F289757

General Info

Members Datasets Scaffolds Average Seq Length
188 107 187 109

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0000023|Ga0451577_0000023_389307_389684
Length 125
Sequence MTRPPLARRVGGAQRRGTMSLPTEFSGVTVHTKANVYFDGKVVSHTVLFAGGAKKTLGLIYPGSYHFGTGAPERMEIVAGACRVQLDGATAGQDYAAGTYFDVPGKSGFTIEVKGGLCEYICSFL

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
25 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
26 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
27 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
28 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
29 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
38 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
39 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
40 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
41 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
42 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
43 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
44 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
45 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
46 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
47 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
48 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
49 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
50 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
51 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
54 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
55 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
58 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
59 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
60 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
61 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
62 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
69 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
70 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
71 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
72 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
73 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
74 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
75 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
76 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
77 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
78 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
81 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
97 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
98 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
99 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
100 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
101 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
102 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
105 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
106 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
107 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.06
Nodule 0
Rhizoplane 1.06
Rhizosphere 90.96
Stem 0
Stem Tuber 0
Unclassified 6.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10070941 3300003320 Bacteria 18619
2 rootL2_10057048 3300003322 Bacteria 12848
3 rootL2_10277371 3300003322 Bacteria 1226
4 Ga0070658_11741253 3300005327 Bacteria 539
5 Ga0070683_100136730 3300005329 Unclassified 2321
6 Ga0070677_10646940 3300005333 Unclassified 590
7 Ga0068869_100000092 3300005334 Bacteria 41548
8 Ga0068869_101235161 3300005334 Unclassified 658
9 Ga0068868_100011467 3300005338 Bacteria 6454
10 Ga0070689_100071480 3300005340 Bacteria 2711
11 Ga0070687_100708577 3300005343 Unclassified 704
12 Ga0070678_101839983 3300005456 Bacteria 571
13 Ga0068867_100000277 3300005459 Bacteria 33777
14 Ga0068853_100587584 3300005539 Bacteria 1057
15 Ga0068856_100030011 3300005614 Bacteria 5314
16 Ga0068859_101268718 3300005617 Unclassified 812
17 Ga0068861_101167311 3300005719 Unclassified 743
18 Ga0068858_101276263 3300005842 Unclassified 722
19 Ga0070717_10000079 3300006028 Bacteria 79689
20 Ga0070717_10603189 3300006028 Unclassified 996
21 Ga0070717_11407326 3300006028 Unclassified 633
22 Ga0097621_100252633 3300006237 Bacteria 1544
23 Ga0068871_100030145 3300006358 Bacteria 4269
24 Ga0075428_100407298 3300006844 Bacteria 1457
25 Ga0068865_100004023 3300006881 Bacteria 8833
26 Ga0068865_102164747 3300006881 Bacteria 506
27 Ga0097620_101268588 3300006931 Unclassified 812
28 Ga0105246_11680797 3300011119 Bacteria 603
29 Ga0157374_10222895 3300013296 Bacteria 1851
30 Ga0157378_11641586 3300013297 Bacteria 689
31 Ga0163162_10463005 3300013306 Bacteria 1399
32 Ga0157380_10954994 3300014326 Bacteria 887
33 Ga0157380_12243895 3300014326 Bacteria 610
34 Ga0207670_10052146 3300025936 Bacteria 2750
35 Ga0207704_10104901 3300025938 Bacteria 1895
36 Ga0207689_10000120 3300025942 Bacteria 65319
37 Ga0207689_10777383 3300025942 Unclassified 808
38 Ga0207661_10112263 3300025944 Unclassified 2307
39 Ga0207677_10030733 3300026023 Bacteria 3432
40 Ga0207648_10004413 3300026089 Bacteria 14450
41 Ga0207674_10529458 3300026116 Bacteria 1138
42 Ga0207683_10077521 3300026121 Bacteria 2943
43 Ga0265326_10087692 3300028558 Bacteria 881
44 Ga0265319_1000148 3300028563 Bacteria 52147
45 Ga0265319_1001516 3300028563 Bacteria 13782
46 Ga0265319_1036117 3300028563 Bacteria 1692
47 Ga0265334_10001154 3300028573 Bacteria 12920
48 Ga0265318_10000022 3300028577 Bacteria 162885
49 Ga0265318_10001301 3300028577 Bacteria 15020
50 Ga0265318_10001649 3300028577 Bacteria 12856
51 Ga0265318_10162233 3300028577 Bacteria 819
52 Ga0265323_10000004 3300028653 Bacteria 197761
53 Ga0265323_10002830 3300028653 Bacteria 7806
54 Ga0265323_10011732 3300028653 Bacteria 3528
55 Ga0265323_10036280 3300028653 Bacteria 1813
56 Ga0265323_10043047 3300028653 Bacteria 1632
57 Ga0265323_10060350 3300028653 Bacteria 1320
58 Ga0265322_10000721 3300028654 Bacteria 12088
59 Ga0265322_10060541 3300028654 Bacteria 1074
60 Ga0265336_10052181 3300028666 Bacteria 1233
61 Ga0265338_10448553 3300028800 Bacteria 914
62 Ga0265338_10651380 3300028800 Bacteria 730
63 Ga0265330_10012019 3300031235 Bacteria 4050
64 Ga0265330_10077833 3300031235 Bacteria 1431
65 Ga0265330_10152037 3300031235 Bacteria 983
66 Ga0265330_10190864 3300031235 Bacteria 867
67 Ga0265332_10084413 3300031238 Bacteria 1346
