F290682

General Info

Members Datasets Scaffolds Average Seq Length
189 137 378 262

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100610448|Ga0068863_1006104482
Length 287
Sequence VLFLFICLKYLFDIKTEFKIFAVPEMIQAYNFLASWQLFPEKGIYEKGERPKSAIYKIEAANENKQLVISHHWVDLENYGFDSNYRILADGALNDFEKHELADQAQASFPDSISFEIHFYKKGEVVMHVIHEIMPNGYLKVTQQALKDDGNKYCNTEIYHKQLSVLPYSASVAGALIRPTEEGMIKHKALTAMEEQTNMQLNQIRKQIELLALQAQEIQKRKDLSLMIYNSKISFKPNIGQTYYLYEKNDDSYMLSLVSPNEWGSAGPFKKFIATVRLLADHTWMEL

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
94 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
95 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
96 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
97 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
98 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
99 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
100 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
101 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
102 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
109 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
110 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
111 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
120 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
121 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
122 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
123 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
130 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
131 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
132 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
133 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
134 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
135 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
136 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
137 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.35
Nodule 0
Rhizoplane 0
Rhizosphere 90.48
Stem 0
Stem Tuber 0
Unclassified 14.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_100610448 3300005841 Unclassified 1080
2 JGI24033J26618_1014621 3300002155 Bacteria 962
3 rootL2_10143886 3300003322 Bacteria 1416
4 rootL2_10280658 3300003322 Bacteria 2024
5 rootH1_10015224 3300003323 Bacteria 25733
6 Ga0065712_10001970 3300005290 Bacteria 7695
7 Ga0070676_10069916 3300005328 Bacteria 2105
8 Ga0070676_10396180 3300005328 Bacteria 959
9 Ga0070690_100014240 3300005330 Bacteria 4715
10 Ga0070670_100056333 3300005331 Bacteria 3373
11 Ga0068869_100011711 3300005334 Bacteria 5764
12 Ga0068869_100117962 3300005334 Bacteria 2026
13 Ga0068869_100157168 3300005334 Bacteria 1767
14 Ga0070682_100000060 3300005337 Bacteria 105136
15 Ga0070689_100556811 3300005340 Bacteria 989
16 Ga0070687_100051884 3300005343 Unclassified 2126
17 Ga0070687_100182201 3300005343 Bacteria 1259
18 Ga0070661_100052436 3300005344 Bacteria 2986
19 Ga0070668_100027619 3300005347 Bacteria 4309
20 Ga0070668_100057815 3300005347 Unclassified 2999
21 Ga0070669_100024003 3300005353 Bacteria 4369
22 Ga0070675_100001080 3300005354 Bacteria 19673
23 Ga0070671_100002422 3300005355 Bacteria 14421
24 Ga0070674_100063320 3300005356 Unclassified 2588
25 Ga0070674_100321734 3300005356 Bacteria 1240
26 Ga0070674_100436064 3300005356 Unclassified 1078
27 Ga0070673_100015691 3300005364 Bacteria 5329
28 Ga0070688_100005132 3300005365 Bacteria 6867
29 Ga0070659_100027999 3300005366 Bacteria 4347
30 Ga0070700_100037485 3300005441 Bacteria 2949
31 Ga0070662_100085071 3300005457 Bacteria 2363
32 Ga0068867_100084078 3300005459 Bacteria 2403
33 Ga0068867_100189367 3300005459 Bacteria 1641
34 Ga0070698_100101241 3300005471 Bacteria 2853
35 Ga0068853_100234997 3300005539 Bacteria 1678
36 Ga0068853_100835411 3300005539 Bacteria 883
37 Ga0070672_100129121 3300005543 Bacteria 2076
38 Ga0070686_100034475 3300005544 Bacteria 3119
