F291099

General Info

Members Datasets Scaffolds Average Seq Length
189 136 189 508

Family's Representative Sequence

Representative Sequence 3300025960|Ga0207651_10008165|Ga0207651_100081654
Length 497
Sequence MNPSTDLPLDRPFADRAPQREVLVQDRPTLGSMPRTRRGIGWWLVPLIDLVSSSVSRGGEDGMAWPVIRLLAAALFAWSASLLSGIDGGEQLILWGGFIALDTVARRLGDPLFRRLDPGERWVLVGDDATAQRLRAYEPLRAYAGIVATVPPNGDDTQAAARVAALEVVDRYRADRVVIASQHADDDGLLELVRAFKSIGVPVSLLPRPLDLLEAPAVTQSQVGGVPLIEVGALAARDSVPYTGPDRRSRKTKISVVVPAMNEERNIGHVLRCLPEGLHEVILVDGNSADGTIEAAERALPGIRVLSQSGRGKGDAFRTGFAAVTGNLVVMLDADGSADPAEIPRFVEALEGGADFAKGSRFLPGGGSADITRLRGLGNTFLSGTANLLHGTHFTDLCYGYNAFWARCLPFISLDVPGFEVETLINLRIAGAGMKITEVPSYEADRIHGQSNLNTFRDGFRVLGTILRETRRRRSIQPERPAVEAQQKKTKAAATAA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
67 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
68 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
69 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
70 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
71 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
72 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
73 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
74 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
75 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
76 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
77 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
78 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
79 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
80 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
81 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
82 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
83 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
84 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
85 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
86 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
87 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
88 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
89 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
90 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
91 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
92 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
93 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
94 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
95 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
96 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
97 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
98 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
99 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
100 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
101 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
102 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
103 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
104 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
105 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
106 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
113 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
116 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
117 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
118 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
