F289520

General Info

Members Datasets Scaffolds Average Seq Length
188 128 188 260

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_10000120|Ga0207661_1000012051
Length 292
Sequence MAAGARPTTTGKRTTTGSSFSPLAAAMVPYGSMPPTKKSLGQHWLHDPASLEAICDAAAVGPEDTVLEIGPGLGTLTTKLVARAKKVVAVEFDTELAKHLATRVPATNLEVLSQDILRFDLSTLPAGYKIVANIPYYLTSNLLRVLVESPTPFAQAALLVQKEVAERVCEHPGNMNLLAVCMQYYCEVRLGAVVPAKLFTPPPKVDSQVLVLTYRPEPLYPDVNVKEFFRIAKAGFAQRRKTLLNSLGAGLHLSREQAGALLENVDIPPATRAQSLTLDDWYALYEAYQDMQ

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
42 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
75 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
76 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
77 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
80 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
81 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
82 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
83 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
84 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
85 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
94 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
95 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
96 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
97 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
98 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
99 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
100 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
101 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
104 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
105 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
110 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
111 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
112 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
113 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
114 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
115 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
116 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
117 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
118 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
119 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
120 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
121 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
122 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
123 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
124 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
125 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
126 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
127 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
128 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.15
Nodule 0
Rhizoplane 0.53
Rhizosphere 77.66
Stem 0
Stem Tuber 0
Unclassified 2.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10057043 3300001979 Bacteria 1092
2 JGI24742J22300_10000003 3300002244 Bacteria 45975
3 rootH2_10000763 3300003320 Bacteria 99150
4 rootH1_10121068 3300003323 Unclassified 4314
5 Ga0070658_10000020 3300005327 Bacteria 188851
6 Ga0070658_10011403 3300005327 Bacteria 7128
7 Ga0070683_100000432 3300005329 Bacteria 29084
