F290599

General Info

Members Datasets Scaffolds Average Seq Length
189 124 188 309

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100008654|Ga0070679_1000086549
Length 337
Sequence MFCVLSFGFWVLGELSLKIIFTFLFMMKKALVTAKVHEYLIERLEKNGYEVKYQPSITYDELMEVISDINGLIATTRIKIDQHIIDEAVRLKWIGRLGSGMELIDVPYAENKKIICVSSPEGNRNAVAEHALGMLLNLMNKICSSYEEVKQGKWIRDANRGTELSGKTVGIIGFGNTGSAFAKLLAPFNVTVLAHDKYKSGFAKDYVRECEPEQIFRYADVVSLHLPLTDETYHYADGNFFNSFHQPPYFLTTCRGKVTDIAALIQAIENKKIKGAGLDVLENEKLDSFSQEEKLNLDWLCNQPNVLITPHIAGYSHEAFYLMAKILLDKLEQKGCL

Samples

Sample ID Description Type Environment
1 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
104 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
114 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
117 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
118 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
119 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
120 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
121 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
122 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
123 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
124 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.17
Nodule 0
Rhizoplane 0
Rhizosphere 91.01
Stem 0
Stem Tuber 0
Unclassified 5.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10006999 3300003203 Bacteria 5175
2 rootH2_10104165 3300003320 Bacteria 5687
3 rootL2_10188576 3300003322 Unclassified 3142
4 rootH1_10107461 3300003323 Bacteria 12071
5 Ga0070690_100014235 3300005330 Bacteria 4716
6 Ga0070670_100357018 3300005331 Bacteria 1284
7 Ga0068869_100171710 3300005334 Bacteria 1694
8 Ga0070666_10108161 3300005335 Bacteria 1921
9 Ga0068868_100008668 3300005338 Bacteria 7282
10 Ga0068868_100046456 3300005338 Bacteria 3399
11 Ga0070689_100063099 3300005340 Bacteria 2884
12 Ga0070668_100038873 3300005347 Bacteria 3639
13 Ga0070668_100091413 3300005347 Bacteria 2399
14 Ga0070675_100289137 3300005354 Unclassified 1442
15 Ga0070674_100132677 3300005356 Bacteria 1859
16 Ga0070674_100250628 3300005356 Bacteria 1390
17 Ga0070673_100008682 3300005364 Bacteria 6774
18 Ga0070673_100460229 3300005364 Bacteria 1145
19 Ga0070688_100067522 3300005365 Bacteria 2278
20 Ga0070659_100170587 3300005366 Bacteria 1782
21 Ga0070667_100076337 3300005367 Bacteria 2861
22 Ga0070667_100131321 3300005367 Bacteria 2186
23 Ga0070678_100001724 3300005456 Bacteria 11742
24 Ga0068867_100044599 3300005459 Bacteria 3249
25 Ga0068867_100075659 3300005459 Bacteria 2526
26 Ga0070679_100008654 3300005530 Bacteria 9590
27 Ga0070679_100046244 3300005530 Unclassified 4338
28 Ga0070679_100144432 3300005530 Bacteria 2357
29 Ga0070684_100052214 3300005535 Bacteria 3554
30 Ga0068853_100025440 3300005539 Unclassified 4967
31 Ga0068853_100031212 3300005539 Bacteria 4506
32 Ga0070672_100020997 3300005543 Bacteria 4774
33 Ga0070672_100503973 3300005543 Bacteria 1047
34 Ga0070665_100008455 3300005548 Bacteria 10411
35 Ga0068855_100004970 3300005563 Bacteria 16223
36 Ga0068855_100045244 3300005563 Bacteria 5205
37 Ga0070664_100016990 3300005564 Bacteria 5972
38 Ga0068857_100211464 3300005577 Unclassified 1770
39 Ga0068857_100319075 3300005577 Bacteria 1435
40 Ga0068854_100047498 3300005578 Unclassified 3060
41 Ga0068856_100027915 3300005614 Bacteria 5507
42 Ga0068852_100000897 3300005616 Bacteria 19694
43 Ga0068852_100004300 3300005616 Bacteria 10051
44 Ga0068852_100154887 3300005616 Bacteria 2134
