F290645

General Info

Members Datasets Scaffolds Average Seq Length
189 122 379 110

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_100195434|Ga0068854_1001954341
Length 117
Sequence MSEKAMTHKEFEEYLLSFPNTWLGFPFGEGTSVYKIGHKETGEGKIFAIIQDGSKPLRVSLKCDPHLAETLREKYETVVPGYHLNKKHWNTILVTGQLTNDELQDLARHSYQLVSGS

Samples

Sample ID Description Type Environment
1 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
58 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
59 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
60 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
61 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
62 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
65 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
66 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
67 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
68 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
69 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
70 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
71 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
72 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
73 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
76 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
79 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
80 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
81 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
82 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
83 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
84 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
85 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
86 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
87 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
88 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
89 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
90 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
91 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
94 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
95 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
96 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
97 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
98 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
99 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
100 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
101 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
102 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
103 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
104 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
105 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
106 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
107 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
108 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
109 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
110 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
111 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
112 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
113 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
114 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
115 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
116 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
117 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
118 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
119 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
120 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
121 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
122 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.04
Nodule 0
Rhizoplane 1.06
Rhizosphere 66.67
Stem 0
Stem Tuber 0
Unclassified 13.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068854_100195434 3300005578 Bacteria 1587
2 MBSR1b_contig_12120710 2162886012 Unclassified 2319
3 MBSR1b_contig_1226760 2162886012 Unclassified 2583
4 rootH1_10003685 3300003316 Bacteria 49635
5 rootH1_10003685 3300003323 Bacteria 21096
6 rootH2_10008921 3300003320 Bacteria 50114
7 rootH2_10242516 3300003320 Bacteria 2470
8 rootL2_10380321 3300003322 Unclassified 1325
9 rootH1_10001727 3300003323 Bacteria 102468
10 rootH1_10379776 3300003323 Bacteria 1367
11 JGI25405J52794_10005825 3300003911 Bacteria 2236
12 Ga0065715_10090517 3300005293 Bacteria 6877
13 Ga0070683_100009101 3300005329 Bacteria 8477
14 Ga0070690_100008622 3300005330 Bacteria 5880
15 Ga0068868_100549775 3300005338 Bacteria 1017
16 Ga0070660_100312165 3300005339 Bacteria 1290
17 Ga0070659_101689508 3300005366 Unclassified 566
18 Ga0070681_10117573 3300005458 Bacteria 2595
19 Ga0070679_100450353 3300005530 Bacteria 1232
20 Ga0070684_100003232 3300005535 Bacteria 12185
21 Ga0068853_100293086 3300005539 Bacteria 1502
22 Ga0070686_100031726 3300005544 Bacteria 3233
23 Ga0068855_100000002 3300005563 Bacteria 616881
24 Ga0068855_100014163 3300005563 Bacteria 9608
25 Ga0068855_100614889 3300005563 Bacteria 1170
26 Ga0068857_100086990 3300005577 Bacteria 2795
27 Ga0068856_100095746 3300005614 Unclassified 2957
28 Ga0068856_100170683 3300005614 Bacteria 2187
29 Ga0081455_10000006 3300005937 Bacteria 323066
30 Ga0075365_10000005 3300006038 Bacteria 125137
31 Ga0075365_10000113 3300006038 Bacteria 23945
32 Ga0075365_10001282 3300006038 Bacteria 11175
33 Ga0075365_10005326 3300006038 Bacteria 6925
34 Ga0075368_10000664 3300006042 Bacteria 10443
35 Ga0075363_100241895 3300006048 Bacteria 1037
36 Ga0075364_10000166 3300006051 Bacteria 29442
37 Ga0075364_10222874 3300006051 Bacteria 1280
38 Ga0075362_10125130 3300006177 Bacteria 1219
39 Ga0075367_10010207 3300006178 Unclassified 4925
40 Ga0075369_10000004 3300006186 Bacteria 154675
41 Ga0075369_10003077 3300006186 Bacteria 6042
42 Ga0075370_10006167 3300006353 Bacteria 6014
43 Ga0105240_10000030 3300009093 Bacteria 321312
44 Ga0105240_10406334 3300009093 Bacteria 1533
45 Ga0105240_10813940 3300009093 Bacteria 1011
46 Ga0105245_10038613 3300009098 Unclassified 4248
47 Ga0105245_10212389 3300009098 Bacteria 1863
48 Ga0105241_10019510 3300009174 Bacteria 5000
49 Ga0105241_10486826 3300009174 Bacteria 1097
50 Ga0105237_10000001 3300009545 Bacteria 1009213
51 Ga0105237_12686066 3300009545 Bacteria 509
52 Ga0105032_100002 3300009979 Bacteria 303884
53 Ga0105032_100010 3300009979 Bacteria 81059
54 Ga0105239_10361034 3300010375 Bacteria 1641
55 Ga0157314_1005911 3300012500 Bacteria 943
56 Ga0157371_10003785 3300013102 Bacteria 13544
57 Ga0157371_10088640 3300013102 Bacteria 2191
58 Ga0157371_10361265 3300013102 Bacteria 1058
59 Ga0157370_10000232 3300013104 Bacteria 71177
60 Ga0157370_10072532 3300013104 Bacteria 3248
61 Ga0157369_10000003 3300013105 Bacteria 507337
62 Ga0157369_10016734 3300013105 Bacteria 8242
63 Ga0157369_10043685 3300013105 Bacteria 4884
64 Ga0157369_11561551 3300013105 Bacteria 671
65 Ga0157374_10004004 3300013296 Bacteria 12384
66 Ga0157374_10160676 3300013296 Bacteria 2188
67 Ga0157374_11004517 3300013296 Unclassified 853
68 Ga0157378_10557995 3300013297 Bacteria 1151
69 Ga0157372_10000007 3300013307 Bacteria 340690
70 Ga0157372_10017752 3300013307 Bacteria 7638
71 Ga0157372_10106749 3300013307 Bacteria 3203
72 Ga0157372_13363210 3300013307 Unclassified 509
73 Ga0207654_10140609 3300025911 Bacteria 1539
74 Ga0207654_10324491 3300025911 Bacteria 1053
75 Ga0207707_10127029 3300025912 Bacteria 2230
76 Ga0207695_10000009 3300025913 Bacteria 1034276
