F289247

General Info

Members Datasets Scaffolds Average Seq Length
188 132 187 252

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10127443|Ga0111539_101274433
Length 279
Sequence VLISCAANFGKETTLAALFIHFISMDIVIIGTGNVAYALAGLIKKSGHILLEVSGRNESELKKIAGAFDVPASSIPNFNKEADLYIVAISDDALYNIGEWLSLERKLVVHTAGSVSKEVLQAVSRNYGVLYPLQSLKKGMKSIPEIPFLVDGNTADDLALIRDFALSLSSKVEVADDEARRKLHLAAVVVNNFTNHLYALAEEYCKKEGLSFDILQPLIMETTHRIKSMSPKTAQTGPAIRNDLSTKKKQLDMLKNHPELRRVYEVMTESIVSRISDSG

Samples

Sample ID Description Type Environment
1 2818991444 Filimonas endophytica 3197 Isolate Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
95 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
96 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
97 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
98 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
99 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
100 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
104 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
109 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
119 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
121 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
122 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
128 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
129 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
130 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
131 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
132 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.79
Nodule 0
Rhizoplane 2.66
Rhizosphere 86.17
Stem 0
Stem Tuber 0
Unclassified 6.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10010170 3300003323 Bacteria 5608
2 rootH1_10026824 3300003323 Bacteria 22983
3 Ga0070683_100022625 3300005329 Bacteria 5621
4 Ga0070670_100620109 3300005331 Bacteria 969
5 Ga0070666_10055712 3300005335 Bacteria 2669
6 Ga0070666_10310894 3300005335 Bacteria 1123
7 Ga0070680_100004542 3300005336 Bacteria 10443
8 Ga0068868_100343757 3300005338 Unclassified 1276
9 Ga0070660_100008391 3300005339 Bacteria 7222
10 Ga0070660_100160920 3300005339 Bacteria 1809
11 Ga0070687_100034283 3300005343 Unclassified 2511
12 Ga0070675_100166631 3300005354 Unclassified 1898
13 Ga0070671_100032925 3300005355 Bacteria 4284
14 Ga0070671_100062701 3300005355 Bacteria 3095
15 Ga0070671_100323657 3300005355 Bacteria 1314
16 Ga0070674_100044197 3300005356 Bacteria 3035
17 Ga0070674_100061419 3300005356 Bacteria 2622
18 Ga0070673_100114288 3300005364 Unclassified 2243
19 Ga0070673_100625949 3300005364 Unclassified 983
20 Ga0070688_100088939 3300005365 Bacteria 2014
21 Ga0070678_100178235 3300005456 Unclassified 1737
22 Ga0070681_10051045 3300005458 Unclassified 4126
23 Ga0070685_10402632 3300005466 Bacteria 948
24 Ga0070679_100003499 3300005530 Bacteria 14380
25 Ga0068853_100157008 3300005539 Bacteria 2050
26 Ga0068853_100762040 3300005539 Unclassified 925
27 Ga0070672_100047712 3300005543 Unclassified 3324
28 Ga0070686_100144660 3300005544 Bacteria 1659
29 Ga0068855_100231880 3300005563 Bacteria 2067
30 Ga0070664_100076746 3300005564 Unclassified 2871
31 Ga0068854_100516800 3300005578 Unclassified 1008
32 Ga0070702_100002159 3300005615 Bacteria 8362
33 Ga0068852_100051694 3300005616 Bacteria 3528
34 Ga0068859_100426220 3300005617 Bacteria 1423
35 Ga0068864_100880547 3300005618 Bacteria 883
36 Ga0068866_10377221 3300005718 Unclassified 908
37 Ga0068861_100071480 3300005719 Unclassified 2690
38 Ga0068863_100043172 3300005841 Bacteria 4281
39 Ga0068858_100202879 3300005842 Unclassified 1876