8 Ga0070683_100058676 3300005329 Bacteria 3575
9 Ga0070666_10094168 3300005335 Bacteria 2060
10 Ga0070680_100004159 3300005336 Bacteria 10844
11 Ga0070660_100002488 3300005339 Bacteria 12643
12 Ga0070660_100254628 3300005339 Bacteria 1432
13 Ga0070669_100127577 3300005353 Unclassified 1948
14 Ga0070674_100044147 3300005356 Bacteria 3037
15 Ga0070673_100000033 3300005364 Bacteria 60744
16 Ga0070688_100048922 3300005365 Unclassified 2629
17 Ga0070659_100289749 3300005366 Unclassified 1363
18 Ga0070678_100000498 3300005456 Bacteria 18864
19 Ga0070681_10092973 3300005458 Bacteria 2965
20 Ga0070681_10093237 3300005458 Unclassified 2960
21 Ga0070685_10000334 3300005466 Bacteria 28953
22 Ga0070679_100006848 3300005530 Bacteria 10631
23 Ga0070679_100219158 3300005530 Bacteria 1864
24 Ga0070684_100001855 3300005535 Bacteria 15471
25 Ga0070684_100030111 3300005535 Bacteria 4609
26 Ga0070672_100008744 3300005543 Bacteria 6951
27 Ga0068855_100000005 3300005563 Bacteria 337711
28 Ga0068855_100000990 3300005563 Bacteria 35322
29 Ga0068855_100011730 3300005563 Bacteria 10594
30 Ga0068855_100146720 3300005563 Bacteria 2685
31 Ga0068857_100001409 3300005577 Bacteria 19000
32 Ga0068857_100073414 3300005577 Bacteria 3048
33 Ga0068852_100000001 3300005616 Bacteria 716526
34 Ga0068863_100033495 3300005841 Bacteria 4895
35 Ga0068860_100149351 3300005843 Bacteria 2250
36 Ga0068860_100516284 3300005843 Bacteria 1194
37 Ga0081455_10000001 3300005937 Bacteria 603871
38 Ga0075365_10000008 3300006038 Bacteria 114620
39 Ga0075365_10000041 3300006038 Bacteria 43185
40 Ga0075365_10016732 3300006038 Bacteria 4469
41 Ga0075368_10000639 3300006042 Bacteria 10627
42 Ga0075363_100004976 3300006048 Bacteria 5881
43 Ga0075364_10026587 3300006051 Bacteria 3692
44 Ga0075364_10158727 3300006051 Unclassified 1526
45 Ga0075362_10019331 3300006177 Bacteria 2831
46 Ga0075369_10028160 3300006186 Bacteria 2354
47 Ga0075428_100002220 3300006844 Bacteria 21042
48 Ga0105240_10000004 3300009093 Bacteria 708156
49 Ga0105240_10001037 3300009093 Bacteria 49391
50 Ga0105240_10007176 3300009093 Bacteria 16225
51 Ga0105240_10009152 3300009093 Bacteria 14052
52 Ga0105240_10062431 3300009093 Bacteria 4639
53 Ga0105245_10094690 3300009098 Bacteria 2753
54 Ga0105245_10649666 3300009098 Unclassified 1085
55 Ga0105245_10687694 3300009098 Bacteria 1055
56 Ga0105243_10022915 3300009148 Bacteria 4748
57 Ga0105241_10107881 3300009174 Unclassified 2225
58 Ga0105242_10014996 3300009176 Bacteria 6008
59 Ga0105242_10071620 3300009176 Unclassified 2877
60 Ga0105248_10062741 3300009177 Bacteria 4172
61 Ga0105237_10000001 3300009545 Bacteria 1009213
62 Ga0105237_10000002 3300009545 Bacteria 702357
63 Ga0105237_10108381 3300009545 Bacteria 2769
64 Ga0105032_100025 3300009979 Bacteria 33986
65 Ga0105028_100017 3300009993 Bacteria 21566
66 Ga0105239_10020034 3300010375 Bacteria 7381
67 Ga0157371_10000105 3300013102 Bacteria 126728
68 Ga0157370_10000168 3300013104 Bacteria 80700
69 Ga0157369_10000003 3300013105 Bacteria 507337
70 Ga0157369_10003043 3300013105 Bacteria 20014
71 Ga0157369_10006246 3300013105 Bacteria 13824
72 Ga0157369_10024524 3300013105 Bacteria 6709
73 Ga0157369_10074752 3300013105 Unclassified 3634
74 Ga0157369_10742636 3300013105 Bacteria 1010