39 Ga0070664_100069188 3300005564 Bacteria 3020
40 Ga0068857_100010473 3300005577 Bacteria 8059
41 Ga0068857_100090270 3300005577 Bacteria 2742
42 Ga0068857_100131412 3300005577 Bacteria 2258
43 Ga0070702_100084191 3300005615 Bacteria 1912
44 Ga0068852_100000811 3300005616 Bacteria 20584
45 Ga0068852_100511944 3300005616 Bacteria 1196
46 Ga0068859_100026306 3300005617 Bacteria 5833
47 Ga0068859_100803304 3300005617 Bacteria 1028
48 Ga0068866_10011165 3300005718 Bacteria 3876
49 Ga0068861_100267739 3300005719 Bacteria 1466
50 Ga0068861_100553751 3300005719 Unclassified 1048
51 Ga0068870_10004910 3300005840 Bacteria 5789
52 Ga0068858_100540553 3300005842 Bacteria 1128
53 Ga0075366_10160878 3300006195 Bacteria 1361
54 Ga0075366_10374590 3300006195 Bacteria 875
55 Ga0097621_100300335 3300006237 Bacteria 1418
56 Ga0068871_100205390 3300006358 Bacteria 1702
57 Ga0097620_100026306 3300006931 Bacteria 5833
58 Ga0097620_100803363 3300006931 Bacteria 1028
59 Ga0111539_10008708 3300009094 Bacteria 12873
60 Ga0111539_10707053 3300009094 Bacteria 1173
61 Ga0105248_10748186 3300009177 Bacteria 1103
62 Ga0105237_10116291 3300009545 Bacteria 2668
63 Ga0105249_10001595 3300009553 Bacteria 19863
64 Ga0157373_10030605 3300013100 Unclassified 3873
65 Ga0157373_10285984 3300013100 Unclassified 1169
66 Ga0157371_10430387 3300013102 Unclassified 968
67 Ga0157370_10032729 3300013104 Bacteria 5075
68 Ga0157378_10000923 3300013297 Bacteria 27055
69 Ga0157378_10149756 3300013297 Unclassified 2173
70 Ga0163162_10814013 3300013306 Bacteria 1051
71 Ga0157372_10162934 3300013307 Unclassified 2578
72 Ga0157372_10254626 3300013307 Bacteria 2038
73 Ga0157372_10329570 3300013307 Bacteria 1778
74 Ga0157372_10630730 3300013307 Bacteria 1249
75 Ga0157375_10002993 3300013308 Bacteria 14676
76 Ga0157375_10423533 3300013308 Bacteria 1497
77 Ga0163163_10274341 3300014325 Bacteria 1737
78 Ga0157380_10037228 3300014326 Bacteria 3768
79 Ga0157380_10200332 3300014326 Bacteria 1771
80 Ga0157377_10001241 3300014745 Bacteria 10911
81 Ga0163161_10163715 3300017792 Bacteria 1697
82 Ga0163161_10323335 3300017792 Bacteria 1220
83 Ga0207688_10036094 3300025901 Bacteria 2740
84 Ga0207647_10006657 3300025904 Bacteria 8398
85 Ga0207645_10025678 3300025907 Bacteria 3811
86 Ga0207645_10068874 3300025907 Bacteria 2263
87 Ga0207671_10118167 3300025914 Bacteria 2024
88 Ga0207662_10041932 3300025918 Bacteria 2696
89 Ga0207662_10231097 3300025918 Bacteria 1208
90 Ga0207659_10110475 3300025926 Bacteria 2089
91 Ga0207659_10156226 3300025926 Bacteria 1786
92 Ga0207644_10031219 3300025931 Bacteria 3710
93 Ga0207690_10009184 3300025932 Bacteria 5869
94 Ga0207706_10189735 3300025933 Bacteria 1804
95 Ga0207670_10516205 3300025936 Bacteria 972
96 Ga0207669_10069424 3300025937 Bacteria 2205
97 Ga0207691_10227913 3300025940 Bacteria 1614
98 Ga0207691_10532874 3300025940 Bacteria 996
99 Ga0207689_10026003 3300025942 Bacteria 4901
100 Ga0207689_10035347 3300025942 Unclassified 4152
101 Ga0207689_10039238 3300025942 Bacteria 3921
102 Ga0207689_10678526 3300025942 Unclassified 868
103 Ga0207651_10020466 3300025960 Bacteria 3994
104 Ga0207651_10035923 3300025960 Bacteria 3229
105 Ga0207668_10092153 3300025972 Bacteria 2229
106 Ga0207668_10092222 3300025972 Bacteria 2229
107 Ga0207640_10053554 3300025981 Bacteria 2634
108 Ga0207639_10773008 3300026041 Bacteria 894
109 Ga0207708_10029692 3300026075 Bacteria 4144
110 Ga0207641_10603320 3300026088 Unclassified 1075
111 Ga0207648_10001588 3300026089 Bacteria 24911
112 Ga0207648_10211242 3300026089 Bacteria 1723
113 Ga0207648_10229517 3300026089 Bacteria 1651
114 Ga0207676_10307652 3300026095 Bacteria 1449
115 Ga0207674_10103276 3300026116 Bacteria 2830
116 Ga0207674_10127926 3300026116 Bacteria 2505
117 Ga0207675_100168857 3300026118 Bacteria 2090
118 Ga0207683_10109076 3300026121 Bacteria 2477
119 Ga0207698_10001170 3300026142 Bacteria 15290