40 Ga0068858_100657719 3300005842 Unclassified 1018
41 Ga0068860_100274604 3300005843 Unclassified 1646
42 Ga0097621_100001025 3300006237 Bacteria 19666
43 Ga0068871_100000029 3300006358 Bacteria 77924
44 Ga0068871_100451281 3300006358 Bacteria 1152
45 Ga0075431_100037366 3300006847 Bacteria 5003
46 Ga0075429_100220910 3300006880 Bacteria 1660
47 Ga0097620_100426218 3300006931 Bacteria 1423
48 Ga0111539_10127443 3300009094 Bacteria 2981
49 Ga0105242_10044361 3300009176 Bacteria 3601
50 Ga0105242_10868815 3300009176 Bacteria 899
51 Ga0105248_10035786 3300009177 Bacteria 5554
52 Ga0105249_10027167 3300009553 Bacteria 5163
53 Ga0105246_10170582 3300011119 Bacteria 1666
54 Ga0157370_10113362 3300013104 Bacteria 2534
55 Ga0157369_10170113 3300013105 Bacteria 2296
56 Ga0157369_10902703 3300013105 Unclassified 906
57 Ga0157374_10086475 3300013296 Bacteria 2983
58 Ga0157374_10320832 3300013296 Unclassified 1535
59 Ga0157374_10541187 3300013296 Bacteria 1172
60 Ga0157378_10006350 3300013297 Bacteria 10342
61 Ga0157378_10024040 3300013297 Bacteria 5360
62 Ga0157378_10308858 3300013297 Bacteria 1533
63 Ga0163162_10000195 3300013306 Bacteria 55910
64 Ga0163162_10111492 3300013306 Bacteria 2833
65 Ga0163162_10161294 3300013306 Bacteria 2364
66 Ga0163162_10721651 3300013306 Bacteria 1117
67 Ga0157372_10344952 3300013307 Bacteria 1735
68 Ga0157372_10600856 3300013307 Bacteria 1282
69 Ga0157375_10003192 3300013308 Bacteria 14233
70 Ga0157375_10068336 3300013308 Bacteria 3555
71 Ga0157375_10460093 3300013308 Bacteria 1438
72 Ga0157375_10473753 3300013308 Unclassified 1417
73 Ga0157375_10517043 3300013308 Bacteria 1357
74 Ga0163163_10000377 3300014325 Bacteria 42550
75 Ga0157380_10003319 3300014326 Bacteria 11040
76 Ga0157377_10019507 3300014745 Unclassified 3544
77 Ga0157379_10115480 3300014968 Bacteria 2413
78 Ga0157379_10197202 3300014968 Bacteria 1820
79 Ga0157379_10306462 3300014968 Bacteria 1448
80 Ga0157376_10001210 3300014969 Bacteria 17016
81 Ga0157376_10038455 3300014969 Bacteria 3893
82 Ga0163161_10001838 3300017792 Bacteria 15498
83 Ga0163161_10015414 3300017792 Bacteria 5329
84 Ga0213876_10021883 3300021384 Bacteria 3382
85 Ga0209646_1000869 3300025246 Bacteria 10077
86 Ga0207642_10288408 3300025899 Unclassified 947
87 Ga0207688_10017830 3300025901 Unclassified 3863
88 Ga0207680_10072938 3300025903 Unclassified 2133
89 Ga0207645_10008391 3300025907 Bacteria 7206
90 Ga0207705_10080766 3300025909 Bacteria 2369
91 Ga0207707_10109442 3300025912 Unclassified 2415
92 Ga0207660_10227606 3300025917 Bacteria 1465
93 Ga0207657_10085867 3300025919 Bacteria 2635
94 Ga0207652_10001304 3300025921 Bacteria 22193
95 Ga0207652_10082269 3300025921 Bacteria 2817
96 Ga0207681_10422861 3300025923 Unclassified 1080
97 Ga0207659_10136677 3300025926 Unclassified 1898
98 Ga0207644_10049101 3300025931 Bacteria 3019
99 Ga0207644_10111686 3300025931 Unclassified 2068
100 Ga0207706_10225847 3300025933 Unclassified 1639
101 Ga0207711_10042818 3300025941 Bacteria 3859
102 Ga0207661_10013687 3300025944 Bacteria 5924
103 Ga0207679_10143101 3300025945 Unclassified 1935
104 Ga0207667_10142802 3300025949 Bacteria 2465
105 Ga0207712_10277658 3300025961 Bacteria 1366
106 Ga0207640_10249554 3300025981 Bacteria 1376
107 Ga0207658_10407666 3300025986 Unclassified 1196
108 Ga0207703_10208201 3300026035 Unclassified 1742
109 Ga0207641_10039570 3300026088 Bacteria 3944
110 Ga0207648_10106648 3300026089 Bacteria 2459
111 Ga0207648_10264478 3300026089 Bacteria 1535
112 Ga0207676_10464462 3300026095 Bacteria 1196
113 Ga0207675_100047745 3300026118 Bacteria 3996