75 Ga0157374_10000096 3300013296 Bacteria 82179
76 Ga0157374_10002673 3300013296 Bacteria 14999
77 Ga0157374_10025936 3300013296 Bacteria 5269
78 Ga0157374_10354123 3300013296 Bacteria 1459
79 Ga0157378_10018194 3300013297 Bacteria 6170
80 Ga0157372_10000002 3300013307 Bacteria 687862
81 Ga0157372_10000160 3300013307 Bacteria 73603
82 Ga0157372_10073133 3300013307 Bacteria 3863
83 Ga0157372_10258808 3300013307 Bacteria 2021
84 Ga0163163_10091667 3300014325 Unclassified 3054
85 Ga0157377_10017021 3300014745 Bacteria 3754
86 Ga0207680_10076004 3300025903 Bacteria 2096
87 Ga0207705_10000115 3300025909 Bacteria 89955
88 Ga0207705_10008209 3300025909 Bacteria 7636
89 Ga0207707_10166089 3300025912 Bacteria 1929
90 Ga0207707_10228206 3300025912 Bacteria 1620
91 Ga0207695_10000009 3300025913 Bacteria 1034276
92 Ga0207695_10002087 3300025913 Bacteria 30417
93 Ga0207695_10003753 3300025913 Bacteria 21111
94 Ga0207695_10019661 3300025913 Bacteria 7767
95 Ga0207671_10000003 3300025914 Bacteria 1065461
96 Ga0207671_10000008 3300025914 Bacteria 798229
97 Ga0207660_10008934 3300025917 Bacteria 6484
98 Ga0207657_10000772 3300025919 Bacteria 33957
99 Ga0207657_10006284 3300025919 Bacteria 12348
100 Ga0207657_10007372 3300025919 Bacteria 11286
101 Ga0207652_10001769 3300025921 Bacteria 18828
102 Ga0207652_10404949 3300025921 Unclassified 1231
103 Ga0207652_10555027 3300025921 Unclassified 1032
104 Ga0207644_10057197 3300025931 Bacteria 2815
105 Ga0207690_10126408 3300025932 Unclassified 1865
106 Ga0207686_10016300 3300025934 Bacteria 4170
107 Ga0207686_10118549 3300025934 Bacteria 1798
108 Ga0207709_10110561 3300025935 Bacteria 1836
109 Ga0207691_10076716 3300025940 Unclassified 3011
110 Ga0207661_10000120 3300025944 Bacteria 50228
111 Ga0207667_10000027 3300025949 Bacteria 337700
112 Ga0207658_10033151 3300025986 Unclassified 3682
113 Ga0207674_10001826 3300026116 Bacteria 27174
114 Ga0207674_10090728 3300026116 Bacteria 3047
115 Ga0207674_10438438 3300026116 Bacteria 1263
116 Ga0207683_10217354 3300026121 Bacteria 1741
117 Ga0207698_10000001 3300026142 Bacteria 625389
118 Ga0209813_10000251 3300027866 Bacteria 15589
119 Ga0268266_10277664 3300028379 Bacteria 1557
120 Ga0268264_10084635 3300028381 Unclassified 2720
121 Ga0265326_10000825 3300028558 Bacteria 11416
122 Ga0265319_1003447 3300028563 Bacteria 8234
123 Ga0265334_10000004 3300028573 Bacteria 243436
124 Ga0265334_10034494 3300028573 Bacteria 2008
125 Ga0265318_10015356 3300028577 Bacteria 3189
126 Ga0265338_10000003 3300028800 Bacteria 733923
127 Ga0265338_10024075 3300028800 Bacteria 6231
128 Ga0314311_1146205 3300030733 Bacteria 1912
129 Ga0316179_1078429 3300030734 Bacteria 15213
130 Ga0316180_1067914 3300030736 Bacteria 4316
131 Ga0316183_1005382 3300030742 Bacteria 21667
132 Ga0316183_1009146 3300030742 Bacteria 14177
133 Ga0316181_1020431 3300030744 Bacteria 46502
134 Ga0316182_1003092 3300030745 Bacteria 41807
135 Ga0316182_1068941 3300030745 Bacteria 3085
136 Ga0316182_1214308 3300030745 Bacteria 13254
137 Ga0265329_10052919 3300031242 Unclassified 1291
138 Ga0265316_10023114 3300031344 Bacteria 5227
139 Ga0307516_10000091 3300031730 Bacteria 101445
140 Ga0307516_10011743 3300031730 Bacteria 9503
141 Ga0307405_10063818 3300031731 Bacteria 2338