120 Ga0209999_1003586 3300027543 Unclassified 2779
121 Ga0209974_10041935 3300027876 Bacteria 1524
122 Ga0268265_10057422 3300028380 Bacteria 2966
123 Ga0268264_10460764 3300028381 Bacteria 1233
124 Ga0307513_10312845 3300031456 Bacteria 1332
125 Ga0307413_10285715 3300031824 Unclassified 1243
126 Ga0307407_10121319 3300031903 Unclassified 1658
127 Ga0307416_100556274 3300032002 Unclassified 1221
128 Ga0307411_10093809 3300032005 Bacteria 2103
129 Ga0395900_0349596 3300037418 Bacteria 1452
130 Ga0395905_0002191 3300037471 Bacteria 22056
131 Ga0395905_0314972 3300037471 Bacteria 1454
132 Ga0439436_0004431 3300041404 Bacteria 4301
133 Ga0439439_0007422 3300041406 Bacteria 2565
134 Ga0451851_0713291 3300041507 Bacteria 1346
135 Ga0439442_007688 3300042002 Bacteria 2173
136 Ga0439449_0097257 3300042007 Bacteria 1088
137 Ga0439457_000014 3300042014 Bacteria 36364
138 Ga0439457_020579 3300042014 Bacteria 1464
139 Ga0439462_0004044 3300042015 Bacteria 3558
140 Ga0439462_0005476 3300042015 Unclassified 3130
141 Ga0450897_001827 3300042128 Unclassified 1512
142 Ga0450894_011735 3300042131 Unclassified 1142
143 Ga0439434_0020130 3300042435 Bacteria 2003
144 Ga0451577_0021710 3300042876 Bacteria 5871
145 Ga0451577_0124347 3300042876 Bacteria 2311
146 Ga0451577_0307377 3300042876 Bacteria 1437
147 Ga0453683_0085205 3300044673 Bacteria 1980
148 Ga0453683_0086151 3300044673 Bacteria 1968
149 Ga0453684_0019317 3300044712 Bacteria 10386
150 Ga0453684_0049592 3300044712 Bacteria 5534
151 Ga0453684_0060657 3300044712 Bacteria 4861
152 Ga0453684_0207122 3300044712 Bacteria 2282
153 Ga0466957_0001332 3300044842 Bacteria 12896
154 Ga0466957_0001834 3300044842 Bacteria 11215
155 Ga0451576_0009056 3300045051 Bacteria 11591
156 Ga0451576_0044939 3300045051 Bacteria 4654
157 Ga0495668_0005362 3300046616 Bacteria 8738
158 Ga0495611_0113891 3300046648 Bacteria 1260
159 Ga0495672_0024051 3300047320 Unclassified 3932
160 Ga0495686_0115983 3300047472 Unclassified 1601
161 Ga0501036_0033100 3300049572 Bacteria 4371
162 Ga0501037_0106427 3300049573 Bacteria 2021
163 Ga0501038_0024681 3300049574 Bacteria 5360
164 Ga0501039_0052073 3300049575 Bacteria 3167
165 Ga0501043_0059025 3300049579 Bacteria 3010
166 Ga0501046_0029486 3300049580 Bacteria 4460
167 Ga0501047_0055240 3300049581 Bacteria 3840
168 Ga0501047_0192536 3300049581 Bacteria 1902
169 Ga0501202_003845 3300049652 Bacteria 2593
170 Ga0501206_015962 3300049653 Bacteria 1042
171 Ga0501235_031348 3300049669 Unclassified 1200
172 Ga0501225_0000559 3300049705 Bacteria 11640
173 Ga0501245_004029 3300049708 Bacteria 2010
174 Ga0501080_0552717 3300049742 Bacteria 1025
175 Ga0501035_0026074 3300049822 Bacteria 5353
176 Ga0501044_0004343 3300049823 Bacteria 15878
177 nmdc:mga0k408_16119_c1 3300050493 Bacteria 4141
178 nmdc:mga0k408_173057_c1 3300050493 Unclassified 1287
179 nmdc:mga0k408_91200_c2 3300050493 Bacteria 1421
180 nmdc:mga08y16_9431_c1 3300050511 Bacteria 10235
181 Ga0500644_0055056 3300053088 Unclassified 1379
182 Ga0500641_0036456 3300053096 Bacteria 1967
183 Ga0500559_0044567 3300053136 Bacteria 1941
184 Ga0500568_0001817 3300053139 Bacteria 13149
185 Ga0500604_0025015 3300053151 Bacteria 1714
186 Ga0500616_0171297 3300053153 Unclassified 985
187 Ga0500611_000034 3300053727 Bacteria 78957
188 Ga0466962_0163022 3300061719 Bacteria 1084
189 2738727781 2738541278 Bacteria 9755573
190 Ga0068863_100610448
191 JGI24033J26618_1014621
192 rootL2_10143886
193 rootL2_10280658
194 rootH1_10015224
195 Ga0065712_10001970
196 Ga0070676_10069916
197 Ga0070676_10396180
198 Ga0070690_100014240
199 Ga0070670_100056333
200 Ga0068869_100011711
201 Ga0068869_100117962
202 Ga0068869_100157168
203 Ga0070682_100000060
204 Ga0070689_100556811
205 Ga0070687_100051884
206 Ga0070687_100182201
207 Ga0070661_100052436
208 Ga0070668_100027619
209 Ga0070668_100057815