114 Ga0207675_100485312 3300026118 Bacteria 1229
115 Ga0207683_10104780 3300026121 Bacteria 2528
116 Ga0207683_10181010 3300026121 Unclassified 1911
117 Ga0207698_10039811 3300026142 Bacteria 3485
118 Ga0207698_10283308 3300026142 Unclassified 1534
119 Ga0268264_10369449 3300028381 Bacteria 1371
120 Ga0265327_10008375 3300031251 Bacteria 7714
121 Ga0307513_10279181 3300031456 Bacteria 1449
122 Ga0307513_10287734 3300031456 Unclassified 1417
123 Ga0307509_10232530 3300031507 Bacteria 1645
124 Ga0307516_10002853 3300031730 Bacteria 22760
125 Ga0307414_10049223 3300032004 Bacteria 2912
126 Ga0373925_0092987 3300037068 Bacteria 2308
127 Ga0436365_1321487 3300039437 Bacteria 32026
128 Ga0451800_0434419 3300041459 Bacteria 1021
129 Ga0451802_1683940 3300041460 Bacteria 1484
130 Ga0439457_025741 3300042014 Bacteria 1301
131 Ga0439462_0017510 3300042015 Bacteria 1856
132 Ga0466972_0000083 3300044658 Bacteria 87204
133 Ga0466972_0005305 3300044658 Bacteria 6452
134 Ga0466972_0024493 3300044658 Bacteria 2995
135 Ga0453684_0103310 3300044712 Bacteria 3483
136 Ga0453684_0187022 3300044712 Bacteria 2426
137 Ga0466968_0202947 3300044735 Bacteria 929
138 Ga0466957_0002599 3300044842 Bacteria 9731
139 Ga0466960_0081132 3300044901 Bacteria 1635
140 Ga0495638_0282267 3300046460 Bacteria 902
141 Ga0495668_0001819 3300046616 Bacteria 19357
142 Ga0496101_0155743 3300048904 Unclassified 1750
143 Ga0496106_0359076 3300048909 Unclassified 1170
144 Ga0496114_0061432 3300048917 Bacteria 3143
145 Ga0496122_0237146 3300048925 Bacteria 1032
146 Ga0496124_0031102 3300048927 Bacteria 4729
147 Ga0501032_0041697 3300049569 Bacteria 3116
148 Ga0501032_0415416 3300049569 Unclassified 863
149 Ga0501033_0031320 3300049570 Bacteria 3997
150 Ga0501034_0041801 3300049571 Bacteria 4638
151 Ga0501034_0077379 3300049571 Bacteria 3332
152 Ga0501034_0207037 3300049571 Unclassified 1918
153 Ga0501036_0042765 3300049572 Bacteria 3836
154 Ga0501037_0053512 3300049573 Unclassified 2952
155 Ga0501038_0020779 3300049574 Bacteria 5901
156 Ga0501043_0039135 3300049579 Bacteria 3727
157 Ga0501043_0049203 3300049579 Unclassified 3314
158 Ga0501043_0144995 3300049579 Bacteria 1859
159 Ga0501043_0207002 3300049579 Bacteria 1521
160 Ga0501043_0586542 3300049579 Bacteria 825
161 Ga0501047_0030011 3300049581 Bacteria 5242
162 Ga0501047_0037567 3300049581 Bacteria 4682
163 Ga0501047_0055081 3300049581 Bacteria 3846
164 Ga0501047_0232147 3300049581 Bacteria 1698
165 Ga0501047_0468336 3300049581 Bacteria 1088
166 Ga0501219_000036 3300049703 Bacteria 21384
167 Ga0501035_0004654 3300049822 Bacteria 13021
168 Ga0501035_0034702 3300049822 Unclassified 4582
169 Ga0501035_0096728 3300049822 Bacteria 2594
170 Ga0501044_0016696 3300049823 Bacteria 7881
171 Ga0501044_0046074 3300049823 Unclassified 4516
172 Ga0501044_0128745 3300049823 Unclassified 2527
173 Ga0501044_0170142 3300049823 Unclassified 2151
174 Ga0501284_00038 3300050005 Bacteria 54754
175 nmdc:mga0k408_146070_c1 3300050493 Unclassified 1408
176 nmdc:mga05p37_122877_c1 3300050507 Bacteria 3189
177 nmdc:mga09592_131423_c1 3300050508 Bacteria 2154
178 nmdc:mga06r32_50633_c1 3300050510 Bacteria 3973
179 nmdc:mga08y16_185633_c1 3300050511 Bacteria 2158
180 Ga0500578_0000066 3300053086 Bacteria 116854
181 Ga0500578_0073441 3300053086 Bacteria 2179
182 Ga0500583_0000002 3300053092 Bacteria 232826
183 Ga0500583_0002659 3300053092 Bacteria 5429
184 Ga0500572_027815 3300053111 Bacteria 1552
185 Ga0500589_038583 3300053147 Bacteria 2230
186 Ga0500622_0040148 3300053156 Bacteria 2437
187 Ga0500636_0133017 3300053177 Bacteria 1384

