F290309

General Info

Members Datasets Scaffolds Average Seq Length
189 129 378 201

Family's Representative Sequence

Representative Sequence 3300004801|Ga0058860_11785091|Ga0058860_117850912
Length 221
Sequence LFARAAGCLEQAFHPAGDLLTENSDVMPTEVDAEHVTSAARPDQFPAESLPEIAFLGRSNVGKSSLLNCLTGKKGLAFTSSKPGCTQLINFFRINGEMFFVDLPGYGFARVPLEVKARWKSLIESYLLKRNTLTTAVVLIDSRRGWMEPDLELKSWLEFQRIPYLVVATKIDKLNQKEQHRNLNSIAKELSGSELFPFSAVTGRGAREIWQAISKTKKLRQ

Samples

Sample ID Description Type Environment
1 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
74 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
75 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
76 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
77 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
78 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
87 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
88 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
89 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
92 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
93 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
94 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
95 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
104 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
105 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
111 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
112 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
113 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
114 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
115 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
116 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
117 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
118 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
119 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
123 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
124 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
125 2738543010 Bacillus sp. YR335 Isolate Unclassified
126 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
127 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
128 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
129 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.42
Metatranscriptomes 7.94
Isolates 2.65

Biome Distribution

Category Percentage (%)
Aerial Root 0.53
Bulb 0
Endosphere 1.59
Nodule 0.53
Rhizoplane 2.12
Rhizosphere 72.49
Stem 0
Stem Tuber 0
Unclassified 12.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058860_11785091 3300004801 Bacteria 1136
2 Ga0006777J48905_1095125 3300003308 Unclassified 973
3 JGI25405J52794_10023715 3300003911 Bacteria 1250
4 Ga0058861_11576545 3300004800 Bacteria 1397
5 Ga0058862_12741148 3300004803 Unclassified 1048
6 Ga0070683_100096141 3300005329 Bacteria 2786
7 Ga0068869_100448580 3300005334 Unclassified 1069
8 Ga0070680_100102690 3300005336 Bacteria 2375
9 Ga0070661_100040640 3300005344 Bacteria 3394
10 Ga0070661_100343942 3300005344 Bacteria 1169
11 Ga0070659_100094493 3300005366 Bacteria 2401
12 Ga0070714_100254496 3300005435 Bacteria 1625
13 Ga0070711_100445921 3300005439 Bacteria 1059
14 Ga0070681_10018233 3300005458 Bacteria 7015
15 Ga0070684_100231533 3300005535 Bacteria 1687
16 Ga0070697_100327481 3300005536 Bacteria 1320
17 Ga0070697_100847709 3300005536 Unclassified 809
18 Ga0068853_100037586 3300005539 Bacteria 4119
19 Ga0068855_100031831 3300005563 Bacteria 6297
20 Ga0068856_100002503 3300005614 Bacteria 18908
21 Ga0068856_100058716 3300005614 Bacteria 3800
22 Ga0068856_100096999 3300005614 Bacteria 2937
23 Ga0068856_100610277 3300005614 Bacteria 1112
24 Ga0068852_100649857 3300005616 Bacteria 1062
25 Ga0068863_100329788 3300005841 Bacteria 1484
26 Ga0068858_100446643 3300005842 Bacteria 1246
27 Ga0081455_10006093 3300005937 Bacteria 13042
28 Ga0081455_10125467 3300005937 Bacteria 2015
29 Ga0081539_10060896 3300005985 Bacteria 2070
30 Ga0070717_10199489 3300006028 Bacteria 1752
