteria 2281
115 Ga0373932_0001701 3300035112 Bacteria 5982
116 Ga0316574_0200064 3300035398 Bacteria 1283
117 Ga0373937_0050932 3300036401 Unclassified 3795
118 Ga0316582_0245024 3300036647 Bacteria 1228
119 Ga0373925_0282090 3300037068 Bacteria 1338
120 Ga0436365_0115280 3300039437 Unclassified 1261
121 Ga0436365_0190860 3300039437 Bacteria 42582
122 Ga0436365_1065350 3300039437 Bacteria 21502
123 Ga0436362_0649416 3300039453 Bacteria 210038
124 Ga0451839_0047541 3300041496 Bacteria 1657
125 Ga0451577_0049467 3300042876 Bacteria 3754
126 Ga0451577_0155033 3300042876 Unclassified 2061
127 Ga0451577_0432029 3300042876 Bacteria 1196
128 Ga0451577_0442671 3300042876 Unclassified 1180
129 Ga0451577_0446312 3300042876 Bacteria 1175
130 Ga0453684_0003390 3300044712 Bacteria 36045
131 Ga0453684_0006095 3300044712 Bacteria 23250
132 Ga0453684_0126431 3300044712 Bacteria 3076
133 Ga0451576_0054190 3300045051 Unclassified 4200
134 Ga0451576_0165639 3300045051 Bacteria 2307
135 Ga0451576_0605490 3300045051 Unclassified 1152
136 Ga0451576_0795876 3300045051 Bacteria 993
137 Ga0451576_0828530 3300045051 Unclassified 971
138 Ga0495603_0173703 3300046455 Bacteria 1248
139 Ga0495629_0035312 3300046459 Bacteria 3533
140 Ga0495641_0007533 3300046461 Bacteria 6780
141 Ga0495582_0024698 3300046473 Bacteria 3289
142 Ga0495582_0065601 3300046473 Bacteria 2006
143 Ga0495639_0087503 3300046475 Bacteria 1458
144 Ga0495662_0051180 3300046476 Bacteria 1994
145 Ga0495630_0000220 3300046517 Bacteria 45190
146 Ga0495666_0001943 3300046526 Bacteria 10191
147 Ga0495640_0046962 3300046533 Unclassified 2989
148 Ga0495640_0105784 3300046533 Bacteria 1843
149 Ga0495640_0191545 3300046533 Bacteria 1299
150 Ga0495586_0000017 3300046535 Bacteria 116426
151 Ga0495586_0017749 3300046535 Bacteria 3786
152 Ga0495586_0087610 3300046535 Bacteria 1716
153 Ga0495586_0107106 3300046535 Bacteria 1554
154 Ga0495587_0201383 3300046536 Bacteria 1126
155 Ga0495645_0093849 3300046543 Bacteria 2141
156 Ga0495645_0276401 3300046543 Bacteria 1106
157 Ga0495667_0022499 3300046559 Bacteria 4246
158 Ga0495634_0076859 3300046642 Bacteria 2191
159 Ga0495634_0131683 3300046642 Bacteria 1594
160 Ga0495657_0268273 3300046675 Bacteria 1024
161 Ga0495599_0084760 3300046678 Bacteria 1979
162 Ga0495646_0121742 3300046680 Unclassified 1476
163 Ga0495647_0003546 3300046681 Bacteria 5000
164 Ga0495658_0002669 3300046683 Bacteria 8974
165 Ga0495658_0004288 3300046683 Bacteria 7022
166 Ga0495658_0025488 3300046683 Bacteria 3161
167 Ga0495658_0234591 3300046683 Bacteria 1151
168 Ga0495613_0003861 3300046689 Bacteria 11209
169 Ga0495613_0175753 3300046689 Unclassified 1518
170 Ga0495624_0126966 3300046690 Unclassified 1565
171 Ga0495674_0000243 3300047319 Bacteria 45976
172 Ga0495680_0154332 3300047322 Bacteria 1672
173 Ga0495675_0226303 3300047444 Bacteria 1130
174 Ga0495679_020500 3300047446 Bacteria 2301
175 Ga0495684_0116137 3300047471 Bacteria 2018
176 Ga0495684_0154427 3300047471 Bacteria 1715
177 Ga0496107_0026530 3300048910 Bacteria 4108
178 Ga0501075_0029833 3300049591 Bacteria 4035
179 Ga0501079_0113608 3300049741 Bacteria 2105
180 nmdc:mga09592_98816_c1 3300050508 Unclassified 2499
181 nmdc:mga08y16_20_c1 3300050511 Bacteria 276739
182 nmdc:mga08y16_280334_c1 3300050511 Unclassified 1719
183 nmdc:mga0n895_187466_c1 3300050512 Unclassified 2099
184 nmdc:mga0rr50_114895_c1 3300050513 Bacteria 2135
185 nmdc:mga0rr50_29995_c1 3300050513 Bacteria 3844
186 nmdc:mga08x19_209385_c1 3300050514 Bacteria 1338
187 nmdc:mga0a205_470111_c1 3300050515 Unclassified 1116
188 Ga0500555_000004 3300053103 Bacteria 343705
189 Ga0070707_100111672
190 MBSR1b_contig_13881467
191 Ga0070658_10237967
192 Ga0070658_10544260
193 Ga0070683_100000045
194 Ga0070670_100149650
195 Ga0070682_100000002
196 Ga0068868_100000058
197 Ga0070689_100000064
198 Ga0070689_100004516
199 Ga0070673_100299456
200 Ga0070688_100036940
201 Ga0070709_10196515
202 Ga0070714_100003605
203 Ga0070713_100094154