119 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
120 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
121 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
122 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
130 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
131 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
132 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
133 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
134 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
135 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
136 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.59
Nodule 0
Rhizoplane 13.76
Rhizosphere 79.89
Stem 0
Stem Tuber 0
Unclassified 4.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002984 3300001979 Bacteria 7492
2 Ga0070658_10102174 3300005327 Bacteria 2371
3 Ga0070683_100002880 3300005329 Bacteria 13782
4 Ga0070683_100007773 3300005329 Bacteria 9080
5 Ga0070683_100015776 3300005329 Bacteria 6642
6 Ga0070690_100042576 3300005330 Bacteria 2877
7 Ga0070677_10000131 3300005333 Bacteria 24829
8 Ga0070666_10005816 3300005335 Bacteria 7579
9 Ga0070666_10094582 3300005335 Bacteria 2056
10 Ga0070682_100000013 3300005337 Bacteria 254641
11 Ga0068868_100000541 3300005338 Bacteria 25367
12 Ga0070661_100000344 3300005344 Bacteria 36955
13 Ga0070674_100000056 3300005356 Bacteria 49642
14 Ga0070688_100000256 3300005365 Bacteria 27953
15 Ga0070659_100021766 3300005366 Bacteria 4888
16 Ga0070667_100016235 3300005367 Bacteria 6161
17 Ga0070713_100000186 3300005436 Bacteria 41000
18 Ga0070678_100006343 3300005456 Bacteria 6938
19 Ga0068867_100002511 3300005459 Bacteria 12903
20 Ga0070685_10000355 3300005466 Bacteria 27953
21 Ga0070679_100000068 3300005530 Bacteria 77184
22 Ga0070684_100014993 3300005535 Bacteria 6295
23 Ga0070684_100017930 3300005535 Bacteria 5820
24 Ga0068853_100000972 3300005539 Bacteria 20161
25 Ga0070665_100000106 3300005548 Bacteria 157315
26 Ga0070665_100000501 3300005548 Bacteria 56135
27 Ga0070665_100002351 3300005548 Bacteria 20915
28 Ga0068855_100052986 3300005563 Bacteria 4775
29 Ga0068852_100163078 3300005616 Bacteria 2083
30 Ga0068866_10000001 3300005718 Bacteria 519680
31 Ga0068866_10003764 3300005718 Bacteria 6218
32 Ga0068863_100001363 3300005841 Bacteria 24294
33 Ga0068863_100014333 3300005841 Bacteria 7635
34 Ga0068858_100000009 3300005842 Bacteria 237748
35 Ga0070715_10000001 3300006163 Bacteria 693690
36 Ga0075433_10001323 3300006852 Bacteria 18133
37 Ga0105245_10000835 3300009098 Bacteria 28064
38 Ga0105245_10001339 3300009098 Bacteria 22307
39 Ga0105247_10000628 3300009101 Bacteria 28197
40 Ga0105238_10000011 3300009551 Bacteria 261080
41 Ga0105249_10000203 3300009553 Bacteria 67783
42 Ga0105239_10012026 3300010375 Bacteria 9651
43 Ga0157374_10009554 3300013296 Bacteria 8330
44 Ga0157378_10003549 3300013297 Bacteria 13820
45 Ga0157378_10143936 3300013297 Bacteria 2216
46 Ga0163163_10199401 3300014325 Bacteria 2050
47 Ga0163161_10000357 3300017792 Bacteria 38514
48 Ga0207682_10000005 3300025893 Bacteria 95617
49 Ga0207642_10000002 3300025899 Bacteria 658166
50 Ga0207710_10000239 3300025900 Bacteria 46663
51 Ga0207680_10003136 3300025903 Bacteria 7761