68 Ga0265320_10002888 3300031240 Bacteria 11783
69 Ga0265320_10005901 3300031240 Bacteria 7795
70 Ga0265320_10012059 3300031240 Bacteria 5054
71 Ga0265320_10026207 3300031240 Bacteria 3054
72 Ga0265320_10152032 3300031240 Bacteria 1045
73 Ga0265325_10382687 3300031241 Bacteria 618
74 Ga0265329_10262506 3300031242 Bacteria 578
75 Ga0265339_10113653 3300031249 Bacteria 1398
76 Ga0265339_10242577 3300031249 Bacteria 874
77 Ga0265331_10042363 3300031250 Bacteria 2208
78 Ga0265331_10121581 3300031250 Bacteria 1194
79 Ga0265331_10150013 3300031250 Bacteria 1059
80 Ga0265327_10000029 3300031251 Bacteria 352607
81 Ga0265327_10013006 3300031251 Bacteria 5563
82 Ga0265327_10415696 3300031251 Bacteria 583
83 Ga0265316_10011385 3300031344 Bacteria 8027
84 Ga0265316_10012056 3300031344 Bacteria 7768
85 Ga0265316_10059120 3300031344 Bacteria 2982
86 Ga0265316_10095556 3300031344 Bacteria 2263
87 Ga0265316_10262501 3300031344 Bacteria 1266
88 Ga0265316_10483379 3300031344 Bacteria 886
89 Ga0307513_10480583 3300031456 Bacteria 962
90 Ga0307509_10592784 3300031507 Bacteria 782
91 Ga0307408_100000011 3300031548 Bacteria 414737
92 Ga0265313_10006390 3300031595 Bacteria 8359
93 Ga0265313_10023064 3300031595 Bacteria 3360
94 Ga0307508_10000068 3300031616 Bacteria 119901
95 Ga0265314_10000432 3300031711 Bacteria 56071
96 Ga0265314_10000613 3300031711 Bacteria 43883
97 Ga0265314_10292476 3300031711 Archaea 917
98 Ga0265342_10002343 3300031712 Bacteria 16450
99 Ga0265342_10014678 3300031712 Bacteria 5191
100 Ga0265342_10060766 3300031712 Bacteria 2227
101 Ga0265342_10176673 3300031712 Bacteria 1171
102 Ga0307413_10470955 3300031824 Bacteria 1002
103 Ga0307407_10018965 3300031903 Bacteria 3492
104 Ga0307412_10005085 3300031911 Bacteria 7356
105 Ga0307409_100000072 3300031995 Bacteria 36405
106 Ga0307416_100000062 3300032002 Bacteria 99295
107 Ga0307414_10494523 3300032004 Bacteria 1081
108 Ga0307414_12277790 3300032004 Bacteria 506
109 Ga0307411_10052385 3300032005 Bacteria 2668
110 Ga0373951_0005436 3300035091 Bacteria 2960
111 Ga0373960_0360730 3300035121 Bacteria 553
112 Ga0373931_0739593 3300035691 Bacteria 652
113 Ga0395905_0000026 3300037471 Bacteria 315051
114 Ga0451802_1724911 3300041460 Bacteria 514
115 Ga0451804_0269814 3300041463 Bacteria 519
116 Ga0451841_1329775 3300041498 Bacteria 522
117 Ga0451847_0727801 3300041503 Bacteria 875
118 Ga0451843_0048062 3300041509 Bacteria 651
119 Ga0451843_0808386 3300041509 Bacteria 602
120 Ga0451853_0035096 3300041512 Bacteria 1190
121 Ga0451853_1986527 3300041512 Bacteria 569
122 Ga0439441_081769 3300042001 Bacteria 704
123 Ga0451577_0000023 3300042876 Bacteria 419051
124 Ga0451577_0000734 3300042876 Bacteria 50721
125 Ga0451577_0000846 3300042876 Bacteria 45685
126 Ga0451577_0050022 3300042876 Bacteria 3731
127 Ga0451577_0181443 3300042876 Bacteria 1898
128 Ga0451577_0221210 3300042876 Bacteria 1711
129 Ga0451577_0341777 3300042876 Bacteria 1357
130 Ga0451577_0839110 3300042876 Bacteria 829
131 Ga0453683_0029499 3300044673 Bacteria 3468
132 Ga0453683_0338101 3300044673 Unclassified 966
133 Ga0453684_0000019 3300044712 Bacteria 908702
134 Ga0453684_0005578 3300044712 Bacteria 24799
135 Ga0453684_0012369 3300044712 Bacteria 14093