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025246 Ga0209646_1000869 Ga0209646_100086910 183
2 3300049571 Ga0501034_0207037 Ga0501034_0207037_1143_1895 186
3 3300005339 Ga0070660_100160920 Ga0070660_1001609202 187
4 3300048925 Ga0496122_0237146 Ga0496122_0237146_258_1001 187
5 3300049579 Ga0501043_0049203 Ga0501043_0049203_1368_2120 188
6 3300050510 nmdc:mga06r32_50633_c1 nmdc:mga06r32_50633_c1_3117_3938 188
7 3300003323 rootH1_10026824 rootH1_1002682416 189
8 3300025921 Ga0207652_10082269 Ga0207652_100822694 189
9 3300049569 Ga0501032_0041697 Ga0501032_0041697_740_1501 189
10 3300049570 Ga0501033_0031320 Ga0501033_0031320_1905_2666 189
11 3300049571 Ga0501034_0041801 Ga0501034_0041801_1473_2234 189
12 3300049572 Ga0501036_0042765 Ga0501036_0042765_211_960 189
13 3300049573 Ga0501037_0053512 Ga0501037_0053512_719_1480 189
14 3300049574 Ga0501038_0020779 Ga0501038_0020779_4539_5300 189
15 3300049579 Ga0501043_0144995 Ga0501043_0144995_448_1209 189
16 3300049579 Ga0501043_0207002 Ga0501043_0207002_299_1048 189
17 3300049581 Ga0501047_0030011 Ga0501047_0030011_1575_2336 189
18 3300049581 Ga0501047_0232147 Ga0501047_0232147_784_1533 189
19 3300049822 Ga0501035_0004654 Ga0501035_0004654_6653_7402 189
20 3300049822 Ga0501035_0034702 Ga0501035_0034702_2305_3066 189
21 3300049823 Ga0501044_0046074 Ga0501044_0046074_2406_3167 189
22 3300031456 Ga0307513_10279181 Ga0307513_102791812 191
23 3300032004 Ga0307414_10049223 Ga0307414_100492233 192
24 3300046616 Ga0495668_0001819 Ga0495668_0001819_18379_19134 194
25 3300048927 Ga0496124_0031102 Ga0496124_0031102_91_792 194
26 iso_pu_bacteria 2818991444 2819589647 194
27 3300005329 Ga0070683_100022625 Ga0070683_1000226253 195
28 3300005618 Ga0068864_100880547 Ga0068864_1008805471 195
29 3300013306 Ga0163162_10161294 Ga0163162_101612942 195
30 3300013308 Ga0157375_10460093 Ga0157375_104600932 195
31 3300025944 Ga0207661_10013687 Ga0207661_100136873 195
32 3300026095 Ga0207676_10464462 Ga0207676_104644622 195
33 3300026142 Ga0207698_10283308 Ga0207698_102833082 195
34 3300049569 Ga0501032_0415416 Ga0501032_0415416_48_821 195
35 3300049823 Ga0501044_0170142 Ga0501044_0170142_10_720 195
36 3300005335 Ga0070666_10310894 Ga0070666_103108942 196
37 3300005355 Ga0070671_100323657 Ga0070671_1003236571 196
38 3300005365 Ga0070688_100088939 Ga0070688_1000889392 196
39 3300005617 Ga0068859_100426220 Ga0068859_1004262202 196
40 3300006931 Ga0097620_100426218 Ga0097620_1004262182 196
41 3300013296 Ga0157374_10086475 Ga0157374_100864753 196
42 3300013297 Ga0157378_10308858 Ga0157378_103088582 196
43 3300014968 Ga0157379_10306462 Ga0157379_103064622 196
44 3300021384 Ga0213876_10021883 Ga0213876_100218834 196
45 3300025923 Ga0207681_10422861 Ga0207681_104228611 196
46 3300025931 Ga0207644_10111686 Ga0207644_101116862 196
47 3300026089 Ga0207648_10264478 Ga0207648_102644782 196