31 Ga0068871_100700151 3300006358 Bacteria 928
32 Ga0068871_100750058 3300006358 Unclassified 897
33 Ga0075430_100115244 3300006846 Bacteria 2239
34 Ga0075430_100149291 3300006846 Bacteria 1946
35 Ga0075433_10162377 3300006852 Bacteria 1988
36 Ga0075429_100068694 3300006880 Bacteria 3084
37 Ga0105240_10026134 3300009093 Bacteria 7661
38 Ga0105241_10067150 3300009174 Bacteria 2775
39 Ga0105237_10721557 3300009545 Bacteria 1003
40 Ga0105238_10011617 3300009551 Bacteria 8870
41 Ga0105239_10954136 3300010375 Bacteria 985
42 Ga0157373_10511175 3300013100 Bacteria 868
43 Ga0157371_10023466 3300013102 Bacteria 4511
44 Ga0157370_10044809 3300013104 Bacteria 4248
45 Ga0157370_10570844 3300013104 Bacteria 1036
46 Ga0157369_10027527 3300013105 Bacteria 6300
47 Ga0157369_10035507 3300013105 Bacteria 5465
48 Ga0157369_10115647 3300013105 Bacteria 2849
49 Ga0157369_10194290 3300013105 Bacteria 2132
50 Ga0157369_10247172 3300013105 Bacteria 1862
51 Ga0157374_10001249 3300013296 Bacteria 21701
52 Ga0157374_10034693 3300013296 Bacteria 4611
53 Ga0157378_10595065 3300013297 Bacteria 1116
54 Ga0157372_10231836 3300013307 Bacteria 2141
55 Ga0157372_10657194 3300013307 Bacteria 1221
56 Ga0157372_11034365 3300013307 Unclassified 951
57 Ga0163163_11462312 3300014325 Bacteria 745
58 Ga0157380_11289880 3300014326 Bacteria 777
59 Ga0157379_10263027 3300014968 Bacteria 1568
60 Ga0157376_10029690 3300014969 Bacteria 4357
61 Ga0206349_1188575 3300020075 Bacteria 3851
62 Ga0206350_10825619 3300020080 Bacteria 1018
63 Ga0206353_11281317 3300020082 Unclassified 1314
64 Ga0213876_10013157 3300021384 Bacteria 4397
65 Ga0213876_10219844 3300021384 Bacteria 1010
66 Ga0213876_10335254 3300021384 Unclassified 804
67 Ga0213875_10000005 3300021388 Bacteria 595146
68 Ga0213875_10000027 3300021388 Bacteria 190420
69 Ga0213875_10000796 3300021388 Bacteria 23564
70 Ga0213875_10001193 3300021388 Bacteria 17776
71 Ga0213875_10026387 3300021388 Bacteria 2763
72 Ga0213875_10152161 3300021388 Unclassified 1084
73 Ga0213871_10000665 3300021441 Bacteria 4953
74 Ga0207699_10172095 3300025906 Bacteria 1449
75 Ga0207707_10063118 3300025912 Bacteria 3224
76 Ga0207695_10677971 3300025913 Bacteria 912
77 Ga0207671_10771337 3300025914 Bacteria 763
78 Ga0207663_10452815 3300025916 Bacteria 990
79 Ga0207660_10130017 3300025917 Unclassified 1916
80 Ga0207657_10124933 3300025919 Bacteria 2114
81 Ga0207649_10497413 3300025920 Bacteria 927
82 Ga0207652_10156929 3300025921 Bacteria 2039
83 Ga0207694_10113812 3300025924 Bacteria 2154
84 Ga0207700_10203896 3300025928 Bacteria 1668
85 Ga0207664_10217720 3300025929 Bacteria 1655
86 Ga0207706_10202161 3300025933 Bacteria 1743
87 Ga0207661_10371862 3300025944 Unclassified 1292
88 Ga0207667_10022557 3300025949 Bacteria 6950
89 Ga0207667_10700194 3300025949 Bacteria 1015
90 Ga0207639_10023876 3300026041 Bacteria 4419
91 Ga0207678_10449773 3300026067 Bacteria 1119
92 Ga0207702_10009586 3300026078 Bacteria 8129
93 Ga0207702_10071744 3300026078 Bacteria 2983
94 Ga0207702_10077377 3300026078 Bacteria 2877
95 Ga0207702_10627306 3300026078 Bacteria 1056
96 Ga0207641_10176303 3300026088 Bacteria 1955
97 Ga0207676_10349037 3300026095 Bacteria 1368
98 Ga0207428_10001374 3300027907 Bacteria 25780
99 Ga0268266_10482197 3300028379 Bacteria 1182
100 Ga0268266_11254420 3300028379 Unclassified 716
101 Ga0316577_10000181 3300031733 Bacteria 20471
102 Ga0307414_11115619 3300032004 Unclassified 729
103 Ga0373945_0086938 3300035116 Bacteria 1205
104 Ga0373953_0248988 3300035117 Unclassified 772
105 Ga0373943_0550386 3300035170 Unclassified 677
106 Ga0373935_0013280 3300035692 Bacteria 4969
107 Ga0373935_0034257 3300035692 Bacteria 3165
108 Ga0373947_0196957 3300035725 Bacteria 1317
109 Ga0373937_0012682 3300036401 Bacteria 7416
110 Ga0316584_0094249 3300036712 Bacteria 2242
111 Ga0373925_0110620 3300037068 Bacteria 2122
112 Ga0395900_0226084 3300037418 Bacteria 1884
113 Ga0395905_0934546 3300037471 Bacteria 770