136 Ga0453684_0035896 3300044712 Bacteria 6841
137 Ga0453684_0060719 3300044712 Bacteria 4858
138 Ga0453684_0283112 3300044712 Bacteria 1890
139 Ga0453684_0297812 3300044712 Bacteria 1834
140 Ga0453684_2234680 3300044712 Unclassified 545
141 Ga0451576_0000098 3300045051 Bacteria 220454
142 Ga0451576_0000379 3300045051 Bacteria 104282
143 Ga0451576_0005624 3300045051 Bacteria 15650
144 Ga0451576_0082763 3300045051 Bacteria 3338
145 Ga0451576_0399833 3300045051 Bacteria 1440
146 Ga0451576_2547808 3300045051 Bacteria 522
147 Ga0501032_0001188 3300049569 Bacteria 20866
148 Ga0501032_0003696 3300049569 Bacteria 11615
149 Ga0501033_0015821 3300049570 Bacteria 5716
150 Ga0501034_0003369 3300049571 Bacteria 18243
151 Ga0501034_0034773 3300049571 Bacteria 5109
152 Ga0501036_0002558 3300049572 Bacteria 14302
153 Ga0501036_0174042 3300049572 Bacteria 1813
154 Ga0501037_0017042 3300049573 Bacteria 5344
155 Ga0501037_0380297 3300049573 Unclassified 970
156 Ga0501038_0000717 3300049574 Bacteria 29617
157 Ga0501038_0397295 3300049574 Unclassified 1067
158 Ga0501038_0667105 3300049574 Unclassified 781
159 Ga0501039_0002533 3300049575 Bacteria 13633
160 Ga0501040_1383404 3300049576 Unclassified 511
161 Ga0501042_0006472 3300049578 Bacteria 7606
162 Ga0501043_0028679 3300049579 Unclassified 4369
163 Ga0501043_0035885 3300049579 Bacteria 3901
164 Ga0501043_0328236 3300049579 Unclassified 1165
165 Ga0501046_0011004 3300049580 Bacteria 7754
166 Ga0501046_0043610 3300049580 Bacteria 3570
167 Ga0501046_0199631 3300049580 Bacteria 1488
168 Ga0501046_0335969 3300049580 Unclassified 1098
169 Ga0501047_0005851 3300049581 Bacteria 11574
170 Ga0501047_0119425 3300049581 Bacteria 2518
171 Ga0501048_0065250 3300049582 Bacteria 2574
172 Ga0501067_0162394 3300049583 Bacteria 1244
173 Ga0501068_0339479 3300049584 Bacteria 964
174 Ga0501069_0343568 3300049585 Unclassified 879
175 Ga0501243_000168 3300049675 Bacteria 7652
176 Ga0501080_0065913 3300049742 Bacteria 3368
177 Ga0501080_0075047 3300049742 Unclassified 3145
178 Ga0501083_0002828 3300049744 Bacteria 11990
179 Ga0501035_0001895 3300049822 Bacteria 21033
180 Ga0501044_0002504 3300049823 Bacteria 20948
181 Ga0501044_0579581 3300049823 Unclassified 1016
182 Ga0501044_0647945 3300049823 Unclassified 945
183 Ga0501044_0966035 3300049823 Bacteria 725
184 Ga0501045_0160188 3300049824 Bacteria 1675
185 Ga0500642_0440968 3300053130 Bacteria 561
186 Ga0500573_0450531 3300053140 Unclassified 595
187 Ga0501082_0121132 3300060353 Bacteria 2268

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028577 Ga0265318_10001649 Ga0265318_1000164914 93
2 3300042876 Ga0451577_0000846 Ga0451577_0000846_23332_23655 100
3 3300044712 Ga0453684_0005578 Ga0453684_0005578_7719_8042 100
4 3300005340 Ga0070689_100071480 Ga0070689_1000714802 103
5 3300011119 Ga0105246_11680797 Ga0105246_116807971 103
6 3300014326 Ga0157380_12243895 Ga0157380_122438951 103
7 3300025936 Ga0207670_10052146 Ga0207670_100521462 103
8 3300049744 Ga0501083_0002828 Ga0501083_0002828_4619_4933 103
9 iso_pu_bacteria 2786546940 2788435428 104
10 3300003322 rootL2_10277371 rootL2_102773711 105
11 3300005333 Ga0070677_10646940 Ga0070677_106469401 105