45 Ga0068852_100202907 3300005616 Bacteria 1877
46 Ga0068859_100011705 3300005617 Bacteria 8814
47 Ga0068859_100035020 3300005617 Bacteria 5036
48 Ga0068859_100054282 3300005617 Bacteria 4029
49 Ga0068859_100238894 3300005617 Unclassified 1906
50 Ga0068859_100329883 3300005617 Bacteria 1620
51 Ga0068864_100127345 3300005618 Bacteria 2283
52 Ga0068864_100355793 3300005618 Bacteria 1383
53 Ga0068866_10052705 3300005718 Bacteria 2077
54 Ga0068866_10083268 3300005718 Bacteria 1723
55 Ga0068861_100028237 3300005719 Bacteria 4093
56 Ga0068861_100346965 3300005719 Archaea 1301
57 Ga0068851_10108247 3300005834 Bacteria 1481
58 Ga0068851_10126614 3300005834 Bacteria 1378
59 Ga0068860_100011263 3300005843 Bacteria 8813
60 Ga0068860_100021859 3300005843 Bacteria 6190
61 Ga0068862_100159633 3300005844 Unclassified 2012
62 Ga0081539_10000042 3300005985 Bacteria 289955
63 Ga0097621_100006881 3300006237 Bacteria 8088
64 Ga0097621_100314477 3300006237 Bacteria 1386
65 Ga0075430_100002216 3300006846 Bacteria 16112
66 Ga0075431_100079739 3300006847 Bacteria 3379
67 Ga0068865_100012383 3300006881 Bacteria 5367
68 Ga0068865_100118565 3300006881 Bacteria 1964
69 Ga0097620_100011705 3300006931 Bacteria 8814
70 Ga0097620_100035023 3300006931 Bacteria 5036
71 Ga0097620_100054282 3300006931 Bacteria 4029
72 Ga0097620_100238897 3300006931 Unclassified 1906
73 Ga0097620_100329895 3300006931 Bacteria 1620
74 Ga0105240_10007820 3300009093 Bacteria 15434
75 Ga0114129_10065602 3300009147 Bacteria 5067
76 Ga0105242_10021087 3300009176 Bacteria 5113
77 Ga0105242_10034580 3300009176 Bacteria 4052
78 Ga0105242_10054738 3300009176 Bacteria 3262
79 Ga0105242_10152235 3300009176 Bacteria 2018
80 Ga0105237_10003399 3300009545 Bacteria 18931
81 Ga0105237_10004660 3300009545 Bacteria 15793
82 Ga0105237_10158650 3300009545 Bacteria 2260
83 Ga0105238_10043769 3300009551 Bacteria 4529
84 Ga0105249_10007000 3300009553 Bacteria 9841
85 Ga0105239_10001834 3300010375 Bacteria 27813
86 Ga0105239_10012454 3300010375 Bacteria 9472
87 Ga0105246_10172942 3300011119 Bacteria 1656
88 Ga0157371_10026242 3300013102 Bacteria 4236
89 Ga0157371_10146776 3300013102 Bacteria 1681
90 Ga0157370_10001901 3300013104 Bacteria 25708
91 Ga0157369_10069662 3300013105 Bacteria 3779
92 Ga0157369_10107444 3300013105 Bacteria 2969
93 Ga0157374_10040158 3300013296 Bacteria 4308
94 Ga0157374_10052990 3300013296 Bacteria 3781
95 Ga0157378_10022691 3300013297 Bacteria 5524
96 Ga0157378_10120058 3300013297 Bacteria 2422
97 Ga0157378_10199544 3300013297 Unclassified 1892
98 Ga0163162_10020533 3300013306 Bacteria 6490
99 Ga0163162_10052305 3300013306 Bacteria 4102
100 Ga0163162_10722419 3300013306 Bacteria 1117
101 Ga0157372_10001369 3300013307 Bacteria 26379
102 Ga0157372_10077017 3300013307 Bacteria 3766
103 Ga0157372_10097578 3300013307 Bacteria 3352
104 Ga0157372_10408495 3300013307 Bacteria 1582
105 Ga0157375_10064574 3300013308 Bacteria 3645
106 Ga0163163_10469721 3300014325 Unclassified 1319
107 Ga0157379_10228297 3300014968 Bacteria 1687
108 Ga0157376_10201951 3300014969 Unclassified 1830
109 Ga0157376_10559290 3300014969 Bacteria 1133
110 Ga0213876_10005696 3300021384 Bacteria 6832
111 Ga0207426_1000132 3300025302 Bacteria 209623
112 Ga0207642_10038867 3300025899 Bacteria 2063
113 Ga0207688_10016077 3300025901 Bacteria 4057
114 Ga0207645_10009902 3300025907 Bacteria 6567
115 Ga0207654_10106026 3300025911 Bacteria 1740
116 Ga0207695_10030445 3300025913 Bacteria 5940
117 Ga0207671_10003806 3300025914 Bacteria 14790