114 Ga0436364_0025760 3300037853 Bacteria 3320
115 Ga0436364_0191556 3300037853 Bacteria 908
116 Ga0436364_0301698 3300037853 Bacteria 10821
117 Ga0436364_0317618 3300037853 Bacteria 89116
118 Ga0436364_0446012 3300037853 Bacteria 193523
119 Ga0436364_0493035 3300037853 Bacteria 35512
120 Ga0436364_0548583 3300037853 Unclassified 895
121 Ga0436364_0760276 3300037853 Bacteria 1321
122 Ga0436364_0761948 3300037853 Bacteria 2031
123 Ga0436364_0794010 3300037853 Bacteria 1733
124 Ga0436364_0870811 3300037853 Bacteria 2967
125 Ga0436364_0997237 3300037853 Bacteria 21177
126 Ga0436364_1033893 3300037853 Bacteria 1332
127 Ga0436364_1058180 3300037853 Bacteria 3478
128 Ga0436364_1316794 3300037853 Bacteria 2006
129 Ga0436364_1332298 3300037853 Unclassified 672
130 Ga0436364_1466037 3300037853 Unclassified 1499
131 Ga0400490_02052 3300038726 Bacteria 29647
132 Ga0400491_18892 3300038727 Bacteria 3987
133 Ga0400483_218310 3300039062 Bacteria 4159
134 Ga0400489_65890 3300039093 Bacteria 27169
135 Ga0436365_0266715 3300039437 Bacteria 2899
136 Ga0436365_0287215 3300039437 Bacteria 1801
137 Ga0436365_0746493 3300039437 Bacteria 2242
138 Ga0436365_1377132 3300039437 Bacteria 3149
139 Ga0436365_1827853 3300039437 Bacteria 4632
140 Ga0436360_0325515 3300039438 Bacteria 1606
141 Ga0436360_0965759 3300039438 Bacteria 1420
142 Ga0436360_1294485 3300039438 Bacteria 10623
143 Ga0436361_0683315 3300039447 Bacteria 65588
144 Ga0436361_1207485 3300039447 Bacteria 1147
145 Ga0436363_0228721 3300039450 Bacteria 3456
146 Ga0436363_0719316 3300039450 Unclassified 711
147 Ga0436363_0941550 3300039450 Bacteria 1843
148 Ga0436363_1181567 3300039450 Bacteria 1899
149 Ga0436362_0242795 3300039453 Bacteria 816
150 Ga0436362_0384939 3300039453 Bacteria 2513
151 Ga0436362_0645364 3300039453 Bacteria 2216
152 Ga0436362_1001625 3300039453 Bacteria 6176
153 Ga0436362_1049167 3300039453 Bacteria 2565
154 Ga0453683_1024238 3300044673 Bacteria 549
155 Ga0466966_0025085 3300044684 Bacteria 3897
156 Ga0466963_0503279 3300044694 Unclassified 855
157 Ga0466970_0066915 3300044765 Bacteria 1929
158 Ga0466959_0128040 3300045049 Bacteria 1801
159 Ga0466967_0497560 3300045976 Bacteria 1196
160 Ga0496104_0513262 3300048907 Unclassified 1110
161 Ga0496109_0000015 3300048912 Bacteria 214913
162 Ga0496112_0007839 3300048915 Bacteria 9506
163 Ga0496115_0232502 3300048918 Bacteria 1520
164 Ga0501312_000241 3300049528 Bacteria 3929
165 Ga0501315_018115 3300049531 Bacteria 927
166 Ga0501317_003866 3300049533 Bacteria 1523
167 Ga0501324_006181 3300049540 Bacteria 1002
168 Ga0501332_07879 3300049548 Bacteria 685
169 nmdc:mga05p37_227427_c1 3300050507 Bacteria 2249
170 nmdc:mga0qj67_100553_c1 3300050509 Bacteria 2331
171 nmdc:mga0qj67_504257_c1 3300050509 Bacteria 973
172 nmdc:mga06r32_722554_c1 3300050510 Unclassified 961
173 nmdc:mga08y16_32525_c1 3300050511 Bacteria 5482
174 nmdc:mga0n895_442012_c1 3300050512 Bacteria 1314
175 nmdc:mga0rr50_176381_c1 3300050513 Bacteria 1744
176 Ga0500641_0037809 3300053096 Bacteria 1937
177 Ga0500555_002078 3300053103 Bacteria 5889
178 Ga0500617_094414 3300053124 Bacteria 1274
179 Ga0587082_055310 3300059504 Unclassified 768
180 Ga0587090_022365 3300059510 Bacteria 998
181 Ga0587107_052942 3300059652 Bacteria 694
182 Ga0501082_1032173 3300060353 Bacteria 719
183 Ga0466962_0382687 3300061719 Unclassified 703
184 Ga0530510_0806689 3300061734 Bacteria 716
185 2739229969 2738543010 Bacteria 5583595
186 2925326529 2925326138 Bacteria 9652120
187 2984530744 2984527788 Bacteria 5288478
188 8054800330 8054795415 Bacteria 9785225
189 8057475872 8057473075 Bacteria 5892720
190 Ga0058860_11785091
191 Ga0006777J48905_1095125
192 JGI25405J52794_10023715
193 Ga0058861_11576545
194 Ga0058862_12741148
195 Ga0070683_100096141
196 Ga0068869_100448580
197 Ga0070680_100102690
198 Ga0070661_100040640
199 Ga0070661_100343942
200 Ga0070659_100094493
201 Ga0070714_100254496
202 Ga0070711_100445921
203 Ga0070681_10018233