12 3300014326 Ga0157380_10954994 Ga0157380_109549942 105
13 3300005327 Ga0070658_11741253 Ga0070658_117412531 106
14 3300005842 Ga0068858_101276263 Ga0068858_1012762631 106
15 3300006028 Ga0070717_10000079 Ga0070717_1000007934 106
16 3300049583 Ga0501067_0162394 Ga0501067_0162394_24_344 106
17 3300049742 Ga0501080_0075047 Ga0501080_0075047_1181_1504 106
18 3300003320 rootH2_10070941 rootH2_1007094113 107
19 3300003322 rootL2_10057048 rootL2_100570485 107
20 3300005329 Ga0070683_100136730 Ga0070683_1001367303 107
21 3300005334 Ga0068869_100000092 Ga0068869_10000009225 107
22 3300005334 Ga0068869_101235161 Ga0068869_1012351611 107
23 3300005338 Ga0068868_100011467 Ga0068868_1000114673 107
24 3300005343 Ga0070687_100708577 Ga0070687_1007085771 107
25 3300005456 Ga0070678_101839983 Ga0070678_1018399831 107
26 3300005459 Ga0068867_100000277 Ga0068867_10000027710 107
27 3300005539 Ga0068853_100587584 Ga0068853_1005875841 107
28 3300005614 Ga0068856_100030011 Ga0068856_1000300113 107
29 3300005617 Ga0068859_101268718 Ga0068859_1012687181 107
30 3300005719 Ga0068861_101167311 Ga0068861_1011673112 107
31 3300006028 Ga0070717_10603189 Ga0070717_106031891 107
32 3300006028 Ga0070717_11407326 Ga0070717_114073261 107
33 3300006237 Ga0097621_100252633 Ga0097621_1002526333 107
34 3300006358 Ga0068871_100030145 Ga0068871_1000301455 107
35 3300006844 Ga0075428_100407298 Ga0075428_1004072982 107
36 3300006881 Ga0068865_100004023 Ga0068865_1000040237 107
37 3300006881 Ga0068865_102164747 Ga0068865_1021647471 107
38 3300006931 Ga0097620_101268588 Ga0097620_1012685881 107
39 3300013296 Ga0157374_10222895 Ga0157374_102228953 107
40 3300013297 Ga0157378_11641586 Ga0157378_116415861 107
41 3300013306 Ga0163162_10463005 Ga0163162_104630052 107
42 3300025938 Ga0207704_10104901 Ga0207704_101049012 107
43 3300025942 Ga0207689_10000120 Ga0207689_1000012019 107
44 3300025942 Ga0207689_10777383 Ga0207689_107773831 107
45 3300025944 Ga0207661_10112263 Ga0207661_101122633 107
46 3300026023 Ga0207677_10030733 Ga0207677_100307333 107
47 3300026089 Ga0207648_10004413 Ga0207648_100044134 107
48 3300026116 Ga0207674_10529458 Ga0207674_105294582 107
49 3300026121 Ga0207683_10077521 Ga0207683_100775214 107
50 3300028558 Ga0265326_10087692 Ga0265326_100876921 107
51 3300028563 Ga0265319_1000148 Ga0265319_100014822 107
52 3300028563 Ga0265319_1001516 Ga0265319_10015161 107
53 3300028563 Ga0265319_1036117 Ga0265319_10361172 107
54 3300028573 Ga0265334_10001154 Ga0265334_100011548 107
55 3300028577 Ga0265318_10000022 Ga0265318_10000022123 107
56 3300028577 Ga0265318_10001301 Ga0265318_1000130110 107
57 3300028577 Ga0265318_10162233 Ga0265318_101622331 107
58 3300028653 Ga0265323_10000004 Ga0265323_10000004171 107
59 3300028653 Ga0265323_10002830 Ga0265323_100028303 107
60 3300028653 Ga0265323_10011732 Ga0265323_100117322 107
61 3300028653 Ga0265323_10036280 Ga0265323_100362802 107
62 3300028653 Ga0265323_10043047 Ga0265323_100430472 107
63 3300028653 Ga0265323_10060350 Ga0265323_100603503 107
64 3300028654 Ga0265322_10000721 Ga0265322_1000072114 107
65 3300028654 Ga0265322_10060541 Ga0265322_100605412 107
66 3300028666 Ga0265336_10052181 Ga0265336_100521812 107