118 Ga0207671_10008591 3300025914 Bacteria 8635
119 Ga0207671_10089157 3300025914 Bacteria 2321
120 Ga0207650_10010184 3300025925 Bacteria 6442
121 Ga0207650_10132072 3300025925 Unclassified 1955
122 Ga0207659_10067521 3300025926 Bacteria 2597
123 Ga0207690_10167567 3300025932 Bacteria 1643
124 Ga0207706_10005000 3300025933 Bacteria 12384
125 Ga0207670_10268813 3300025936 Unclassified 1324
126 Ga0207669_10159816 3300025937 Bacteria 1590
127 Ga0207704_10146066 3300025938 Bacteria 1662
128 Ga0207689_10003045 3300025942 Bacteria 15442
129 Ga0207689_10016808 3300025942 Bacteria 6193
130 Ga0207679_10238181 3300025945 Bacteria 1540
131 Ga0207667_10001158 3300025949 Bacteria 33133
132 Ga0207667_10036014 3300025949 Bacteria 5307
133 Ga0207651_10287335 3300025960 Bacteria 1362
134 Ga0207712_10053672 3300025961 Bacteria 2828
135 Ga0207668_10395563 3300025972 Bacteria 1167
136 Ga0207640_10029717 3300025981 Bacteria 3358
137 Ga0207658_10040013 3300025986 Bacteria 3386
138 Ga0207658_10059959 3300025986 Bacteria 2837
139 Ga0207658_10124986 3300025986 Bacteria 2057
140 Ga0207658_10338616 3300025986 Unclassified 1307
141 Ga0207677_10045343 3300026023 Bacteria 2936
142 Ga0207677_10078357 3300026023 Bacteria 2359
143 Ga0207703_10076940 3300026035 Bacteria 2769
144 Ga0207639_10021884 3300026041 Bacteria 4598
145 Ga0207702_10020683 3300026078 Bacteria 5445
146 Ga0207641_10169234 3300026088 Unclassified 1993
147 Ga0207648_10000860 3300026089 Bacteria 34249
148 Ga0207648_10003633 3300026089 Bacteria 16131
149 Ga0207648_10024542 3300026089 Bacteria 5379
150 Ga0207676_10066711 3300026095 Bacteria 2872
151 Ga0207676_10170129 3300026095 Bacteria 1897
152 Ga0207675_100025757 3300026118 Bacteria 5474
153 Ga0207675_100041494 3300026118 Bacteria 4298
154 Ga0268265_10280788 3300028380 Bacteria 1490
155 Ga0268264_10008886 3300028381 Bacteria 8331
156 Ga0268264_10096065 3300028381 Bacteria 2566
157 Ga0268264_10117131 3300028381 Bacteria 2343
158 Ga0307517_10020139 3300028786 Bacteria 8515
159 Ga0307515_10000001 3300028794 Bacteria 4259510
160 Ga0307515_10029635 3300028794 Bacteria 9238
161 Ga0265327_10042377 3300031251 Bacteria 2444
162 Ga0307516_10000496 3300031730 Bacteria 52327
163 Ga0395905_0604143 3300037471 Bacteria 999
164 Ga0436365_0390857 3300039437 Bacteria 26340
165 Ga0436365_0890266 3300039437 Bacteria 2375
166 Ga0466972_0000016 3300044658 Bacteria 208802
167 Ga0453684_0451149 3300044712 Bacteria 1431
168 Ga0466957_0100046 3300044842 Unclassified 1827
169 Ga0466967_0159222 3300045976 Bacteria 2118
170 Ga0495650_0024610 3300046471 Bacteria 2841
171 Ga0495652_0296603 3300046529 Bacteria 1177
172 Ga0495668_0000114 3300046616 Bacteria 127503
173 Ga0501037_0195270 3300049573 Bacteria 1432
174 Ga0501043_0003586 3300049579 Bacteria 12742
175 Ga0501043_0165531 3300049579 Bacteria 1727
176 Ga0501048_0213082 3300049582 Unclassified 1370
177 Ga0501069_0008695 3300049585 Bacteria 5348
178 Ga0501079_0128743 3300049741 Bacteria 1970
179 Ga0501044_0383154 3300049823 Unclassified 1321
180 nmdc:mga0qj67_8917_c1 3300050509 Bacteria 7442
181 nmdc:mga06r32_252529_c1 3300050510 Bacteria 1751
182 Ga0500562_000086 3300053108 Bacteria 38952
183 Ga0500568_0000635 3300053139 Bacteria 25302
184 Ga0500616_0094998 3300053153 Bacteria 1468
185 Ga0500622_0000948 3300053156 Bacteria 24673
186 Ga0501084_0001548 3300054114 Bacteria 18288
187 Ga0500661_008787 3300055283 Bacteria 1858
188 Ga0501082_0379998 3300060353 Unclassified 1232