204 Ga0070710_10305133
205 Ga0070701_10002002
206 Ga0070708_100014336
207 Ga0070707_100477719
208 Ga0070698_100026592
209 Ga0070684_100000169
210 Ga0070697_100028831
211 Ga0070672_100000615
212 Ga0070693_100116022
213 Ga0068855_100053530
214 Ga0068855_100082359
215 Ga0068857_100077985
216 Ga0068857_100081846
217 Ga0068854_100039077
218 Ga0068854_100053020
219 Ga0068856_100000391
220 Ga0070702_100062402
221 Ga0068859_100595943
222 Ga0068864_100000013
223 Ga0068863_100091508
224 Ga0068858_100000090
225 Ga0068858_100433455
226 Ga0081455_10068698
227 Ga0070716_100050543
228 Ga0075428_100021761
229 Ga0075428_100187877
230 Ga0075433_10508241
231 Ga0075429_100105865
232 Ga0068865_100102411
233 Ga0097620_100596015
234 Ga0075435_100184761
235 Ga0111539_10000016
236 Ga0111539_10404064
237 Ga0105245_10000028
238 Ga0105245_10003612
239 Ga0105245_10013812
240 Ga0105238_10000001
241 Ga0105238_10003243
242 Ga0105238_10079565
243 Ga0105239_10027759
244 Ga0157374_10000022
245 Ga0157374_10183755
246 Ga0157378_10000034
247 Ga0163162_10025111
248 Ga0157375_10000030
249 Ga0157375_10000049
250 Ga0157375_10000054
251 Ga0157375_10000329
252 Ga0163163_10740238
253 Ga0157380_10016781
254 Ga0157377_10000009
255 Ga0157376_10000024
256 Ga0213873_10000001
257 Ga0213876_10000002
258 Ga0213876_10007442
259 Ga0207699_10169993
260 Ga0207643_10082125
261 Ga0207684_10209047
262 Ga0207646_10019005
263 Ga0207646_10421776
264 Ga0207694_10000001
265 Ga0207694_10015321
266 Ga0207694_10119279
267 Ga0207687_10000002
268 Ga0207687_10002480
269 Ga0207687_10006243
270 Ga0207700_10141738
271 Ga0207664_10005474
272 Ga0207670_10000137
273 Ga0207704_10576443
274 Ga0207691_10003668
275 Ga0207661_10000007
276 Ga0207640_10002045
277 Ga0207640_10091689
278 Ga0207677_10000004
279 Ga0207677_10000433
280 Ga0207703_10000242
281 Ga0207702_10001937
282 Ga0207648_10232625
283 Ga0207676_10000014
284 Ga0207674_10083804
285 Ga0207674_10095160
286 Ga0207674_10276868
287 Ga0207428_10000020
288 Ga0265337_1008246
289 Ga0265326_10056340
290 Ga0265338_10000101
291 Ga0265338_10000561
292 Ga0265338_10031110
293 Ga0265324_10002095
294 Ga0265324_10007787
295 Ga0307511_10009189
296 Ga0265340_10118590
297 Ga0265339_10185472
298 Ga0265331_10157715
299 Ga0265327_10001688
300 Ga0265316_10182341
301 Ga0265342_10079980
302 Ga0373944_0013292
303 Ga0373932_0001701
304 Ga0316574_0200064
305 Ga0373937_0050932
306 Ga0316582_0245024
307 Ga0373925_0282090
308 Ga0436365_0115280
309 Ga0436365_0190860
310 Ga0436365_1065350
311 Ga0436362_0649416
312 Ga0451839_0047541
313 Ga0451577_0049467
314 Ga0451577_0155033
315 Ga0451577_0432029
316 Ga0451577_0442671
317 Ga0451577_0446312
318 Ga0453684_0003390
319 Ga0453684_0006095
320 Ga0453684_0126431
321 Ga0451576_0054190
322 Ga0451576_0165639
323 Ga0451576_0605490
324 Ga0451576_0795876
325 Ga0451576_0828530
326 Ga0495603_0173703
327 Ga0495629_0035312
328 Ga0495641_0007533
329 Ga0495582_0024698
330 Ga0495582_0065601
331 Ga0495639_0087503
332 Ga0495662_0051180
333 Ga0495630_0000220
334 Ga0495666_0001943
335 Ga0495640_0046962
336 Ga0495640_0105784
337 Ga0495640_0191545
338 Ga0495586_0000017
339 Ga0495586_0017749
340 Ga0495586_0087610
341 Ga0495586_0107106
342 Ga0495587_0201383
343 Ga0495645_0093849
344 Ga0495645_0276401
345 Ga0495667_0022499
346 Ga0495634_0076859
347 Ga0495634_0131683
348 Ga0495657_0268273
349 Ga0495599_0084760
350 Ga0495646_0121742
351 Ga0495647_0003546
352 Ga0495658_0002669
353 Ga0495658_0004288
354 Ga0495658_0025488
355 Ga0495658_0234591
356 Ga0495613_0003861
357 Ga0495613_0175753
358 Ga0495624_0126966
359 Ga0495674_0000243
360 Ga0495680_0154332
361 Ga0495675_0226303
362 Ga0495679_020500
363 Ga0495684_0116137
364 Ga0495684_0154427
365 Ga0496107_0026530
366 Ga0501075_0029833
367 Ga0501079_0113608
368 nmdc:mga09592_98816_c1
369 nmdc:mga08y16_20_c1
370 nmdc:mga08y16_280334_c1
371 nmdc:mga0n895_187466_c1
372 nmdc:mga0rr50_114895_c1
373 nmdc:mga0rr50_29995_c1
374 nmdc:mga08x19_209385_c1
375 nmdc:mga0a205_470111_c1
376 Ga0500555_000004