52 Ga0207680_10018477 3300025903 Bacteria 3707
53 Ga0207685_10000027 3300025905 Bacteria 102101
54 Ga0207649_10000009 3300025920 Bacteria 295544
55 Ga0207652_10000044 3300025921 Bacteria 127779
56 Ga0207694_10000004 3300025924 Bacteria 967075
57 Ga0207687_10000013 3300025927 Bacteria 299826
58 Ga0207687_10001581 3300025927 Bacteria 15684
59 Ga0207700_10000027 3300025928 Bacteria 137708
60 Ga0207690_10006715 3300025932 Bacteria 6817
61 Ga0207686_10000048 3300025934 Bacteria 115595
62 Ga0207686_10000886 3300025934 Bacteria 18081
63 Ga0207669_10000018 3300025937 Bacteria 114254
64 Ga0207661_10000139 3300025944 Bacteria 45892
65 Ga0207661_10003835 3300025944 Bacteria 10482
66 Ga0207661_10005248 3300025944 Bacteria 9113
67 Ga0207679_10012839 3300025945 Bacteria 5477
68 Ga0207667_10182027 3300025949 Bacteria 2158
69 Ga0207651_10008165 3300025960 Bacteria 5635
70 Ga0207712_10000007 3300025961 Bacteria 539589
71 Ga0207668_10110282 3300025972 Bacteria 2063
72 Ga0207658_10020763 3300025986 Bacteria 4550
73 Ga0207677_10000340 3300026023 Bacteria 33455
74 Ga0207703_10000023 3300026035 Bacteria 222018
75 Ga0207639_10002385 3300026041 Bacteria 12611
76 Ga0207641_10000405 3300026088 Bacteria 50517
77 Ga0207641_10011512 3300026088 Bacteria 7261
78 Ga0207648_10013844 3300026089 Bacteria 7482
79 Ga0207683_10089226 3300026121 Bacteria 2744
80 Ga0268266_10000047 3300028379 Bacteria 310996
81 Ga0268266_10000285 3300028379 Bacteria 83300
82 Ga0268266_10000640 3300028379 Bacteria 47545
83 Ga0268264_10007697 3300028381 Bacteria 8974
84 Ga0451853_3536374 3300041512 Bacteria 3503
85 Ga0466963_0000001 3300044694 Bacteria 110556
86 Ga0495603_0000016 3300046455 Bacteria 67399
87 Ga0495603_0001366 3300046455 Bacteria 14180
88 Ga0495629_0000381 3300046459 Bacteria 37177
89 Ga0495641_0000110 3300046461 Bacteria 57683
90 Ga0495653_0092761 3300046463 Bacteria 2204
91 Ga0495582_0000081 3300046473 Bacteria 48557
92 Ga0495662_0000019 3300046476 Bacteria 55148
93 Ga0495606_0000565 3300046507 Bacteria 58752
94 Ga0495608_0000125 3300046511 Bacteria 54881
95 Ga0495608_0003724 3300046511 Bacteria 10955
96 Ga0495618_0000129 3300046514 Bacteria 54912
97 Ga0495620_0000436 3300046515 Bacteria 27894
98 Ga0495628_0111808 3300046516 Bacteria 2100
99 Ga0495630_0000020 3300046517 Bacteria 176389
100 Ga0495630_0001524 3300046517 Bacteria 16049
101 Ga0495630_0003550 3300046517 Bacteria 10861
102 Ga0495630_0008658 3300046517 Bacteria 7304
103 Ga0495630_0054103 3300046517 Bacteria 3007
104 Ga0495640_0004330 3300046533 Bacteria 11332
105 Ga0495586_0000161 3300046535 Bacteria 43544
106 Ga0495667_0000018 3300046559 Bacteria 188610
107 Ga0495634_0000561 3300046642 Bacteria 36353
108 Ga0495635_0000044 3300046663 Bacteria 83945
109 Ga0495588_0000340 3300046674 Bacteria 30427
110 Ga0495657_0000004 3300046675 Bacteria 266465
111 Ga0495657_0011598 3300046675 Bacteria 6585
112 Ga0495599_0008695 3300046678 Bacteria 6181
113 Ga0495647_0000018 3300046681 Bacteria 81701
114 Ga0495647_0000335 3300046681 Bacteria 13187
115 Ga0495658_0000034 3300046683 Bacteria 69176
116 Ga0495669_0000033 3300046684 Bacteria 98629
117 Ga0495613_0000179 3300046689 Bacteria 62109
118 Ga0495624_0000073 3300046690 Bacteria 65582
119 Ga0495624_0000097 3300046690 Bacteria 58715
120 Ga0495670_0007926 3300046691 Bacteria 5221