48 3300039437 Ga0436365_1321487 Ga0436365_1321487_11362_12123 196
49 3300044842 Ga0466957_0002599 Ga0466957_0002599_8623_9285 196
50 3300046460 Ga0495638_0282267 Ga0495638_0282267_73_792 196
51 3300049571 Ga0501034_0077379 Ga0501034_0077379_2101_2895 196
52 3300049579 Ga0501043_0039135 Ga0501043_0039135_805_1590 196
53 3300049581 Ga0501047_0037567 Ga0501047_0037567_3632_4324 196
54 3300049581 Ga0501047_0055081 Ga0501047_0055081_650_1435 196
55 3300049581 Ga0501047_0468336 Ga0501047_0468336_254_973 196
56 3300049822 Ga0501035_0096728 Ga0501035_0096728_1426_2211 196
57 3300049823 Ga0501044_0016696 Ga0501044_0016696_629_1321 196
58 3300049823 Ga0501044_0128745 Ga0501044_0128745_153_914 196
59 3300003323 rootH1_10010170 rootH1_100101701 197
60 3300005331 Ga0070670_100620109 Ga0070670_1006201092 197
61 3300005335 Ga0070666_10055712 Ga0070666_100557124 197
62 3300005336 Ga0070680_100004542 Ga0070680_10000454212 197
63 3300005338 Ga0068868_100343757 Ga0068868_1003437572 197
64 3300005339 Ga0070660_100008391 Ga0070660_1000083912 197
65 3300005343 Ga0070687_100034283 Ga0070687_1000342832 197
66 3300005354 Ga0070675_100166631 Ga0070675_1001666313 197
67 3300005355 Ga0070671_100032925 Ga0070671_1000329251 197
68 3300005355 Ga0070671_100062701 Ga0070671_1000627012 197
69 3300005356 Ga0070674_100044197 Ga0070674_1000441972 197
70 3300005356 Ga0070674_100061419 Ga0070674_1000614192 197
71 3300005364 Ga0070673_100114288 Ga0070673_1001142885 197
72 3300005364 Ga0070673_100625949 Ga0070673_1006259491 197
73 3300005456 Ga0070678_100178235 Ga0070678_1001782352 197
74 3300005458 Ga0070681_10051045 Ga0070681_100510451 197
75 3300005466 Ga0070685_10402632 Ga0070685_104026322 197
76 3300005530 Ga0070679_100003499 Ga0070679_10000349912 197
77 3300005539 Ga0068853_100157008 Ga0068853_1001570082 197
78 3300005539 Ga0068853_100762040 Ga0068853_1007620402 197
79 3300005543 Ga0070672_100047712 Ga0070672_1000477126 197
80 3300005544 Ga0070686_100144660 Ga0070686_1001446602 197
81 3300005563 Ga0068855_100231880 Ga0068855_1002318802 197
82 3300005564 Ga0070664_100076746 Ga0070664_1000767462 197
83 3300005578 Ga0068854_100516800 Ga0068854_1005168001 197
84 3300005615 Ga0070702_100002159 Ga0070702_1000021595 197
85 3300005616 Ga0068852_100051694 Ga0068852_1000516944 197
86 3300005718 Ga0068866_10377221 Ga0068866_103772211 197
87 3300005719 Ga0068861_100071480 Ga0068861_1000714802 197
88 3300005841 Ga0068863_100043172 Ga0068863_1000431723 197
89 3300005842 Ga0068858_100202879 Ga0068858_1002028793 197
90 3300005842 Ga0068858_100657719 Ga0068858_1006577191 197
91 3300005843 Ga0068860_100274604 Ga0068860_1002746043 197
92 3300006237 Ga0097621_100001025 Ga0097621_10000102516 197
93 3300006358 Ga0068871_100000029 Ga0068871_10000002933 197
94 3300006358 Ga0068871_100451281 Ga0068871_1004512812 197