142 Ga0307412_10055148 3300031911 Bacteria 2642
143 Ga0395899_0080911 3300037312 Bacteria 2364
144 Ga0395905_0004898 3300037471 Bacteria 13795
145 Ga0395901_0057136 3300038443 Bacteria 4059
146 Ga0439438_003461 3300041405 Bacteria 6377
147 Ga0451791_0059111 3300041451 Bacteria 927
148 Ga0439442_005601 3300042002 Bacteria 2512
149 Ga0439445_0002955 3300042004 Bacteria 3798
150 Ga0439432_006735 3300042006 Bacteria 4092
151 Ga0450906_006538 3300042145 Bacteria 2348
152 Ga0439446_0000236 3300042156 Bacteria 10208
153 Ga0450909_018390 3300042185 Unclassified 1037
154 Ga0439434_0000829 3300042435 Bacteria 8912
155 Ga0495638_0000061 3300046460 Bacteria 188551
156 Ga0495597_0033209 3300046542 Bacteria 2338
157 Ga0495660_0000005 3300046810 Bacteria 574567
158 Ga0496124_0381687 3300048927 Unclassified 985
159 Ga0501034_0000028 3300049571 Bacteria 255803
160 Ga0501034_0001632 3300049571 Bacteria 29045
161 Ga0501037_0000001 3300049573 Bacteria 753276
162 Ga0501038_0174762 3300049574 Unclassified 1736
163 nmdc:mga00v17_211_c1 3300050491 Bacteria 35324
164 nmdc:mga0yw44_17_c1 3300050492 Bacteria 74504
165 nmdc:mga0yw44_1_c1 3300050492 Bacteria 702221
166 nmdc:mga0yw44_4_c1 3300050492 Bacteria 450247
167 nmdc:mga06z11_196_c1 3300050494 Bacteria 24317
168 nmdc:mga07m45_29920_c1 3300050496 Bacteria 3015
169 Ga0500643_001279 3300053087 Bacteria 14856
170 Ga0500646_0000075 3300053090 Bacteria 28149
171 Ga0500583_0019270 3300053092 Bacteria 2794
172 Ga0500651_0000001 3300053093 Bacteria 529808
173 Ga0500651_0000567 3300053093 Bacteria 18811
174 Ga0500651_0001674 3300053093 Bacteria 11314
175 Ga0500641_0000001 3300053096 Bacteria 1115973
176 Ga0500650_0009280 3300053098 Bacteria 3940
177 Ga0500569_000014 3300053109 Bacteria 50618
178 Ga0500594_0000074 3300053118 Bacteria 31465
179 Ga0500614_001057 3300053123 Bacteria 6849
180 Ga0500642_0000428 3300053130 Bacteria 13705
181 Ga0500652_000001 3300053131 Bacteria 946868
182 Ga0500652_147401 3300053131 Bacteria 977
183 Ga0500568_0025177 3300053139 Bacteria 2514
184 Ga0500577_0001315 3300053142 Bacteria 6357
185 Ga0500577_0013797 3300053142 Bacteria 2479
186 Ga0500588_0000029 3300053146 Bacteria 32025
187 Ga0500589_000007 3300053147 Bacteria 145453
188 Ga0500616_0000012 3300053153 Bacteria 681798

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10011403 Ga0070658_100114033 238
2 3300005336 Ga0070680_100004159 Ga0070680_1000041595 238
3 3300005339 Ga0070660_100002488 Ga0070660_10000248811 238
4 3300005458 Ga0070681_10092973 Ga0070681_100929733 238
5 3300005530 Ga0070679_100006848 Ga0070679_1000068486 238
6 3300013307 Ga0157372_10073133 Ga0157372_100731333 238
7 3300025909 Ga0207705_10008209 Ga0207705_100082095 238
8 3300025912 Ga0207707_10228206 Ga0207707_102282061 238
9 3300025917 Ga0207660_10008934 Ga0207660_100089343 238
10 3300025919 Ga0207657_10007372 Ga0207657_1000737210 238
11 3300025921 Ga0207652_10001769 Ga0207652_1000176922 238
12 3300005329 Ga0070683_100058676 Ga0070683_1000586763 240
13 3300005563 Ga0068855_100011730 Ga0068855_10001173010 240
14 3300005577 Ga0068857_100073414 Ga0068857_1000734142 240
15 3300026116 Ga0207674_10090728 Ga0207674_100907282 240
16 3300006038 Ga0075365_10000008 Ga0075365_1000000851 244