121 Ga0495649_0009668 3300046694 Bacteria 5716
122 Ga0495600_0002104 3300046809 Bacteria 11260
123 Ga0495600_0065880 3300046809 Bacteria 2368
124 Ga0495604_0000055 3300047317 Bacteria 100430
125 Ga0495604_0000137 3300047317 Bacteria 62542
126 Ga0495604_0003579 3300047317 Bacteria 12385
127 Ga0495676_0002777 3300047321 Bacteria 15738
128 Ga0495676_0030604 3300047321 Bacteria 4564
129 Ga0495680_0001693 3300047322 Bacteria 23412
130 Ga0495680_0003149 3300047322 Bacteria 16432
131 Ga0495680_0005380 3300047322 Bacteria 12069
132 Ga0495675_0000175 3300047444 Bacteria 46609
133 Ga0495602_0000041 3300048088 Bacteria 126954
134 Ga0496100_0000002 3300048903 Bacteria 489057
135 Ga0496101_0000001 3300048904 Bacteria 489057
136 Ga0496102_0000039 3300048905 Bacteria 198306
137 Ga0496102_0044652 3300048905 Bacteria 4022
138 Ga0496103_0000008 3300048906 Bacteria 340474
139 Ga0496104_0000004 3300048907 Bacteria 641830
140 Ga0496104_0000009 3300048907 Bacteria 488055
141 Ga0496104_0026475 3300048907 Bacteria 5356
142 Ga0496104_0036310 3300048907 Bacteria 4607
143 Ga0496105_0000001 3300048908 Bacteria 1328178
144 Ga0496105_0000007 3300048908 Bacteria 339658
145 Ga0496105_0011953 3300048908 Bacteria 6875
146 Ga0496105_0025642 3300048908 Bacteria 4801
147 Ga0496106_0000110 3300048909 Bacteria 63946
148 Ga0496106_0000312 3300048909 Bacteria 34208
149 Ga0496107_0000003 3300048910 Bacteria 304038
150 Ga0496107_0028995 3300048910 Bacteria 3936
151 Ga0496108_0000001 3300048911 Bacteria 919044
152 Ga0496108_0170316 3300048911 Bacteria 1884
153 Ga0496109_0000003 3300048912 Bacteria 420862
154 Ga0496109_0009604 3300048912 Bacteria 8250
155 Ga0496109_0079177 3300048912 Bacteria 3027
156 Ga0496110_0014930 3300048913 Bacteria 6456
157 Ga0496111_0040570 3300048914 Bacteria 3339
158 Ga0496113_0014489 3300048916 Bacteria 5381
159 Ga0496115_0010763 3300048918 Bacteria 6841
160 Ga0496117_0001757 3300048920 Bacteria 29817
161 Ga0496118_0000550 3300048921 Bacteria 61734
162 Ga0496119_0009440 3300048922 Bacteria 8373
163 Ga0496121_0018742 3300048924 Bacteria 6959
164 Ga0496124_0013538 3300048927 Bacteria 7954
165 Ga0496125_0021489 3300048928 Bacteria 6020
166 Ga0496125_0058448 3300048928 Bacteria 3115
167 Ga0496126_0065062 3300048929 Bacteria 3264
168 Ga0501042_0104991 3300049578 Bacteria 2033
169 Ga0501070_0094224 3300049586 Bacteria 2477
170 Ga0501071_0014739 3300049587 Bacteria 5350
171 Ga0501079_0047479 3300049741 Bacteria 3312
172 Ga0501080_0096372 3300049742 Bacteria 2746
173 Ga0501083_0003153 3300049744 Bacteria 11474
174 Ga0501044_0004142 3300049823 Bacteria 16282
175 nmdc:mga0a205_1451_c1 3300050515 Bacteria 20201
176 Ga0495601_0000013 3300053077 Bacteria 226476
177 Ga0495601_0000264 3300053077 Bacteria 28275
178 Ga0495601_0000364 3300053077 Bacteria 23907
179 Ga0495655_0000001 3300053083 Bacteria 419518
180 Ga0495595_0000003 3300053084 Bacteria 266465
181 Ga0495595_0000053 3300053084 Bacteria 59851
182 Ga0495595_0002717 3300053084 Bacteria 6939
183 Ga0495619_0000116 3300053085 Bacteria 58748
184 Ga0495619_0001012 3300053085 Bacteria 18401
185 Ga0495619_0005767 3300053085 Bacteria 7847
186 Ga0495619_0005899 3300053085 Bacteria 7761
187 Ga0500566_0005397 3300053094 Bacteria 7603
188 Ga0500614_016697 3300053123 Bacteria 1650