95 3300006847 Ga0075431_100037366 Ga0075431_1000373663 197
96 3300006880 Ga0075429_100220910 Ga0075429_1002209102 197
97 3300009094 Ga0111539_10127443 Ga0111539_101274433 197
98 3300009176 Ga0105242_10044361 Ga0105242_100443614 197
99 3300009176 Ga0105242_10868815 Ga0105242_108688151 197
100 3300009177 Ga0105248_10035786 Ga0105248_100357863 197
101 3300009553 Ga0105249_10027167 Ga0105249_100271674 197
102 3300011119 Ga0105246_10170582 Ga0105246_101705822 197
103 3300013104 Ga0157370_10113362 Ga0157370_101133623 197
104 3300013105 Ga0157369_10170113 Ga0157369_101701132 197
105 3300013105 Ga0157369_10902703 Ga0157369_109027031 197
106 3300013296 Ga0157374_10320832 Ga0157374_103208322 197
107 3300013296 Ga0157374_10541187 Ga0157374_105411871 197
108 3300013297 Ga0157378_10006350 Ga0157378_1000635012 197
109 3300013297 Ga0157378_10024040 Ga0157378_100240404 197
110 3300013306 Ga0163162_10000195 Ga0163162_1000019517 197
111 3300013306 Ga0163162_10111492 Ga0163162_101114922 197
112 3300013306 Ga0163162_10721651 Ga0163162_107216512 197
113 3300013307 Ga0157372_10344952 Ga0157372_103449522 197
114 3300013307 Ga0157372_10600856 Ga0157372_106008561 197
115 3300013308 Ga0157375_10003192 Ga0157375_100031922 197
116 3300013308 Ga0157375_10068336 Ga0157375_100683362 197
117 3300013308 Ga0157375_10473753 Ga0157375_104737532 197
118 3300013308 Ga0157375_10517043 Ga0157375_105170431 197
119 3300014325 Ga0163163_10000377 Ga0163163_100003776 197
120 3300014326 Ga0157380_10003319 Ga0157380_1000331913 197
121 3300014745 Ga0157377_10019507 Ga0157377_100195076 197
122 3300014968 Ga0157379_10115480 Ga0157379_101154802 197
123 3300014968 Ga0157379_10197202 Ga0157379_101972022 197
124 3300014969 Ga0157376_10001210 Ga0157376_1000121015 197
125 3300014969 Ga0157376_10038455 Ga0157376_100384553 197
126 3300017792 Ga0163161_10001838 Ga0163161_100018386 197
127 3300017792 Ga0163161_10015414 Ga0163161_100154142 197
128 3300025899 Ga0207642_10288408 Ga0207642_102884081 197
129 3300025901 Ga0207688_10017830 Ga0207688_100178302 197
130 3300025903 Ga0207680_10072938 Ga0207680_100729382 197
131 3300025907 Ga0207645_10008391 Ga0207645_100083918 197
132 3300025909 Ga0207705_10080766 Ga0207705_100807663 197
133 3300025912 Ga0207707_10109442 Ga0207707_101094423 197
134 3300025917 Ga0207660_10227606 Ga0207660_102276061 197
135 3300025919 Ga0207657_10085867 Ga0207657_100858672 197
136 3300025921 Ga0207652_10001304 Ga0207652_1000130420 197
137 3300025926 Ga0207659_10136677 Ga0207659_101366772 197
138 3300025931 Ga0207644_10049101 Ga0207644_100491014 197
139 3300025933 Ga0207706_10225847 Ga0207706_102258472 197
140 3300025941 Ga0207711_10042818 Ga0207711_100428184 197
141 3300025945 Ga0207679_10143101 Ga0207679_101431014 197
142 3300025949 Ga0207667_10142802 Ga0207667_101428022 197
143 3300025961 Ga0207712_10277658 Ga0207712_102776581 197