67 3300028800 Ga0265338_10448553 Ga0265338_104485532 107
68 3300028800 Ga0265338_10651380 Ga0265338_106513802 107
69 3300031235 Ga0265330_10012019 Ga0265330_100120193 107
70 3300031235 Ga0265330_10077833 Ga0265330_100778331 107
71 3300031235 Ga0265330_10152037 Ga0265330_101520372 107
72 3300031235 Ga0265330_10190864 Ga0265330_101908642 107
73 3300031238 Ga0265332_10084413 Ga0265332_100844132 107
74 3300031240 Ga0265320_10002888 Ga0265320_100028883 107
75 3300031240 Ga0265320_10005901 Ga0265320_100059012 107
76 3300031240 Ga0265320_10012059 Ga0265320_100120594 107
77 3300031240 Ga0265320_10026207 Ga0265320_100262072 107
78 3300031240 Ga0265320_10152032 Ga0265320_101520322 107
79 3300031241 Ga0265325_10382687 Ga0265325_103826872 107
80 3300031242 Ga0265329_10262506 Ga0265329_102625061 107
81 3300031249 Ga0265339_10113653 Ga0265339_101136531 107
82 3300031249 Ga0265339_10242577 Ga0265339_102425771 107
83 3300031250 Ga0265331_10042363 Ga0265331_100423632 107
84 3300031250 Ga0265331_10121581 Ga0265331_101215812 107
85 3300031250 Ga0265331_10150013 Ga0265331_101500132 107
86 3300031251 Ga0265327_10000029 Ga0265327_1000002998 107
87 3300031251 Ga0265327_10013006 Ga0265327_100130064 107
88 3300031251 Ga0265327_10415696 Ga0265327_104156961 107
89 3300031344 Ga0265316_10011385 Ga0265316_100113854 107
90 3300031344 Ga0265316_10012056 Ga0265316_100120562 107
91 3300031344 Ga0265316_10059120 Ga0265316_100591203 107
92 3300031344 Ga0265316_10095556 Ga0265316_100955561 107
93 3300031344 Ga0265316_10262501 Ga0265316_102625012 107
94 3300031344 Ga0265316_10483379 Ga0265316_104833792 107
95 3300031456 Ga0307513_10480583 Ga0307513_104805832 107
96 3300031507 Ga0307509_10592784 Ga0307509_105927842 107
97 3300031548 Ga0307408_100000011 Ga0307408_100000011320 107
98 3300031595 Ga0265313_10006390 Ga0265313_100063902 107
99 3300031595 Ga0265313_10023064 Ga0265313_100230642 107
100 3300031616 Ga0307508_10000068 Ga0307508_1000006882 107
101 3300031711 Ga0265314_10000432 Ga0265314_1000043225 107
102 3300031711 Ga0265314_10000613 Ga0265314_1000061323 107
103 3300031711 Ga0265314_10292476 Ga0265314_102924761 107
104 3300031712 Ga0265342_10002343 Ga0265342_1000234311 107
105 3300031712 Ga0265342_10014678 Ga0265342_100146784 107
106 3300031712 Ga0265342_10060766 Ga0265342_100607662 107
107 3300031712 Ga0265342_10176673 Ga0265342_101766732 107
108 3300031824 Ga0307413_10470955 Ga0307413_104709552 107
109 3300031903 Ga0307407_10018965 Ga0307407_100189653 107
110 3300031911 Ga0307412_10005085 Ga0307412_100050852 107
111 3300031995 Ga0307409_100000072 Ga0307409_1000000723 107
112 3300032002 Ga0307416_100000062 Ga0307416_1000000627 107
113 3300032004 Ga0307414_10494523 Ga0307414_104945232 107
114 3300032004 Ga0307414_12277790 Ga0307414_122777901 107
115 3300032005 Ga0307411_10052385 Ga0307411_100523853 107
116 3300035091 Ga0373951_0005436 Ga0373951_0005436_2131_2460 107
117 3300035121 Ga0373960_0360730 Ga0373960_0360730_204_527 107
118 3300035691 Ga0373931_0739593 Ga0373931_0739593_42_365 107
119 3300037471 Ga0395905_0000026 Ga0395905_0000026_275050_275382 107
120 3300041460 Ga0451802_1724911 Ga0451802_1724911_16_339 107