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005459 Ga0068867_100044599 Ga0068867_1000445994 289
2 3300046616 Ga0495668_0000114 Ga0495668_0000114_38160_39077 305
3 iso_pu_bacteria 2929154850 2929158662 305
4 3300028786 Ga0307517_10020139 Ga0307517_1002013910 306
5 3300031730 Ga0307516_10000496 Ga0307516_1000049625 306
6 3300003320 rootH2_10104165 rootH2_101041656 307
7 3300005331 Ga0070670_100357018 Ga0070670_1003570181 307
8 3300005335 Ga0070666_10108161 Ga0070666_101081613 307
9 3300005338 Ga0068868_100008668 Ga0068868_1000086684 307
10 3300005347 Ga0070668_100038873 Ga0070668_1000388733 307
11 3300005347 Ga0070668_100091413 Ga0070668_1000914133 307
12 3300005354 Ga0070675_100289137 Ga0070675_1002891371 307
13 3300005356 Ga0070674_100250628 Ga0070674_1002506282 307
14 3300005364 Ga0070673_100008682 Ga0070673_1000086823 307
15 3300005367 Ga0070667_100076337 Ga0070667_1000763373 307
16 3300005456 Ga0070678_100001724 Ga0070678_1000017247 307
17 3300005539 Ga0068853_100025440 Ga0068853_1000254403 307
18 3300005539 Ga0068853_100031212 Ga0068853_1000312126 307
19 3300005543 Ga0070672_100020997 Ga0070672_1000209972 307
20 3300005543 Ga0070672_100503973 Ga0070672_1005039732 307
21 3300005548 Ga0070665_100008455 Ga0070665_1000084558 307
22 3300005563 Ga0068855_100004970 Ga0068855_10000497019 307
23 3300005563 Ga0068855_100045244 Ga0068855_1000452443 307
24 3300005578 Ga0068854_100047498 Ga0068854_1000474983 307
25 3300005614 Ga0068856_100027915 Ga0068856_1000279153 307
26 3300005616 Ga0068852_100000897 Ga0068852_10000089718 307
27 3300005617 Ga0068859_100011705 Ga0068859_10001170510 307
28 3300005617 Ga0068859_100035020 Ga0068859_1000350202 307
29 3300005617 Ga0068859_100054282 Ga0068859_1000542823 307
30 3300005618 Ga0068864_100355793 Ga0068864_1003557933 307
31 3300005719 Ga0068861_100028237 Ga0068861_1000282373 307
32 3300005719 Ga0068861_100346965 Ga0068861_1003469652 307
33 3300005834 Ga0068851_10108247 Ga0068851_101082472 307
34 3300005843 Ga0068860_100011263 Ga0068860_1000112632 307
35 3300005843 Ga0068860_100021859 Ga0068860_1000218591 307
36 3300006237 Ga0097621_100006881 Ga0097621_1000068814 307
37 3300006237 Ga0097621_100314477 Ga0097621_1003144772 307
38 3300006881 Ga0068865_100012383 Ga0068865_1000123833 307
39 3300006931 Ga0097620_100011705 Ga0097620_10001170510 307
40 3300006931 Ga0097620_100035023 Ga0097620_1000350234 307
41 3300006931 Ga0097620_100054282 Ga0097620_1000542823 307
42 3300009093 Ga0105240_10007820 Ga0105240_1000782010 307
43 3300009176 Ga0105242_10034580 Ga0105242_100345802 307
44 3300009176 Ga0105242_10152235 Ga0105242_101522351 307
45 3300009545 Ga0105237_10003399 Ga0105237_1000339914 307
46 3300009545 Ga0105237_10158650 Ga0105237_101586502 307
47 3300009551 Ga0105238_10043769 Ga0105238_100437693 307