17 3300050492 nmdc:mga0yw44_1_c1 nmdc:mga0yw44_1_c1_67801_68580 244
18 3300005329 Ga0070683_100000432 Ga0070683_10000043222 245
19 3300005535 Ga0070684_100001855 Ga0070684_1000018552 245
20 3300041451 Ga0451791_0059111 Ga0451791_0059111_156_893 245
21 3300009098 Ga0105245_10094690 Ga0105245_100946902 253
22 3300009176 Ga0105242_10014996 Ga0105242_100149963 253
23 3300009177 Ga0105248_10062741 Ga0105248_100627413 253
24 3300025934 Ga0207686_10016300 Ga0207686_100163002 253
25 3300030745 Ga0316182_1068941 Ga0316182_10689414 254
26 3300037312 Ga0395899_0080911 Ga0395899_0080911_298_1065 254
27 3300009993 Ga0105028_100017 Ga0105028_10001717 255
28 3300028563 Ga0265319_1003447 Ga0265319_10034475 255
29 3300028577 Ga0265318_10015356 Ga0265318_100153562 255
30 3300028800 Ga0265338_10024075 Ga0265338_100240756 255
31 3300031344 Ga0265316_10023114 Ga0265316_100231142 255
32 3300048927 Ga0496124_0381687 Ga0496124_0381687_36_809 255
33 3300049571 Ga0501034_0001632 Ga0501034_0001632_17429_18196 255
34 3300053142 Ga0500577_0001315 Ga0500577_0001315_404_1186 255
35 3300053142 Ga0500577_0013797 Ga0500577_0013797_133_915 255
36 3300003320 rootH2_10000763 rootH2_1000076347 256
37 3300005841 Ga0068863_100033495 Ga0068863_1000334952 256
38 3300013105 Ga0157369_10074752 Ga0157369_100747523 256
39 3300025921 Ga0207652_10404949 Ga0207652_104049491 256
40 3300025931 Ga0207644_10057197 Ga0207644_100571972 256
41 3300028558 Ga0265326_10000825 Ga0265326_100008253 256
42 3300028573 Ga0265334_10000004 Ga0265334_10000004291 256
43 3300028800 Ga0265338_10000003 Ga0265338_10000003263 256
44 3300030742 Ga0316183_1005382 Ga0316183_100538213 256
45 3300030744 Ga0316181_1020431 Ga0316181_102043145 256
46 3300030745 Ga0316182_1003092 Ga0316182_100309234 256
47 3300031242 Ga0265329_10052919 Ga0265329_100529192 256
48 3300037471 Ga0395905_0004898 Ga0395905_0004898_9723_10505 256
49 3300042145 Ga0450906_006538 Ga0450906_006538_702_1472 256
50 3300046460 Ga0495638_0000061 Ga0495638_0000061_168585_169355 256
51 3300046542 Ga0495597_0033209 Ga0495597_0033209_122_925 256
52 3300053109 Ga0500569_000014 Ga0500569_000014_19197_20000 256
53 3300053146 Ga0500588_0000029 Ga0500588_0000029_5897_6700 256
54 3300001979 JGI24740J21852_10057043 JGI24740J21852_100570431 257
55 3300002244 JGI24742J22300_10000003 JGI24742J22300_1000000347 257
56 3300003323 rootH1_10121068 rootH1_101210682 257
57 3300005327 Ga0070658_10000020 Ga0070658_1000002024 257
58 3300005335 Ga0070666_10094168 Ga0070666_100941682 257
59 3300005339 Ga0070660_100254628 Ga0070660_1002546283 257
60 3300005353 Ga0070669_100127577 Ga0070669_1001275772 257
61 3300005356 Ga0070674_100044147 Ga0070674_1000441473 257
62 3300005364 Ga0070673_100000033 Ga0070673_10000003312 257
63 3300005365 Ga0070688_100048922 Ga0070688_1000489222 257
64 3300005366 Ga0070659_100289749 Ga0070659_1002897492 257
65 3300005456 Ga0070678_100000498 Ga0070678_10000049821 257
66 3300005458 Ga0070681_10093237 Ga0070681_100932374 257
67 3300005466 Ga0070685_10000334 Ga0070685_1000033422 257
68 3300005530 Ga0070679_100219158 Ga0070679_1002191583 257
69 3300005535 Ga0070684_100030111 Ga0070684_1000301114 257
70 3300005543 Ga0070672_100008744 Ga0070672_1000087443 257
71 3300005563 Ga0068855_100000005 Ga0068855_100000005340 257