121 3300041463 Ga0451804_0269814 Ga0451804_0269814_22_348 107
122 3300041498 Ga0451841_1329775 Ga0451841_1329775_28_351 107
123 3300041503 Ga0451847_0727801 Ga0451847_0727801_190_519 107
124 3300041509 Ga0451843_0048062 Ga0451843_0048062_97_420 107
125 3300041509 Ga0451843_0808386 Ga0451843_0808386_82_411 107
126 3300041512 Ga0451853_0035096 Ga0451853_0035096_691_1014 107
127 3300041512 Ga0451853_1986527 Ga0451853_1986527_122_445 107
128 3300042001 Ga0439441_081769 Ga0439441_081769_29_352 107
129 3300042876 Ga0451577_0000023 Ga0451577_0000023_389307_389684 107
130 3300042876 Ga0451577_0000734 Ga0451577_0000734_1260_1589 107
131 3300042876 Ga0451577_0050022 Ga0451577_0050022_1138_1461 107
132 3300042876 Ga0451577_0181443 Ga0451577_0181443_1452_1775 107
133 3300042876 Ga0451577_0221210 Ga0451577_0221210_606_929 107
134 3300042876 Ga0451577_0341777 Ga0451577_0341777_256_579 107
135 3300042876 Ga0451577_0839110 Ga0451577_0839110_179_502 107
136 3300044673 Ga0453683_0029499 Ga0453683_0029499_1645_1974 107
137 3300044673 Ga0453683_0338101 Ga0453683_0338101_546_875 107
138 3300044712 Ga0453684_0000019 Ga0453684_0000019_732100_732435 107
139 3300044712 Ga0453684_0012369 Ga0453684_0012369_729_1052 107
140 3300044712 Ga0453684_0035896 Ga0453684_0035896_1507_1833 107
141 3300044712 Ga0453684_0060719 Ga0453684_0060719_110_439 107
142 3300044712 Ga0453684_0283112 Ga0453684_0283112_133_456 107
143 3300044712 Ga0453684_0297812 Ga0453684_0297812_674_997 107
144 3300044712 Ga0453684_2234680 Ga0453684_2234680_133_462 107
145 3300045051 Ga0451576_0000098 Ga0451576_0000098_56082_56408 107
146 3300045051 Ga0451576_0000379 Ga0451576_0000379_63454_63777 107
147 3300045051 Ga0451576_0005624 Ga0451576_0005624_14589_14918 107
148 3300045051 Ga0451576_0082763 Ga0451576_0082763_1699_2022 107
149 3300045051 Ga0451576_0399833 Ga0451576_0399833_472_795 107
150 3300045051 Ga0451576_2547808 Ga0451576_2547808_179_505 107
151 3300049569 Ga0501032_0001188 Ga0501032_0001188_12931_13254 107
152 3300049569 Ga0501032_0003696 Ga0501032_0003696_10749_11087 107
153 3300049570 Ga0501033_0015821 Ga0501033_0015821_529_867 107
154 3300049571 Ga0501034_0003369 Ga0501034_0003369_15035_15358 107
155 3300049571 Ga0501034_0034773 Ga0501034_0034773_1572_1910 107
156 3300049572 Ga0501036_0002558 Ga0501036_0002558_13549_13887 107
157 3300049572 Ga0501036_0174042 Ga0501036_0174042_710_1033 107
158 3300049573 Ga0501037_0017042 Ga0501037_0017042_1746_2084 107
159 3300049573 Ga0501037_0380297 Ga0501037_0380297_179_517 107
160 3300049574 Ga0501038_0000717 Ga0501038_0000717_6436_6774 107
161 3300049574 Ga0501038_0397295 Ga0501038_0397295_398_721 107
162 3300049574 Ga0501038_0667105 Ga0501038_0667105_131_469 107
163 3300049575 Ga0501039_0002533 Ga0501039_0002533_5220_5558 107
164 3300049576 Ga0501040_1383404 Ga0501040_1383404_32_370 107
165 3300049578 Ga0501042_0006472 Ga0501042_0006472_836_1174 107
166 3300049579 Ga0501043_0028679 Ga0501043_0028679_2247_2570 107
167 3300049579 Ga0501043_0035885 Ga0501043_0035885_482_820 107
168 3300049579 Ga0501043_0328236 Ga0501043_0328236_353_691 107
169 3300049580 Ga0501046_0011004 Ga0501046_0011004_228_551 107