210 Ga0070669_100024003
211 Ga0070675_100001080
212 Ga0070671_100002422
213 Ga0070674_100063320
214 Ga0070674_100321734
215 Ga0070674_100436064
216 Ga0070673_100015691
217 Ga0070688_100005132
218 Ga0070659_100027999
219 Ga0070700_100037485
220 Ga0070662_100085071
221 Ga0068867_100084078
222 Ga0068867_100189367
223 Ga0070698_100101241
224 Ga0068853_100234997
225 Ga0068853_100835411
226 Ga0070672_100129121
227 Ga0070686_100034475
228 Ga0070664_100069188
229 Ga0068857_100010473
230 Ga0068857_100090270
231 Ga0068857_100131412
232 Ga0070702_100084191
233 Ga0068852_100000811
234 Ga0068852_100511944
235 Ga0068859_100026306
236 Ga0068859_100803304
237 Ga0068866_10011165
238 Ga0068861_100267739
239 Ga0068861_100553751
240 Ga0068870_10004910
241 Ga0068858_100540553
242 Ga0075366_10160878
243 Ga0075366_10374590
244 Ga0097621_100300335
245 Ga0068871_100205390
246 Ga0097620_100026306
247 Ga0097620_100803363
248 Ga0111539_10008708
249 Ga0111539_10707053
250 Ga0105248_10748186
251 Ga0105237_10116291
252 Ga0105249_10001595
253 Ga0157373_10030605
254 Ga0157373_10285984
255 Ga0157371_10430387
256 Ga0157370_10032729
257 Ga0157378_10000923
258 Ga0157378_10149756
259 Ga0163162_10814013
260 Ga0157372_10162934
261 Ga0157372_10254626
262 Ga0157372_10329570
263 Ga0157372_10630730
264 Ga0157375_10002993
265 Ga0157375_10423533
266 Ga0163163_10274341
267 Ga0157380_10037228
268 Ga0157380_10200332
269 Ga0157377_10001241
270 Ga0163161_10163715
271 Ga0163161_10323335
272 Ga0207688_10036094
273 Ga0207647_10006657
274 Ga0207645_10025678
275 Ga0207645_10068874
276 Ga0207671_10118167
277 Ga0207662_10041932
278 Ga0207662_10231097
279 Ga0207659_10110475
280 Ga0207659_10156226
281 Ga0207644_10031219
282 Ga0207690_10009184
283 Ga0207706_10189735
284 Ga0207670_10516205
285 Ga0207669_10069424
286 Ga0207691_10227913
287 Ga0207691_10532874
288 Ga0207689_10026003
289 Ga0207689_10035347
290 Ga0207689_10039238
291 Ga0207689_10678526
292 Ga0207651_10020466
293 Ga0207651_10035923
294 Ga0207668_10092153
295 Ga0207668_10092222
296 Ga0207640_10053554
297 Ga0207639_10773008
298 Ga0207708_10029692
299 Ga0207641_10603320
300 Ga0207648_10001588
301 Ga0207648_10211242
302 Ga0207648_10229517
303 Ga0207676_10307652
304 Ga0207674_10103276
305 Ga0207674_10127926
306 Ga0207675_100168857
307 Ga0207683_10109076
308 Ga0207698_10001170
309 Ga0209999_1003586
310 Ga0209974_10041935
311 Ga0268265_10057422
312 Ga0268264_10460764
313 Ga0307513_10312845
314 Ga0307413_10285715
315 Ga0307407_10121319
316 Ga0307416_100556274
317 Ga0307411_10093809
318 Ga0395900_0349596
319 Ga0395905_0002191
320 Ga0395905_0314972
321 Ga0439436_0004431
322 Ga0439439_0007422
323 Ga0451851_0713291
324 Ga0439442_007688
325 Ga0439449_0097257
326 Ga0439457_000014
327 Ga0439457_020579
328 Ga0439462_0004044
329 Ga0439462_0005476
330 Ga0450897_001827
331 Ga0450894_011735
332 Ga0439434_0020130
333 Ga0451577_0021710
334 Ga0451577_0124347
335 Ga0451577_0307377
336 Ga0453683_0085205
337 Ga0453683_0086151
338 Ga0453684_0019317
339 Ga0453684_0049592
340 Ga0453684_0060657
341 Ga0453684_0207122
342 Ga0466957_0001332
343 Ga0466957_0001834
344 Ga0451576_0009056
345 Ga0451576_0044939
346 Ga0495668_0005362
347 Ga0495611_0113891
348 Ga0495672_0024051
349 Ga0495686_0115983
350 Ga0501036_0033100
351 Ga0501037_0106427
352 Ga0501038_0024681
353 Ga0501039_0052073
354 Ga0501043_0059025
355 Ga0501046_0029486
356 Ga0501047_0055240
357 Ga0501047_0192536
358 Ga0501202_003845
359 Ga0501206_015962
360 Ga0501235_031348
361 Ga0501225_0000559
362 Ga0501245_004029
363 Ga0501080_0552717
364 Ga0501035_0026074
365 Ga0501044_0004343
366 nmdc:mga0k408_16119_c1
367 nmdc:mga0k408_173057_c1
368 nmdc:mga0k408_91200_c2
369 nmdc:mga08y16_9431_c1
370 Ga0500644_0055056
371 Ga0500641_0036456
372 Ga0500559_0044567
373 Ga0500568_0001817
374 Ga0500604_0025015
375 Ga0500616_0171297
376 Ga0500611_000034
377 Ga0466962_0163022
378 2738727781