48 3300010375 Ga0105239_10001834 Ga0105239_1000183415 307
49 3300013104 Ga0157370_10001901 Ga0157370_100019012 307
50 3300013105 Ga0157369_10107444 Ga0157369_101074443 307
51 3300013296 Ga0157374_10052990 Ga0157374_100529903 307
52 3300013297 Ga0157378_10120058 Ga0157378_101200581 307
53 3300013297 Ga0157378_10199544 Ga0157378_101995441 307
54 3300013306 Ga0163162_10020533 Ga0163162_100205335 307
55 3300013306 Ga0163162_10052305 Ga0163162_100523054 307
56 3300013307 Ga0157372_10001369 Ga0157372_1000136911 307
57 3300013308 Ga0157375_10064574 Ga0157375_100645743 307
58 3300014968 Ga0157379_10228297 Ga0157379_102282972 307
59 3300014969 Ga0157376_10559290 Ga0157376_105592901 307
60 3300025901 Ga0207688_10016077 Ga0207688_100160772 307
61 3300025907 Ga0207645_10009902 Ga0207645_100099022 307
62 3300025911 Ga0207654_10106026 Ga0207654_101060262 307
63 3300025913 Ga0207695_10030445 Ga0207695_100304452 307
64 3300025914 Ga0207671_10003806 Ga0207671_1000380614 307
65 3300025914 Ga0207671_10008591 Ga0207671_1000859110 307
66 3300025925 Ga0207650_10010184 Ga0207650_100101844 307
67 3300025926 Ga0207659_10067521 Ga0207659_100675213 307
68 3300025942 Ga0207689_10003045 Ga0207689_100030454 307
69 3300025949 Ga0207667_10001158 Ga0207667_100011585 307
70 3300025949 Ga0207667_10036014 Ga0207667_100360144 307
71 3300025981 Ga0207640_10029717 Ga0207640_100297172 307
72 3300025986 Ga0207658_10059959 Ga0207658_100599593 307
73 3300025986 Ga0207658_10338616 Ga0207658_103386162 307
74 3300026023 Ga0207677_10078357 Ga0207677_100783572 307
75 3300026041 Ga0207639_10021884 Ga0207639_100218842 307
76 3300026078 Ga0207702_10020683 Ga0207702_100206837 307
77 3300026088 Ga0207641_10169234 Ga0207641_101692342 307
78 3300026089 Ga0207648_10000860 Ga0207648_100008603 307
79 3300026089 Ga0207648_10024542 Ga0207648_100245422 307
80 3300026095 Ga0207676_10066711 Ga0207676_100667114 307
81 3300026118 Ga0207675_100025757 Ga0207675_1000257573 307
82 3300028380 Ga0268265_10280788 Ga0268265_102807881 307
83 3300028381 Ga0268264_10008886 Ga0268264_100088865 307
84 3300028381 Ga0268264_10096065 Ga0268264_100960653 307
85 3300028381 Ga0268264_10117131 Ga0268264_101171312 307
86 3300028794 Ga0307515_10000001 Ga0307515_100000012104 307
87 3300028794 Ga0307515_10029635 Ga0307515_100296354 307
88 3300044712 Ga0453684_0451149 Ga0453684_0451149_266_1192 307
89 3300044842 Ga0466957_0100046 Ga0466957_0100046_182_1105 307
90 3300046471 Ga0495650_0024610 Ga0495650_0024610_1903_2826 307
91 3300049582 Ga0501048_0213082 Ga0501048_0213082_205_1128 307
92 3300049585 Ga0501069_0008695 Ga0501069_0008695_778_1701 307
93 3300049741 Ga0501079_0128743 Ga0501079_0128743_488_1411 307
94 3300049823 Ga0501044_0383154 Ga0501044_0383154_366_1289 307
95 3300053153 Ga0500616_0094998 Ga0500616_0094998_347_1270 307