170 3300049580 Ga0501046_0043610 Ga0501046_0043610_973_1296 107
171 3300049580 Ga0501046_0199631 Ga0501046_0199631_458_796 107
172 3300049580 Ga0501046_0335969 Ga0501046_0335969_85_423 107
173 3300049581 Ga0501047_0005851 Ga0501047_0005851_3807_4130 107
174 3300049581 Ga0501047_0119425 Ga0501047_0119425_1857_2180 107
175 3300049582 Ga0501048_0065250 Ga0501048_0065250_1708_2046 107
176 3300049584 Ga0501068_0339479 Ga0501068_0339479_10_348 107
177 3300049585 Ga0501069_0343568 Ga0501069_0343568_165_503 107
178 3300049675 Ga0501243_000168 Ga0501243_000168_4424_4753 107
179 3300049742 Ga0501080_0065913 Ga0501080_0065913_993_1331 107
180 3300049822 Ga0501035_0001895 Ga0501035_0001895_7731_8054 107
181 3300049823 Ga0501044_0002504 Ga0501044_0002504_7614_7937 107
182 3300049823 Ga0501044_0579581 Ga0501044_0579581_240_578 107
183 3300049823 Ga0501044_0647945 Ga0501044_0647945_162_500 107
184 3300049823 Ga0501044_0966035 Ga0501044_0966035_212_538 107
185 3300049824 Ga0501045_0160188 Ga0501045_0160188_41_379 107
186 3300053130 Ga0500642_0440968 Ga0500642_0440968_51_374 107
187 3300053140 Ga0500573_0450531 Ga0500573_0450531_138_461 107
188 3300060353 Ga0501082_0121132 Ga0501082_0121132_429_767 107

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06865

Ppnp

Pyrimidine/purine nucleoside phosphorylase

32

124

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oyz-assembly1.cif.gz_A-2 crystal structure of unknown function protein vpa0057 from vibrio parahaemolyticus (targeted domain 2-94) 0.9578 13 107
7eym-assembly1.cif.gz_B crystal structure of vibrio cholerae ppnp 0.9536 13 107
2oyz-assembly1.cif.gz_A-2 crystal structure of unknown function protein vpa0057 from vibrio parahaemolyticus (targeted domain 2-94) 0.9383 13 107
7eyj-assembly1.cif.gz_A crystal structure of escherichia coli ppnp 0.9366 13 107
7eym-assembly1.cif.gz_B crystal structure of vibrio cholerae ppnp 0.9342 13 107
ID Description Score Start End Superfamily
2oyzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9557 13 107 2.60.120.10
af_P0C037_1_93_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9513 13 106 2.60.120.10
af_P0C037_1_93_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9415 13 106 2.60.120.10
2oyzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9358 13 107 2.60.120.10
3hqxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8997 6 107 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A836TFZ2-F1-model_v4 Pyrimidine/purine nucleoside phosphorylase 0.9788 19 107 GO:0004731
GO:0005829
GO:0016154
AF-A0A432DCA5-F1-model_v4 deleted 0.9779 13 107
AF-A0A2N0XZJ2-F1-model_v4 Pyrimidine/purine nucleoside phosphorylase (EC 2.4.2.1) (EC 2.4.2.2) (Adenosine phosphorylase) (Cytidine phosphorylase) (Guanosine phosphorylase) (Inosine phosphorylase) (Thymidine phosphorylase) (Uridine phosphorylase) (Xanthosine phosphorylase) 0.9775 13 107 GO:0004731
GO:0004850
GO:0005829
GO:0009032
GO:0047847
GO:0047975
AF-A0A3D2UJL5-F1-model_v4 deleted 0.9753 26 107
AF-A0A2X2UYK1-F1-model_v4 Uncharacterized protein conserved in bacteria 0.9709 42 107 GO:0004731
GO:0005829
GO:0016154

Feature Viewer

pLDDT pTM Quality
92.17 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map