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03437

BtpA

BtpA family

45

298

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7b3y-assembly1.cif.gz_B-9 structure of a nanoparticle for a covid-19 vaccine candidate 0.8061 4 257
4qcc-assembly1.cif.gz_A structure of a cube-shaped, highly porous protein cage designed by fusing symmetric oligomeric domains 0.797 14 256
7b3y-assembly1.cif.gz_B-9 structure of a nanoparticle for a covid-19 vaccine candidate 0.7953 4 257
8cus-assembly1.cif.gz_B accurate computational design of genetically encoded 3d protein crystals 0.7856 4 257
8e01-assembly1.cif.gz_A structure of engineered nano-cage fusion protein 0.7811 14 257
ID Description Score Start End Superfamily
af_Q58515_37_229_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9676 45 231 3.20.20.70
af_Q58515_8_256_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9658 14 253 3.20.20.70
af_P39364_10_265_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9515 12 251 3.20.20.70
af_Q1NZ26_14_274_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9475 12 255 3.20.20.70
af_Q58515_37_229_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9333 45 231 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7X5WPJ2-F1-model_v4 Phosphorybosylanthranilate isomerase 0.9896 19 106 GO:0016853
AF-A0A3M1EE45-F1-model_v4 Phosphorybosylanthranilate isomerase 0.9812 35 217 GO:0016853
AF-A0A660QM38-F1-model_v4 Phosphorybosylanthranilate isomerase 0.9802 16 136
AF-A0A7Y1X9X6-F1-model_v4 BtpA/SgcQ family protein 0.9801 15 154
AF-A0A7V6Z012-F1-model_v4 BtpA/SgcQ family protein 0.9799 13 255

Map