72 3300005563 Ga0068855_100000990 Ga0068855_10000099013 257
73 3300005563 Ga0068855_100146720 Ga0068855_1001467203 257
74 3300005577 Ga0068857_100001409 Ga0068857_1000014096 257
75 3300005616 Ga0068852_100000001 Ga0068852_100000001388 257
76 3300005843 Ga0068860_100149351 Ga0068860_1001493512 257
77 3300005843 Ga0068860_100516284 Ga0068860_1005162841 257
78 3300005937 Ga0081455_10000001 Ga0081455_10000001414 257
79 3300006038 Ga0075365_10000041 Ga0075365_1000004120 257
80 3300006038 Ga0075365_10016732 Ga0075365_100167322 257
81 3300006042 Ga0075368_10000639 Ga0075368_1000063911 257
82 3300006048 Ga0075363_100004976 Ga0075363_1000049764 257
83 3300006051 Ga0075364_10026587 Ga0075364_100265874 257
84 3300006051 Ga0075364_10158727 Ga0075364_101587272 257
85 3300006177 Ga0075362_10019331 Ga0075362_100193313 257
86 3300006186 Ga0075369_10028160 Ga0075369_100281602 257
87 3300006844 Ga0075428_100002220 Ga0075428_10000222011 257
88 3300009093 Ga0105240_10000004 Ga0105240_1000000433 257
89 3300009093 Ga0105240_10001037 Ga0105240_1000103727 257
90 3300009093 Ga0105240_10007176 Ga0105240_1000717610 257
91 3300009093 Ga0105240_10009152 Ga0105240_100091524 257
92 3300009093 Ga0105240_10062431 Ga0105240_100624314 257
93 3300009098 Ga0105245_10649666 Ga0105245_106496662 257
94 3300009098 Ga0105245_10687694 Ga0105245_106876941 257
95 3300009148 Ga0105243_10022915 Ga0105243_100229152 257
96 3300009174 Ga0105241_10107881 Ga0105241_101078812 257
97 3300009176 Ga0105242_10071620 Ga0105242_100716203 257
98 3300009545 Ga0105237_10000001 Ga0105237_10000001409 257
99 3300009545 Ga0105237_10000002 Ga0105237_10000002284 257
100 3300009545 Ga0105237_10108381 Ga0105237_101083812 257
101 3300009979 Ga0105032_100025 Ga0105032_10002538 257
102 3300010375 Ga0105239_10020034 Ga0105239_100200345 257
103 3300013102 Ga0157371_10000105 Ga0157371_10000105146 257
104 3300013104 Ga0157370_10000168 Ga0157370_1000016869 257
105 3300013105 Ga0157369_10000003 Ga0157369_10000003437 257
106 3300013105 Ga0157369_10003043 Ga0157369_1000304318 257
107 3300013105 Ga0157369_10006246 Ga0157369_100062462 257
108 3300013105 Ga0157369_10024524 Ga0157369_100245243 257
109 3300013105 Ga0157369_10742636 Ga0157369_107426362 257
110 3300013296 Ga0157374_10000096 Ga0157374_1000009676 257
111 3300013296 Ga0157374_10002673 Ga0157374_100026735 257
112 3300013296 Ga0157374_10025936 Ga0157374_100259361 257
113 3300013296 Ga0157374_10354123 Ga0157374_103541232 257
114 3300013297 Ga0157378_10018194 Ga0157378_100181948 257
115 3300013307 Ga0157372_10000002 Ga0157372_1000000211 257
116 3300013307 Ga0157372_10000160 Ga0157372_100001604 257
117 3300013307 Ga0157372_10258808 Ga0157372_102588082 257
118 3300014325 Ga0163163_10091667 Ga0163163_100916673 257
119 3300014745 Ga0157377_10017021 Ga0157377_100170212 257
120 3300025903 Ga0207680_10076004 Ga0207680_100760042 257
121 3300025909 Ga0207705_10000115 Ga0207705_1000011575 257
122 3300025912 Ga0207707_10166089 Ga0207707_101660891 257
123 3300025913 Ga0207695_10000009 Ga0207695_10000009412 257
124 3300025913 Ga0207695_10002087 Ga0207695_1000208710 257
125 3300025913 Ga0207695_10003753 Ga0207695_1000375310 257
126 3300025913 Ga0207695_10019661 Ga0207695_100196618 257
127 3300025914 Ga0207671_10000003 Ga0207671_10000003412 257