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10504

DUF2452

Protein of unknown function (DUF2452)

183

287

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qvf-assembly2.cif.gz_C tt_c0855 competence pilin from thermus thermophilus hb27 0.8294 28 64
5iw9-assembly1.cif.gz_B structure of bacteriophage t4 gp25, sheath polymerization initiator 0.7901 29 63
6ru2-assembly1.cif.gz_A crystal structure of glucuronoyl esterase from cerrena unicolor 0.7468 31 70
6rv7-assembly1.cif.gz_A crystal structure of glucuronoyl esterase from cerrena unicolor inactive s270a variant in complex with the aldouronic acid uxxr 0.7363 26 70
3dwq-assembly1.cif.gz_D crystal structure of the a-subunit of the ab5 toxin from e. coli with neu5gc-2,3gal-1,3glcnac 0.7238 31 65
ID Description Score Start End Superfamily
af_P08372_33_104_3.30.1300.30 Alpha Beta;2-Layer Sandwich;Pantoate--beta-alanine Ligase; Chain: A,domain 2;GSPII I/J protein-like 0.901 29 61 3.30.1300.30
af_A1A5V9_1_212_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7931 29 61 3.40.50.300
5iw9B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7901 29 63 3.10.450.40
af_A0A0R0KBM6_49_178_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.733 29 62 3.30.420.10
af_Q4DPA3_509_629_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.7276 102 127 3.40.1110.10
ID Description Score Start End GO Terms
AF-A0A2A4XTX6-F1-model_v4 Lipocalin-like domain-containing protein 0.9758 5 136
AF-A0A537HQX8-F1-model_v4 DUF2452 domain-containing protein 0.971 160 262
AF-A0A3C0R7A2-F1-model_v4 DUF2452 domain-containing protein 0.9668 182 262
AF-A0A3C1LF52-F1-model_v4 DUF2452 domain-containing protein 0.9643 192 262
AF-A0A537HQX8-F1-model_v4 DUF2452 domain-containing protein 0.953 160 262

Map