96 3300054114 Ga0501084_0001548 Ga0501084_0001548_16781_17704 307
97 3300060353 Ga0501082_0379998 Ga0501082_0379998_44_967 307
98 3300003323 rootH1_10107461 rootH1_101074616 308
99 3300005330 Ga0070690_100014235 Ga0070690_1000142353 308
100 3300005334 Ga0068869_100171710 Ga0068869_1001717102 308
101 3300005340 Ga0070689_100063099 Ga0070689_1000630993 308
102 3300005356 Ga0070674_100132677 Ga0070674_1001326772 308
103 3300005365 Ga0070688_100067522 Ga0070688_1000675223 308
104 3300005366 Ga0070659_100170587 Ga0070659_1001705872 308
105 3300005577 Ga0068857_100211464 Ga0068857_1002114642 308
106 3300005577 Ga0068857_100319075 Ga0068857_1003190752 308
107 3300005617 Ga0068859_100238894 Ga0068859_1002388942 308
108 3300005617 Ga0068859_100329883 Ga0068859_1003298832 308
109 3300005618 Ga0068864_100127345 Ga0068864_1001273451 308
110 3300005718 Ga0068866_10052705 Ga0068866_100527052 308
111 3300006846 Ga0075430_100002216 Ga0075430_1000022167 308
112 3300006847 Ga0075431_100079739 Ga0075431_1000797393 308
113 3300006881 Ga0068865_100118565 Ga0068865_1001185652 308
114 3300006931 Ga0097620_100238897 Ga0097620_1002388972 308
115 3300006931 Ga0097620_100329895 Ga0097620_1003298952 308
116 3300009147 Ga0114129_10065602 Ga0114129_100656024 308
117 3300009176 Ga0105242_10054738 Ga0105242_100547382 308
118 3300009545 Ga0105237_10004660 Ga0105237_1000466010 308
119 3300010375 Ga0105239_10012454 Ga0105239_100124545 308
120 3300013102 Ga0157371_10026242 Ga0157371_100262422 308
121 3300013307 Ga0157372_10408495 Ga0157372_104084952 308
122 3300014969 Ga0157376_10201951 Ga0157376_102019512 308
123 3300025302 Ga0207426_1000132 Ga0207426_100013282 308
124 3300025899 Ga0207642_10038867 Ga0207642_100388672 308
125 3300025914 Ga0207671_10089157 Ga0207671_100891571 308
126 3300025932 Ga0207690_10167567 Ga0207690_101675672 308
127 3300025936 Ga0207670_10268813 Ga0207670_102688132 308
128 3300025937 Ga0207669_10159816 Ga0207669_101598162 308
129 3300025938 Ga0207704_10146066 Ga0207704_101460662 308
130 3300025960 Ga0207651_10287335 Ga0207651_102873352 308
131 3300025986 Ga0207658_10040013 Ga0207658_100400134 308
132 3300026035 Ga0207703_10076940 Ga0207703_100769402 308
133 3300026089 Ga0207648_10003633 Ga0207648_100036336 308
134 3300026095 Ga0207676_10170129 Ga0207676_101701292 308
135 3300026118 Ga0207675_100041494 Ga0207675_1000414943 308
136 3300037471 Ga0395905_0604143 Ga0395905_0604143_48_974 308
137 3300044658 Ga0466972_0000016 Ga0466972_0000016_99629_100558 308
138 3300049579 Ga0501043_0003586 Ga0501043_0003586_865_1809 308
139 3300050509 nmdc:mga0qj67_8917_c1 nmdc:mga0qj67_8917_c1_5102_6028 308
140 3300050510 nmdc:mga06r32_252529_c1 nmdc:mga06r32_252529_c1_626_1552 308
141 3300053108 Ga0500562_000086 Ga0500562_000086_13839_14768 308
142 3300053139 Ga0500568_0000635 Ga0500568_0000635_9759_10685 308