128 3300025914 Ga0207671_10000008 Ga0207671_10000008387 257
129 3300025919 Ga0207657_10000772 Ga0207657_1000077223 257
130 3300025919 Ga0207657_10006284 Ga0207657_100062849 257
131 3300025921 Ga0207652_10555027 Ga0207652_105550271 257
132 3300025932 Ga0207690_10126408 Ga0207690_101264082 257
133 3300025934 Ga0207686_10118549 Ga0207686_101185492 257
134 3300025935 Ga0207709_10110561 Ga0207709_101105612 257
135 3300025940 Ga0207691_10076716 Ga0207691_100767164 257
136 3300025944 Ga0207661_10000120 Ga0207661_1000012051 257
137 3300025949 Ga0207667_10000027 Ga0207667_10000027336 257
138 3300025986 Ga0207658_10033151 Ga0207658_100331512 257
139 3300026116 Ga0207674_10001826 Ga0207674_1000182610 257
140 3300026116 Ga0207674_10438438 Ga0207674_104384382 257
141 3300026121 Ga0207683_10217354 Ga0207683_102173543 257
142 3300026142 Ga0207698_10000001 Ga0207698_10000001340 257
143 3300027866 Ga0209813_10000251 Ga0209813_100002519 257
144 3300028379 Ga0268266_10277664 Ga0268266_102776642 257
145 3300028381 Ga0268264_10084635 Ga0268264_100846353 257
146 3300028573 Ga0265334_10034494 Ga0265334_100344942 257
147 3300030733 Ga0314311_1146205 Ga0314311_11462052 257
148 3300030734 Ga0316179_1078429 Ga0316179_107842912 257
149 3300030736 Ga0316180_1067914 Ga0316180_10679144 257
150 3300030742 Ga0316183_1009146 Ga0316183_100914610 257
151 3300030745 Ga0316182_1214308 Ga0316182_12143085 257
152 3300031730 Ga0307516_10000091 Ga0307516_1000009188 257
153 3300031730 Ga0307516_10011743 Ga0307516_100117432 257
154 3300031731 Ga0307405_10063818 Ga0307405_100638181 257
155 3300031911 Ga0307412_10055148 Ga0307412_100551482 257
156 3300038443 Ga0395901_0057136 Ga0395901_0057136_960_1772 257
157 3300041405 Ga0439438_003461 Ga0439438_003461_1644_2471 257
158 3300042002 Ga0439442_005601 Ga0439442_005601_1111_1890 257
159 3300042004 Ga0439445_0002955 Ga0439445_0002955_289_1065 257
160 3300042006 Ga0439432_006735 Ga0439432_006735_1576_2352 257
161 3300042156 Ga0439446_0000236 Ga0439446_0000236_3436_4263 257
162 3300042185 Ga0450909_018390 Ga0450909_018390_30_857 257
163 3300042435 Ga0439434_0000829 Ga0439434_0000829_1728_2507 257
164 3300046810 Ga0495660_0000005 Ga0495660_0000005_242950_243723 257
165 3300049571 Ga0501034_0000028 Ga0501034_0000028_98141_98914 257
166 3300049573 Ga0501037_0000001 Ga0501037_0000001_98836_99609 257
167 3300049574 Ga0501038_0174762 Ga0501038_0174762_623_1465 257
168 3300050491 nmdc:mga00v17_211_c1 nmdc:mga00v17_211_c1_2133_2915 257
169 3300050492 nmdc:mga0yw44_17_c1 nmdc:mga0yw44_17_c1_25321_26145 257
170 3300050492 nmdc:mga0yw44_4_c1 nmdc:mga0yw44_4_c1_211489_212271 257
171 3300050494 nmdc:mga06z11_196_c1 nmdc:mga06z11_196_c1_18706_19488 257
172 3300050496 nmdc:mga07m45_29920_c1 nmdc:mga07m45_29920_c1_2193_2975 257
173 3300053087 Ga0500643_001279 Ga0500643_001279_3713_4498 257
174 3300053090 Ga0500646_0000075 Ga0500646_0000075_14937_15710 257
175 3300053092 Ga0500583_0019270 Ga0500583_0019270_752_1534 257
176 3300053093 Ga0500651_0000001 Ga0500651_0000001_446597_447382 257
177 3300053093 Ga0500651_0000567 Ga0500651_0000567_10444_11268 257
178 3300053093 Ga0500651_0001674 Ga0500651_0001674_2390_3196 257
179 3300053096 Ga0500641_0000001 Ga0500641_0000001_1081349_1082122 257