189 Ga0500628_000010 3300053129 Bacteria 122210

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046511 Ga0495608_0000125 Ga0495608_0000125_32488_33996 455
2 3300046517 Ga0495630_0001524 Ga0495630_0001524_9782_11260 455
3 3300046675 Ga0495657_0000004 Ga0495657_0000004_155909_157417 455
4 3300047444 Ga0495675_0000175 Ga0495675_0000175_3871_5379 455
5 3300053084 Ga0495595_0000003 Ga0495595_0000003_155909_157417 455
6 3300053085 Ga0495619_0000116 Ga0495619_0000116_2676_4184 455
7 3300005616 Ga0068852_100163078 Ga0068852_1001630782 458
8 3300047317 Ga0495604_0003579 Ga0495604_0003579_10301_11806 458
9 3300048088 Ga0495602_0000041 Ga0495602_0000041_92302_93807 458
10 3300048907 Ga0496104_0036310 Ga0496104_0036310_81_1586 458
11 3300053084 Ga0495595_0002717 Ga0495595_0002717_3072_4577 458
12 3300053123 Ga0500614_016697 Ga0500614_016697_175_1605 459
13 3300025972 Ga0207668_10110282 Ga0207668_101102821 462
14 3300005366 Ga0070659_100021766 Ga0070659_1000217663 463
15 3300025932 Ga0207690_10006715 Ga0207690_100067154 463
16 3300047317 Ga0495604_0000137 Ga0495604_0000137_31670_33184 465
17 3300046476 Ga0495662_0000019 Ga0495662_0000019_31176_32657 466
18 3300046689 Ga0495613_0000179 Ga0495613_0000179_56492_58009 470
19 3300053077 Ga0495601_0000013 Ga0495601_0000013_50310_51827 470
20 3300046809 Ga0495600_0065880 Ga0495600_0065880_784_2295 471
21 3300005436 Ga0070713_100000186 Ga0070713_10000018628 472
22 3300046533 Ga0495640_0004330 Ga0495640_0004330_4504_5982 472
23 3300048908 Ga0496105_0025642 Ga0496105_0025642_941_2425 472
24 3300046809 Ga0495600_0002104 Ga0495600_0002104_4997_6520 475
25 3300048916 Ga0496113_0014489 Ga0496113_0014489_645_2183 475
26 3300049578 Ga0501042_0104991 Ga0501042_0104991_484_2007 475
27 3300014325 Ga0163163_10199401 Ga0163163_101994011 479
28 3300006852 Ga0075433_10001323 Ga0075433_1000132310 481
29 3300050515 nmdc:mga0a205_1451_c1 nmdc:mga0a205_1451_c1_3794_5407 481
30 3300048918 Ga0496115_0010763 Ga0496115_0010763_2198_3712 482
31 3300005338 Ga0068868_100000541 Ga0068868_1000005415 484
32 3300046455 Ga0495603_0000016 Ga0495603_0000016_11410_12936 484
33 3300046473 Ga0495582_0000081 Ga0495582_0000081_23245_24759 484
34 3300046559 Ga0495667_0000018 Ga0495667_0000018_111406_112926 484
35 3300046683 Ga0495658_0000034 Ga0495658_0000034_25745_27259 484
36 3300047322 Ga0495680_0005380 Ga0495680_0005380_99_1619 484
37 3300053094 Ga0500566_0005397 Ga0500566_0005397_5859_7385 484
38 3300005718 Ga0068866_10003764 Ga0068866_100037645 485
39 3300025934 Ga0207686_10000048 Ga0207686_1000004872 485
40 3300046690 Ga0495624_0000073 Ga0495624_0000073_3782_5389 490
41 3300048912 Ga0496109_0079177 Ga0496109_0079177_118_1659 490
42 3300048913 Ga0496110_0014930 Ga0496110_0014930_2191_3732 490
43 3300005327 Ga0070658_10102174 Ga0070658_101021742 491
44 3300046463 Ga0495653_0092761 Ga0495653_0092761_91_1779 491
45 3300046517 Ga0495630_0003550 Ga0495630_0003550_8488_10176 491
46 3300046675 Ga0495657_0011598 Ga0495657_0011598_1971_3659 491
47 3300053077 Ga0495601_0000364 Ga0495601_0000364_20584_22272 491
48 3300005548 Ga0070665_100002351 Ga0070665_1000023512 492
49 3300028379 Ga0268266_10000640 Ga0268266_1000064028 492
50 3300046517 Ga0495630_0000020 Ga0495630_0000020_33826_35433 492