204 Ga0070684_100231533
205 Ga0070697_100327481
206 Ga0070697_100847709
207 Ga0068853_100037586
208 Ga0068855_100031831
209 Ga0068856_100002503
210 Ga0068856_100058716
211 Ga0068856_100096999
212 Ga0068856_100610277
213 Ga0068852_100649857
214 Ga0068863_100329788
215 Ga0068858_100446643
216 Ga0081455_10006093
217 Ga0081455_10125467
218 Ga0081539_10060896
219 Ga0070717_10199489
220 Ga0068871_100700151
221 Ga0068871_100750058
222 Ga0075430_100115244
223 Ga0075430_100149291
224 Ga0075433_10162377
225 Ga0075429_100068694
226 Ga0105240_10026134
227 Ga0105241_10067150
228 Ga0105237_10721557
229 Ga0105238_10011617
230 Ga0105239_10954136
231 Ga0157373_10511175
232 Ga0157371_10023466
233 Ga0157370_10044809
234 Ga0157370_10570844
235 Ga0157369_10027527
236 Ga0157369_10035507
237 Ga0157369_10115647
238 Ga0157369_10194290
239 Ga0157369_10247172
240 Ga0157374_10001249
241 Ga0157374_10034693
242 Ga0157378_10595065
243 Ga0157372_10231836
244 Ga0157372_10657194
245 Ga0157372_11034365
246 Ga0163163_11462312
247 Ga0157380_11289880
248 Ga0157379_10263027
249 Ga0157376_10029690
250 Ga0206349_1188575
251 Ga0206350_10825619
252 Ga0206353_11281317
253 Ga0213876_10013157
254 Ga0213876_10219844
255 Ga0213876_10335254
256 Ga0213875_10000005
257 Ga0213875_10000027
258 Ga0213875_10000796
259 Ga0213875_10001193
260 Ga0213875_10026387
261 Ga0213875_10152161
262 Ga0213871_10000665
263 Ga0207699_10172095
264 Ga0207707_10063118
265 Ga0207695_10677971
266 Ga0207671_10771337
267 Ga0207663_10452815
268 Ga0207660_10130017
269 Ga0207657_10124933
270 Ga0207649_10497413
271 Ga0207652_10156929
272 Ga0207694_10113812
273 Ga0207700_10203896
274 Ga0207664_10217720
275 Ga0207706_10202161
276 Ga0207661_10371862
277 Ga0207667_10022557
278 Ga0207667_10700194
279 Ga0207639_10023876
280 Ga0207678_10449773
281 Ga0207702_10009586
282 Ga0207702_10071744
283 Ga0207702_10077377
284 Ga0207702_10627306
285 Ga0207641_10176303
286 Ga0207676_10349037
287 Ga0207428_10001374
288 Ga0268266_10482197
289 Ga0268266_11254420
290 Ga0316577_10000181
291 Ga0307414_11115619
292 Ga0373945_0086938
293 Ga0373953_0248988
294 Ga0373943_0550386
295 Ga0373935_0013280
296 Ga0373935_0034257
297 Ga0373947_0196957
298 Ga0373937_0012682
299 Ga0316584_0094249
300 Ga0373925_0110620
301 Ga0395900_0226084
302 Ga0395905_0934546
303 Ga0436364_0025760
304 Ga0436364_0191556
305 Ga0436364_0301698
306 Ga0436364_0317618
307 Ga0436364_0446012
308 Ga0436364_0493035
309 Ga0436364_0548583
310 Ga0436364_0760276
311 Ga0436364_0761948
312 Ga0436364_0794010
313 Ga0436364_0870811
314 Ga0436364_0997237
315 Ga0436364_1033893
316 Ga0436364_1058180
317 Ga0436364_1316794
318 Ga0436364_1332298
319 Ga0436364_1466037
320 Ga0400490_02052
321 Ga0400491_18892
322 Ga0400483_218310
323 Ga0400489_65890
324 Ga0436365_0266715
325 Ga0436365_0287215
326 Ga0436365_0746493
327 Ga0436365_1377132
328 Ga0436365_1827853
329 Ga0436360_0325515
330 Ga0436360_0965759
331 Ga0436360_1294485
332 Ga0436361_0683315
333 Ga0436361_1207485
334 Ga0436363_0228721
335 Ga0436363_0719316
336 Ga0436363_0941550
337 Ga0436363_1181567
338 Ga0436362_0242795
339 Ga0436362_0384939
340 Ga0436362_0645364
341 Ga0436362_1001625
342 Ga0436362_1049167
343 Ga0453683_1024238
344 Ga0466966_0025085
345 Ga0466963_0503279
346 Ga0466970_0066915
347 Ga0466959_0128040
348 Ga0466967_0497560
349 Ga0496104_0513262
350 Ga0496109_0000015
351 Ga0496112_0007839
352 Ga0496115_0232502
353 Ga0501312_000241
354 Ga0501315_018115
355 Ga0501317_003866
356 Ga0501324_006181
357 Ga0501332_07879
358 nmdc:mga05p37_227427_c1
359 nmdc:mga0qj67_100553_c1
360 nmdc:mga0qj67_504257_c1
361 nmdc:mga06r32_722554_c1
362 nmdc:mga08y16_32525_c1
363 nmdc:mga0n895_442012_c1
364 nmdc:mga0rr50_176381_c1
365 Ga0500641_0037809
366 Ga0500555_002078
367 Ga0500617_094414
368 Ga0587082_055310
369 Ga0587090_022365
370 Ga0587107_052942
371 Ga0501082_1032173
372 Ga0466962_0382687
373 Ga0530510_0806689
374 2739229969
375 2925326529
376 2984530744
377 8054800330
378 8057475872