143 3300053156 Ga0500622_0000948 Ga0500622_0000948_11400_12329 308
144 3300055283 Ga0500661_008787 Ga0500661_008787_174_1103 308
145 3300005367 Ga0070667_100131321 Ga0070667_1001313212 309
146 3300009553 Ga0105249_10007000 Ga0105249_100070006 309
147 3300025961 Ga0207712_10053672 Ga0207712_100536723 309
148 3300025986 Ga0207658_10124986 Ga0207658_101249864 309
149 3300003203 JGI25406J46586_10006999 JGI25406J46586_100069992 311
150 3300003322 rootL2_10188576 rootL2_101885763 311
151 3300005338 Ga0068868_100046456 Ga0068868_1000464566 311
152 3300005364 Ga0070673_100460229 Ga0070673_1004602291 311
153 3300005459 Ga0068867_100075659 Ga0068867_1000756591 311
154 3300005530 Ga0070679_100008654 Ga0070679_1000086549 311
155 3300005530 Ga0070679_100046244 Ga0070679_1000462444 311
156 3300005530 Ga0070679_100144432 Ga0070679_1001444322 311
157 3300005535 Ga0070684_100052214 Ga0070684_1000522143 311
158 3300005564 Ga0070664_100016990 Ga0070664_1000169904 311
159 3300005616 Ga0068852_100004300 Ga0068852_1000043002 311
160 3300005616 Ga0068852_100154887 Ga0068852_1001548872 311
161 3300005616 Ga0068852_100202907 Ga0068852_1002029072 311
162 3300005718 Ga0068866_10083268 Ga0068866_100832682 311
163 3300005834 Ga0068851_10126614 Ga0068851_101266142 311
164 3300005844 Ga0068862_100159633 Ga0068862_1001596333 311
165 3300005985 Ga0081539_10000042 Ga0081539_1000004284 311
166 3300009176 Ga0105242_10021087 Ga0105242_100210873 311
167 3300011119 Ga0105246_10172942 Ga0105246_101729422 311
168 3300013102 Ga0157371_10146776 Ga0157371_101467762 311
169 3300013105 Ga0157369_10069662 Ga0157369_100696622 311
170 3300013296 Ga0157374_10040158 Ga0157374_100401584 311
171 3300013297 Ga0157378_10022691 Ga0157378_100226915 311
172 3300013306 Ga0163162_10722419 Ga0163162_107224192 311
173 3300013307 Ga0157372_10077017 Ga0157372_100770172 311
174 3300013307 Ga0157372_10097578 Ga0157372_100975782 311
175 3300014325 Ga0163163_10469721 Ga0163163_104697211 311
176 3300021384 Ga0213876_10005696 Ga0213876_100056964 311
177 3300025925 Ga0207650_10132072 Ga0207650_101320722 311
178 3300025933 Ga0207706_10005000 Ga0207706_100050006 311
179 3300025942 Ga0207689_10016808 Ga0207689_100168083 311
180 3300025945 Ga0207679_10238181 Ga0207679_102381812 311
181 3300025972 Ga0207668_10395563 Ga0207668_103955632 311
182 3300026023 Ga0207677_10045343 Ga0207677_100453432 311
183 3300031251 Ga0265327_10042377 Ga0265327_100423773 311
184 3300039437 Ga0436365_0390857 Ga0436365_0390857_4370_5311 311
185 3300039437 Ga0436365_0890266 Ga0436365_0890266_671_1612 311
186 3300045976 Ga0466967_0159222 Ga0466967_0159222_1092_2030 311
187 3300046529 Ga0495652_0296603 Ga0495652_0296603_150_1091 311
188 3300049573 Ga0501037_0195270 Ga0501037_0195270_251_1192 311
189 3300049579 Ga0501043_0165531 Ga0501043_0165531_303_1244 311