144 3300025981 Ga0207640_10249554 Ga0207640_102495541 197
145 3300025986 Ga0207658_10407666 Ga0207658_104076661 197
146 3300026035 Ga0207703_10208201 Ga0207703_102082012 197
147 3300026088 Ga0207641_10039570 Ga0207641_100395704 197
148 3300026089 Ga0207648_10106648 Ga0207648_101066483 197
149 3300026118 Ga0207675_100047745 Ga0207675_1000477455 197
150 3300026118 Ga0207675_100485312 Ga0207675_1004853122 197
151 3300026121 Ga0207683_10104780 Ga0207683_101047804 197
152 3300026121 Ga0207683_10181010 Ga0207683_101810102 197
153 3300026142 Ga0207698_10039811 Ga0207698_100398112 197
154 3300028381 Ga0268264_10369449 Ga0268264_103694492 197
155 3300031251 Ga0265327_10008375 Ga0265327_100083753 197
156 3300031456 Ga0307513_10287734 Ga0307513_102877342 197
157 3300031507 Ga0307509_10232530 Ga0307509_102325302 197
158 3300031730 Ga0307516_10002853 Ga0307516_1000285311 197
159 3300037068 Ga0373925_0092987 Ga0373925_0092987_857_1627 197
160 3300041459 Ga0451800_0434419 Ga0451800_0434419_171_896 197
161 3300041460 Ga0451802_1683940 Ga0451802_1683940_223_987 197
162 3300042014 Ga0439457_025741 Ga0439457_025741_449_1213 197
163 3300042015 Ga0439462_0017510 Ga0439462_0017510_1087_1809 197
164 3300044658 Ga0466972_0000083 Ga0466972_0000083_17901_18671 197
165 3300044658 Ga0466972_0005305 Ga0466972_0005305_3258_4022 197
166 3300044658 Ga0466972_0024493 Ga0466972_0024493_1631_2395 197
167 3300044712 Ga0453684_0103310 Ga0453684_0103310_604_1344 197
168 3300044712 Ga0453684_0187022 Ga0453684_0187022_1266_2039 197
169 3300044735 Ga0466968_0202947 Ga0466968_0202947_71_835 197
170 3300044901 Ga0466960_0081132 Ga0466960_0081132_637_1401 197
171 3300048904 Ga0496101_0155743 Ga0496101_0155743_437_1210 197
172 3300048909 Ga0496106_0359076 Ga0496106_0359076_27_800 197
173 3300048917 Ga0496114_0061432 Ga0496114_0061432_686_1459 197
174 3300049579 Ga0501043_0586542 Ga0501043_0586542_20_736 197
175 3300049703 Ga0501219_000036 Ga0501219_000036_6775_7527 197
176 3300050005 Ga0501284_00038 Ga0501284_00038_37207_37959 197
177 3300050493 nmdc:mga0k408_146070_c1 nmdc:mga0k408_146070_c1_204_974 197
178 3300050507 nmdc:mga05p37_122877_c1 nmdc:mga05p37_122877_c1_2076_2972 197
179 3300050508 nmdc:mga09592_131423_c1 nmdc:mga09592_131423_c1_1096_1992 197
180 3300050511 nmdc:mga08y16_185633_c1 nmdc:mga08y16_185633_c1_1012_1779 197
181 3300053086 Ga0500578_0000066 Ga0500578_0000066_36042_36806 197
182 3300053086 Ga0500578_0073441 Ga0500578_0073441_1268_2038 197
183 3300053092 Ga0500583_0000002 Ga0500583_0000002_49768_50496 197
184 3300053092 Ga0500583_0002659 Ga0500583_0002659_2112_2834 197
185 3300053111 Ga0500572_027815 Ga0500572_027815_726_1451 197
186 3300053147 Ga0500589_038583 Ga0500589_038583_1037_1759 197
187 3300053156 Ga0500622_0040148 Ga0500622_0040148_968_1690 197
188 3300053177 Ga0500636_0133017 Ga0500636_0133017_81_767 197