51 3300047317 Ga0495604_0000055 Ga0495604_0000055_40357_41925 492
52 3300048903 Ga0496100_0000002 Ga0496100_0000002_381987_383606 493
53 3300048904 Ga0496101_0000001 Ga0496101_0000001_381987_383606 493
54 3300048909 Ga0496106_0000110 Ga0496106_0000110_30757_32376 493
55 3300048910 Ga0496107_0000003 Ga0496107_0000003_30730_32349 493
56 3300005365 Ga0070688_100000256 Ga0070688_10000025621 494
57 3300005466 Ga0070685_10000355 Ga0070685_1000035521 494
58 3300005539 Ga0068853_100000972 Ga0068853_10000097211 494
59 3300026041 Ga0207639_10002385 Ga0207639_100023852 494
60 3300046459 Ga0495629_0000381 Ga0495629_0000381_32372_33979 495
61 3300005456 Ga0070678_100006343 Ga0070678_1000063433 496
62 3300005563 Ga0068855_100052986 Ga0068855_1000529861 496
63 3300025949 Ga0207667_10182027 Ga0207667_101820272 496
64 3300025960 Ga0207651_10008165 Ga0207651_100081654 496
65 3300048914 Ga0496111_0040570 Ga0496111_0040570_1603_3210 496
66 3300048907 Ga0496104_0000009 Ga0496104_0000009_269306_270922 498
67 3300048908 Ga0496105_0000007 Ga0496105_0000007_217134_218750 498
68 3300049586 Ga0501070_0094224 Ga0501070_0094224_56_1681 498
69 3300049587 Ga0501071_0014739 Ga0501071_0014739_389_2014 498
70 3300049741 Ga0501079_0047479 Ga0501079_0047479_1505_3130 498
71 3300049742 Ga0501080_0096372 Ga0501080_0096372_900_2525 498
72 3300049744 Ga0501083_0003153 Ga0501083_0003153_8080_9705 498
73 3300049823 Ga0501044_0004142 Ga0501044_0004142_3582_5207 498
74 3300005329 Ga0070683_100002880 Ga0070683_1000028805 499
75 3300010375 Ga0105239_10012026 Ga0105239_100120265 499
76 3300025944 Ga0207661_10000139 Ga0207661_1000013928 499
77 3300046507 Ga0495606_0000565 Ga0495606_0000565_3589_5202 499
78 3300048905 Ga0496102_0000039 Ga0496102_0000039_39871_41442 499
79 3300048906 Ga0496103_0000008 Ga0496103_0000008_161126_162697 499
80 3300005333 Ga0070677_10000131 Ga0070677_100001318 500
81 3300025893 Ga0207682_10000005 Ga0207682_100000053 500
82 3300046681 Ga0495647_0000335 Ga0495647_0000335_8184_9791 500
83 3300048909 Ga0496106_0000312 Ga0496106_0000312_28477_30096 500
84 3300026121 Ga0207683_10089226 Ga0207683_100892262 501
85 3300028381 Ga0268264_10007697 Ga0268264_100076975 501
86 3300046516 Ga0495628_0111808 Ga0495628_0111808_339_1958 501
87 3300046517 Ga0495630_0008658 Ga0495630_0008658_4661_6280 501
88 3300046517 Ga0495630_0054103 Ga0495630_0054103_755_2377 501
89 3300048911 Ga0496108_0000001 Ga0496108_0000001_704590_706206 501
90 3300048912 Ga0496109_0000003 Ga0496109_0000003_379136_380752 501
91 3300048928 Ga0496125_0021489 Ga0496125_0021489_4123_5739 501
92 3300005330 Ga0070690_100042576 Ga0070690_1000425763 502
93 3300005335 Ga0070666_10094582 Ga0070666_100945821 502
94 3300005344 Ga0070661_100000344 Ga0070661_1000003442 502
95 3300005548 Ga0070665_100000106 Ga0070665_10000010658 502
96 3300005841 Ga0068863_100001363 Ga0068863_10000136315 502
97 3300005842 Ga0068858_100000009 Ga0068858_100000009213 502
98 3300025903 Ga0207680_10018477 Ga0207680_100184774 502
99 3300025920 Ga0207649_10000009 Ga0207649_10000009251 502
100 3300026035 Ga0207703_10000023 Ga0207703_10000023120 502
101 3300026088 Ga0207641_10000405 Ga0207641_100004056 502
102 3300028379 Ga0268266_10000047 Ga0268266_10000047210 502
103 3300046455 Ga0495603_0001366 Ga0495603_0001366_5343_6965 502