180 3300053098 Ga0500650_0009280 Ga0500650_0009280_100_873 257
181 3300053118 Ga0500594_0000074 Ga0500594_0000074_19292_20077 257
182 3300053123 Ga0500614_001057 Ga0500614_001057_3701_4525 257
183 3300053130 Ga0500642_0000428 Ga0500642_0000428_6705_7499 257
184 3300053131 Ga0500652_000001 Ga0500652_000001_396279_397100 257
185 3300053131 Ga0500652_147401 Ga0500652_147401_166_948 257
186 3300053139 Ga0500568_0025177 Ga0500568_0025177_976_1764 257
187 3300053147 Ga0500589_000007 Ga0500589_000007_104240_105034 257
188 3300053153 Ga0500616_0000012 Ga0500616_0000012_285465_286238 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00398

RrnaAD

Ribosomal RNA adenine dimethylase

34

290

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ifv-assembly2.cif.gz_B c-terminal truncated ksga from bacillus subtilis 168 0.9351 3 183
3fuu-assembly1.cif.gz_A t. thermophilus 16s rrna a1518 and a1519 methyltransferase (ksga) in complex with adenosine in space group p212121 0.9236 5 257
3fuv-assembly1.cif.gz_A apo-form of t. thermophilus 16s rrna a1518 and a1519 methyltransferase (ksga) in space group p43212 0.9234 9 257
6ifv-assembly1.cif.gz_A c-terminal truncated ksga from bacillus subtilis 168 0.9209 6 183
3fuv-assembly3.cif.gz_C apo-form of t. thermophilus 16s rrna a1518 and a1519 methyltransferase (ksga) in space group p43212 0.9206 6 257
ID Description Score Start End Superfamily
af_Q54QK7_28_214_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9423 3 186 3.40.50.150
af_P9WH07_6_221_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9416 3 184 3.40.50.150
6ifwA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9411 12 186 3.40.50.150
3fuxB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9374 3 182 3.40.50.150
af_O65090_67_269_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9298 3 183 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A521Z848-F1-model_v4 Ribosomal RNA small subunit methyltransferase A (EC 2.1.1.182) (16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase) (16S rRNA dimethyladenosine transferase) (16S rRNA dimethylase) (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) 0.9741 3 256 GO:0003723
GO:0005829
GO:0052908
AF-A0A1G2ICI1-F1-model_v4 Ribosomal RNA small subunit methyltransferase A (EC 2.1.1.182) (16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase) (16S rRNA dimethyladenosine transferase) (16S rRNA dimethylase) (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) 0.9722 3 255 GO:0003723
GO:0005829
GO:0052908
AF-A0A3C0TF53-F1-model_v4 rRNA adenine N-6-methyltransferase (Macrolide-lincosamide-streptogramin B resistance protein) 0.9706 2 189 GO:0000179
GO:0003723
GO:0005829
AF-A0A7C1KDY4-F1-model_v4 16S rRNA (Adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase RsmA 0.9684 109 256 GO:0000179
GO:0003723
GO:0005829
AF-A0A0G0W7Y7-F1-model_v4 Ribosomal RNA small subunit methyltransferase A (EC 2.1.1.182) (16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase) (16S rRNA dimethyladenosine transferase) (16S rRNA dimethylase) (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) 0.9673 5 254 GO:0003723
GO:0005829
GO:0052908

Feature Viewer

pLDDT pTM Quality
94.4 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map