77 Ga0207695_10571425 3300025913 Bacteria 1012
78 Ga0207671_10000003 3300025914 Bacteria 1065461
79 Ga0207657_10035664 3300025919 Unclassified 4459
80 Ga0207652_10404395 3300025921 Bacteria 1232
81 Ga0207690_11248452 3300025932 Unclassified 621
82 Ga0207661_10000526 3300025944 Bacteria 24641
83 Ga0207667_10000005 3300025949 Bacteria 715503
84 Ga0207667_10000278 3300025949 Bacteria 70630
85 Ga0207667_10997351 3300025949 Bacteria 825
86 Ga0207640_10174112 3300025981 Bacteria 1607
87 Ga0207677_11061565 3300026023 Unclassified 737
88 Ga0207702_10119014 3300026078 Unclassified 2361
89 Ga0207674_10105441 3300026116 Bacteria 2797
90 Ga0207674_10401683 3300026116 Bacteria 1324
91 Ga0209813_10000186 3300027866 Bacteria 19692
92 Ga0265337_1000048 3300028556 Bacteria 53749
93 Ga0265337_1013474 3300028556 Bacteria 2742
94 Ga0265326_10000208 3300028558 Bacteria 29214
95 Ga0265326_10003117 3300028558 Bacteria 5487
96 Ga0265334_10001327 3300028573 Bacteria 11930
97 Ga0265322_10001239 3300028654 Bacteria 8683
98 Ga0265322_10001580 3300028654 Bacteria 7308
99 Ga0265336_10000020 3300028666 Bacteria 213480
100 Ga0265338_10000093 3300028800 Bacteria 168444
101 Ga0265338_10001060 3300028800 Bacteria 45733
102 Ga0265338_10457892 3300028800 Bacteria 902
103 Ga0265324_10002301 3300029957 Bacteria 9933
104 Ga0316177_1189579 3300030731 Unclassified 573
105 Ga0314311_1150615 3300030733 Bacteria 8817
106 Ga0314311_1244209 3300030733 Bacteria 730
107 Ga0316179_1056598 3300030734 Bacteria 39107
108 Ga0316180_1029413 3300030736 Unclassified 4648
109 Ga0316183_1008390 3300030742 Bacteria 9967
110 Ga0316183_1024804 3300030742 Bacteria 1580
111 Ga0316183_1114883 3300030742 Bacteria 48072
112 Ga0316183_1183010 3300030742 Bacteria 4424
113 Ga0316181_1069799 3300030744 Bacteria 1679
114 Ga0316181_1123581 3300030744 Bacteria 76132
115 Ga0316181_1259951 3300030744 Bacteria 1154
116 Ga0316182_1010237 3300030745 Bacteria 8976
117 Ga0316182_1018373 3300030745 Bacteria 7132
118 Ga0316182_1080972 3300030745 Bacteria 682
119 Ga0316182_1234581 3300030745 Bacteria 23872
120 Ga0316182_1448605 3300030745 Bacteria 6335
121 Ga0265339_10071955 3300031249 Bacteria 1841
122 Ga0265339_10114825 3300031249 Bacteria 1389
123 Ga0265331_10033342 3300031250 Bacteria 2547
124 Ga0265316_10121986 3300031344 Unclassified 1968
125 Ga0307509_10032800 3300031507 Bacteria 5722
126 Ga0307405_10083314 3300031731 Bacteria 2096
127 Ga0307412_10002279 3300031911 Bacteria 10620
128 Ga0439461_0032022 3300041410 Unclassified 1100
129 Ga0439461_0210544 3300041410 Unclassified 526
130 Ga0451807_1533692 3300041486 Unclassified 804
131 Ga0451853_2166348 3300041512 Bacteria 576
132 Ga0439463_029630 3300042016 Unclassified 1379
133 Ga0450920_001428 3300042122 Bacteria 3951
134 Ga0450906_004889 3300042145 Bacteria 2787
135 Ga0450910_006352 3300042147 Bacteria 1630
136 Ga0439446_0000002 3300042156 Bacteria 177065
137 Ga0450909_007326 3300042185 Bacteria 1595
138 Ga0450909_062628 3300042185 Bacteria 589
139 Ga0439434_0017078 3300042435 Bacteria 2170
140 Ga0450918_000494 3300042531 Bacteria 8451
141 Ga0450918_035738 3300042531 Unclassified 884
142 Ga0466972_0045336 3300044658 Bacteria 2131
143 Ga0466965_0000207 3300044683 Bacteria 18400
144 Ga0466968_0552719 3300044735 Unclassified 578
145 Ga0466970_0165600 3300044765 Bacteria 1224
146 Ga0495660_0000114 3300046810 Bacteria 86218
147 Ga0495660_0331437 3300046810 Bacteria 681
148 Ga0495680_0571403 3300047322 Bacteria 759
149 Ga0496100_0011723 3300048903 Bacteria 4998
150 Ga0501073_0815171 3300049589 Bacteria 643
151 Ga0501223_049773 3300049663 Bacteria 813
152 nmdc:mga03683_7097_c1 3300050489 Bacteria 1114
153 nmdc:mga03n38_6386_c2 3300050490 Bacteria 1971
154 nmdc:mga00v17_128_c1 3300050491 Bacteria 44347