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10728

DUF2520

Domain of unknown function (DUF2520)

146

271

0.97

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

26

114

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d1l-assembly1.cif.gz_B crystal structure of putative nadp oxidoreductase bf3122 from bacteroides fragilis 0.9092 14 193
3d1l-assembly1.cif.gz_B crystal structure of putative nadp oxidoreductase bf3122 from bacteroides fragilis 0.8312 14 193
2i76-assembly1.cif.gz_B crystal structure of protein tm1727 from thermotoga maritima 0.8087 14 197
2i76-assembly1.cif.gz_A crystal structure of protein tm1727 from thermotoga maritima 0.7787 14 196
2i76-assembly1.cif.gz_B crystal structure of protein tm1727 from thermotoga maritima 0.7572 14 197
ID Description Score Start End Superfamily
3d1lB02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;ProC-like, C-terminal domain 0.9489 98 193 1.10.1040.20
3d1lB02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;ProC-like, C-terminal domain 0.9202 98 193 1.10.1040.20
af_O06279_7_172_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7971 14 93 3.40.50.720
af_A0A1D8PKZ7_1_169_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7791 31 98 3.40.50.720
2i76B02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;ProC-like, C-terminal domain 0.7784 102 197 1.10.1040.20
ID Description Score Start End GO Terms
AF-A0A3C1T3K1-F1-model_v4 DUF2520 domain-containing protein 0.9943 82 193
AF-A0A3C0IM21-F1-model_v4 DUF2520 domain-containing protein 0.9849 118 195
AF-A0A7D5S3P9-F1-model_v4 DUF2520 domain-containing protein 0.9781 133 197
AF-A0A3S0K1U8-F1-model_v4 DUF2520 domain-containing protein 0.9768 76 197
AF-A0A522E8L8-F1-model_v4 DUF2520 domain-containing protein 0.9767 66 193

Feature Viewer

pLDDT pTM Quality
90.79 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map