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00389

2-Hacid_dh

D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain

30

334

0.98

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

132

313

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7va1-assembly1.cif.gz_B crystal structure of human 3-phosphoglycerate dehydrogenase in complex with gdd-04-35 0.9006 97 287
6rj6-assembly1.cif.gz_A crystal structure of phgdh in complex with bi-4924 0.8953 99 302
6cwa-assembly1.cif.gz_B crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution 0.8944 2 301
6cwa-assembly1.cif.gz_B crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution 0.8884 2 301
6plf-assembly1.cif.gz_B crystal structure of human phgdh complexed with compound 1 0.8858 2 304
ID Description Score Start End Superfamily
2eklA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9352 2 91 3.40.50.720
af_O88712_64_123_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9322 38 93 3.90.180.10
1wwkB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9188 3 91 3.40.50.720
af_Q2FZW9_11_72_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9148 32 89 3.40.50.720
af_A0A0P0X499_8_76_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.91 31 89 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1Q4F283-F1-model_v4 Hydroxyacid dehydrogenase 0.9832 1 303 GO:0005829
GO:0016618
GO:0030267
GO:0051287
AF-A0A4P5SX02-F1-model_v4 2-hydroxyacid dehydrogenase 0.9825 1 303 GO:0016616
GO:0051287
AF-A0A2P8DC57-F1-model_v4 D-3-phosphoglycerate dehydrogenase 0.978 2 306 GO:0016616
GO:0051287
AF-A0A838F7X6-F1-model_v4 Hydroxyacid dehydrogenase 0.9683 2 308 GO:0016616
GO:0051287
AF-A0A848T384-F1-model_v4 Hydroxyacid dehydrogenase 0.9681 2 304 GO:0008720
GO:0051287

Feature Viewer

pLDDT pTM Quality
93.57 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map