155 nmdc:mga0yw44_1016554_c1 3300050492 Bacteria 561
156 nmdc:mga0yw44_11_c1 3300050492 Bacteria 130624
157 nmdc:mga0yw44_1238_c1 3300050492 Bacteria 10033
158 nmdc:mga0yw44_5963_c1 3300050492 Bacteria 5830
159 nmdc:mga0yw44_5_c1 3300050492 Bacteria 313167
160 nmdc:mga06z11_13768_c1 3300050494 Unclassified 3563
161 nmdc:mga06z11_151_c1 3300050494 Bacteria 27161
162 nmdc:mga04h51_213_c1 3300050495 Bacteria 15573
163 nmdc:mga07m45_14804_c1 3300050496 Bacteria 4165
164 nmdc:mga07m45_271209_c1 3300050496 Bacteria 987
165 nmdc:mga0sz30_1649_c1 3300050516 Bacteria 6042
166 nmdc:mga0sz30_2_c1 3300050516 Bacteria 626403
167 Ga0500643_005181 3300053087 Bacteria 5680
168 Ga0500644_0005371 3300053088 Bacteria 3234
169 Ga0500583_0004275 3300053092 Bacteria 4633
170 Ga0500583_0016445 3300053092 Bacteria 2953
171 Ga0500651_0000021 3300053093 Bacteria 137927
172 Ga0500651_0000105 3300053093 Bacteria 51140
173 Ga0500650_0166220 3300053098 Bacteria 1016
174 Ga0500554_137521 3300053102 Unclassified 826
175 Ga0500555_000001 3300053103 Bacteria 1353713
176 Ga0500555_000045 3300053103 Bacteria 63148
177 Ga0500556_0252964 3300053104 Bacteria 693
178 Ga0500593_000001 3300053117 Bacteria 784404
179 Ga0500594_0000106 3300053118 Bacteria 24380
180 Ga0500655_000068 3300053133 Bacteria 28266
181 Ga0500577_0000194 3300053142 Bacteria 16086
182 Ga0500577_0080721 3300053142 Bacteria 1296
183 Ga0500616_0000012 3300053153 Bacteria 681798
184 Ga0500616_0029620 3300053153 Bacteria 3011
185 Ga0500570_000807 3300053724 Bacteria 13185
186 Ga0500570_065853 3300053724 Bacteria 1723
187 Ga0500570_139073 3300053724 Bacteria 898
188 Ga0500611_104695 3300053727 Bacteria 737
189 Ga0500656_026212 3300053732 Unclassified 752
190 Ga0500613_006730 3300053738 Bacteria 1171
191 Ga0068854_100195434
192 MBSR1b_contig_12120710
193 MBSR1b_contig_1226760
194 rootH1_10003685
195 rootH2_10008921
196 rootH2_10242516
197 rootL2_10380321
198 rootH1_10001727
199 rootH1_10379776
200 JGI25405J52794_10005825
201 Ga0065715_10090517
202 Ga0070683_100009101
203 Ga0070690_100008622
204 Ga0068868_100549775
205 Ga0070660_100312165
206 Ga0070659_101689508
207 Ga0070681_10117573
208 Ga0070679_100450353
209 Ga0070684_100003232
210 Ga0068853_100293086
211 Ga0070686_100031726
212 Ga0068855_100000002
213 Ga0068855_100014163
214 Ga0068855_100614889
215 Ga0068857_100086990
216 Ga0068856_100095746
217 Ga0068856_100170683
218 Ga0081455_10000006
219 Ga0075365_10000005
220 Ga0075365_10000113
221 Ga0075365_10001282
222 Ga0075365_10005326
223 Ga0075368_10000664
224 Ga0075363_100241895
225 Ga0075364_10000166
226 Ga0075364_10222874
227 Ga0075362_10125130
228 Ga0075367_10010207
229 Ga0075369_10000004
230 Ga0075369_10003077
231 Ga0075370_10006167
232 Ga0105240_10000030
233 Ga0105240_10406334
234 Ga0105240_10813940
235 Ga0105245_10038613
236 Ga0105245_10212389
237 Ga0105241_10019510
238 Ga0105241_10486826
239 Ga0105237_10000001
240 Ga0105237_12686066
241 Ga0105032_100002
242 Ga0105032_100010
243 Ga0105239_10361034
244 Ga0157314_1005911
245 Ga0157371_10003785
246 Ga0157371_10088640
247 Ga0157371_10361265
248 Ga0157370_10000232
249 Ga0157370_10072532
250 Ga0157369_10000003
251 Ga0157369_10016734
252 Ga0157369_10043685
253 Ga0157369_11561551
254 Ga0157374_10004004
255 Ga0157374_10160676
256 Ga0157374_11004517
257 Ga0157378_10557995
258 Ga0157372_10000007
259 Ga0157372_10017752
260 Ga0157372_10106749
261 Ga0157372_13363210
262 Ga0207654_10140609
263 Ga0207654_10324491
264 Ga0207707_10127029
265 Ga0207695_10000009
266 Ga0207695_10571425
267 Ga0207671_10000003
268 Ga0207657_10035664
269 Ga0207652_10404395
270 Ga0207690_11248452
271 Ga0207661_10000526
272 Ga0207667_10000005
273 Ga0207667_10000278
274 Ga0207667_10997351
275 Ga0207640_10174112
276 Ga0207677_11061565