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01926

MMR_HSR1

50S ribosome-binding GTPase

52

170

0.85

PF02421

FeoB_N

Ferrous iron transport protein B

51

213

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1svw-assembly2.cif.gz_B crystal structure of ysxc complexed with gmppnp 0.9087 23 212
3pqc-assembly1.cif.gz_A crystal structure of thermotoga maritima ribosome biogenesis gtp-binding protein engb (ysxc/yiha) in complex with gdp 0.9005 24 211
1svw-assembly1.cif.gz_A crystal structure of ysxc complexed with gmppnp 0.8998 23 212
1svi-assembly1.cif.gz_A crystal structure of the gtp-binding protein ysxc complexed with gdp 0.899 20 212
1sul-assembly2.cif.gz_B crystal structure of the apo-ysxc 0.8975 21 212
ID Description Score Start End Superfamily
af_Q8IL49_94_294_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9139 24 210 3.40.50.300
af_Q550M3_249_450_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9089 20 210 3.40.50.300
af_I1LLV7_341_539_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9088 20 214 3.40.50.300
af_P0A6P7_1_210_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9012 22 214 3.40.50.300
3pqcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9005 24 211 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3C0SC78-F1-model_v4 YihA family ribosome biogenesis GTP-binding protein 0.9564 56 210 GO:0000917
GO:0005525
GO:0005829
GO:0046872
AF-A0A367ZM10-F1-model_v4 Probable GTP-binding protein EngB 0.9551 24 212 GO:0000917
GO:0005525
GO:0005829
GO:0046872
AF-A0A6M2A7F3-F1-model_v4 Probable GTP-binding protein EngB 0.9542 24 210 GO:0000917
GO:0005525
GO:0005829
GO:0046872
AF-A0A523YTP6-F1-model_v4 YihA family ribosome biogenesis GTP-binding protein 0.9517 24 157 GO:0000917
GO:0005525
GO:0005829
GO:0046872
AF-A0A7Y5DTN7-F1-model_v4 Ribosome biogenesis GTP-binding protein YsxC 0.9511 24 126 GO:0000917
GO:0005525
GO:0005829
GO:0046872

Map