277 Ga0207702_10119014
278 Ga0207674_10105441
279 Ga0207674_10401683
280 Ga0209813_10000186
281 Ga0265337_1000048
282 Ga0265337_1013474
283 Ga0265326_10000208
284 Ga0265326_10003117
285 Ga0265334_10001327
286 Ga0265322_10001239
287 Ga0265322_10001580
288 Ga0265336_10000020
289 Ga0265338_10000093
290 Ga0265338_10001060
291 Ga0265338_10457892
292 Ga0265324_10002301
293 Ga0316177_1189579
294 Ga0314311_1150615
295 Ga0314311_1244209
296 Ga0316179_1056598
297 Ga0316180_1029413
298 Ga0316183_1008390
299 Ga0316183_1024804
300 Ga0316183_1114883
301 Ga0316183_1183010
302 Ga0316181_1069799
303 Ga0316181_1123581
304 Ga0316181_1259951
305 Ga0316182_1010237
306 Ga0316182_1018373
307 Ga0316182_1080972
308 Ga0316182_1234581
309 Ga0316182_1448605
310 Ga0265339_10071955
311 Ga0265339_10114825
312 Ga0265331_10033342
313 Ga0265316_10121986
314 Ga0307509_10032800
315 Ga0307405_10083314
316 Ga0307412_10002279
317 Ga0439461_0032022
318 Ga0439461_0210544
319 Ga0451807_1533692
320 Ga0451853_2166348
321 Ga0439463_029630
322 Ga0450920_001428
323 Ga0450906_004889
324 Ga0450910_006352
325 Ga0439446_0000002
326 Ga0450909_007326
327 Ga0450909_062628
328 Ga0439434_0017078
329 Ga0450918_000494
330 Ga0450918_035738
331 Ga0466972_0045336
332 Ga0466965_0000207
333 Ga0466968_0552719
334 Ga0466970_0165600
335 Ga0495660_0000114
336 Ga0495660_0331437
337 Ga0495680_0571403
338 Ga0496100_0011723
339 Ga0501073_0815171
340 Ga0501223_049773
341 nmdc:mga03683_7097_c1
342 nmdc:mga03n38_6386_c2
343 nmdc:mga00v17_128_c1
344 nmdc:mga0yw44_1016554_c1
345 nmdc:mga0yw44_11_c1
346 nmdc:mga0yw44_1238_c1
347 nmdc:mga0yw44_5963_c1
348 nmdc:mga0yw44_5_c1
349 nmdc:mga06z11_13768_c1
350 nmdc:mga06z11_151_c1
351 nmdc:mga04h51_213_c1
352 nmdc:mga07m45_14804_c1
353 nmdc:mga07m45_271209_c1
354 nmdc:mga0sz30_1649_c1
355 nmdc:mga0sz30_2_c1
356 Ga0500643_005181
357 Ga0500644_0005371
358 Ga0500583_0004275
359 Ga0500583_0016445
360 Ga0500651_0000021
361 Ga0500651_0000105
362 Ga0500650_0166220
363 Ga0500554_137521
364 Ga0500555_000001
365 Ga0500555_000045
366 Ga0500556_0252964
367 Ga0500593_000001
368 Ga0500594_0000106
369 Ga0500655_000068
370 Ga0500577_0000194
371 Ga0500577_0080721
372 Ga0500616_0000012
373 Ga0500616_0029620
374 Ga0500570_000807
375 Ga0500570_065853
376 Ga0500570_139073
377 Ga0500611_104695
378 Ga0500656_026212
379 Ga0500613_006730

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04237

YjbR

YjbR

16

113

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.9314 2 112
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.9077 2 112
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.7852 1 111
3h9x-assembly1.cif.gz_A crystal structure of the pspto_3016 protein from pseudomonas syringae, northeast structural genomics consortium target psr293 0.7783 1 109
3h9x-assembly1.cif.gz_A crystal structure of the pspto_3016 protein from pseudomonas syringae, northeast structural genomics consortium target psr293 0.7535 1 109
ID Description Score Start End Superfamily
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.9314 2 112 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.9136 1 111 3.90.1150.30
2a1vA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.9077 2 112 3.90.1150.30
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8953 3 111 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8519 1 111 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A7W1KH19-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9622 1 109 GO:0003677
AF-A0A2E4GVS0-F1-model_v4 MmcQ-like protein 0.9588 1 111
AF-A0A1E4ARE3-F1-model_v4 deleted 0.9577 1 111
AF-A0A7W0RZV6-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9569 2 111 GO:0003677
AF-A0A2G6C2F8-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.9567 13 111

Map