104 3300046515 Ga0495620_0000436 Ga0495620_0000436_1634_3256 502
105 3300046678 Ga0495599_0008695 Ga0495599_0008695_3692_5317 502
106 3300048905 Ga0496102_0044652 Ga0496102_0044652_942_2519 502
107 3300048920 Ga0496117_0001757 Ga0496117_0001757_20782_22359 502
108 3300048921 Ga0496118_0000550 Ga0496118_0000550_51658_53235 502
109 3300005841 Ga0068863_100014333 Ga0068863_1000143333 503
110 3300009551 Ga0105238_10000011 Ga0105238_10000011197 503
111 3300025924 Ga0207694_10000004 Ga0207694_10000004425 503
112 3300025928 Ga0207700_10000027 Ga0207700_1000002769 503
113 3300026088 Ga0207641_10011512 Ga0207641_100115122 503
114 3300044694 Ga0466963_0000001 Ga0466963_0000001_4953_6575 503
115 3300046690 Ga0495624_0000097 Ga0495624_0000097_38295_39914 504
116 3300005329 Ga0070683_100007773 Ga0070683_1000077733 505
117 3300025944 Ga0207661_10005248 Ga0207661_100052483 505
118 3300046514 Ga0495618_0000129 Ga0495618_0000129_12630_14249 506
119 3300047322 Ga0495680_0003149 Ga0495680_0003149_1666_3276 506
120 3300048907 Ga0496104_0026475 Ga0496104_0026475_2410_4047 506
121 3300048908 Ga0496105_0011953 Ga0496105_0011953_3426_5063 506
122 3300048910 Ga0496107_0028995 Ga0496107_0028995_1428_3065 506
123 3300048922 Ga0496119_0009440 Ga0496119_0009440_5643_7280 506
124 3300048924 Ga0496121_0018742 Ga0496121_0018742_483_2120 506
125 3300048928 Ga0496125_0058448 Ga0496125_0058448_1122_2759 506
126 3300005337 Ga0070682_100000013 Ga0070682_10000001324 507
127 3300009553 Ga0105249_10000203 Ga0105249_1000020352 507
128 3300025961 Ga0207712_10000007 Ga0207712_10000007389 507
129 3300046684 Ga0495669_0000033 Ga0495669_0000033_45130_46749 507
130 3300005356 Ga0070674_100000056 Ga0070674_10000005632 508
131 3300005535 Ga0070684_100017930 Ga0070684_1000179304 508
132 3300005718 Ga0068866_10000001 Ga0068866_10000001397 508
133 3300006163 Ga0070715_10000001 Ga0070715_10000001365 508
134 3300025899 Ga0207642_10000002 Ga0207642_10000002117 508
135 3300025905 Ga0207685_10000027 Ga0207685_1000002757 508
136 3300025937 Ga0207669_10000018 Ga0207669_1000001830 508
137 3300046461 Ga0495641_0000110 Ga0495641_0000110_18121_19749 508
138 3300047321 Ga0495676_0002777 Ga0495676_0002777_13895_15520 508
139 3300053085 Ga0495619_0005767 Ga0495619_0005767_311_1921 509
140 3300053077 Ga0495601_0000264 Ga0495601_0000264_20364_21989 510
141 3300046535 Ga0495586_0000161 Ga0495586_0000161_18122_19735 511
142 3300005459 Ga0068867_100002511 Ga0068867_1000025116 512
143 3300026089 Ga0207648_10013844 Ga0207648_100138442 512
144 3300046663 Ga0495635_0000044 Ga0495635_0000044_57781_59391 512
145 3300047322 Ga0495680_0001693 Ga0495680_0001693_11692_13314 512
146 3300005335 Ga0070666_10005816 Ga0070666_100058165 513
147 3300005367 Ga0070667_100016235 Ga0070667_1000162353 513
148 3300005548 Ga0070665_100000501 Ga0070665_10000050119 513
149 3300025903 Ga0207680_10003136 Ga0207680_100031363 513
150 3300025986 Ga0207658_10020763 Ga0207658_100207633 513
151 3300028379 Ga0268266_10000285 Ga0268266_1000028533 513
152 3300046511 Ga0495608_0003724 Ga0495608_0003724_7523_9133 513
153 3300048927 Ga0496124_0013538 Ga0496124_0013538_2317_3954 513
154 3300048929 Ga0496126_0065062 Ga0496126_0065062_1137_2774 513
155 3300053084 Ga0495595_0000053 Ga0495595_0000053_14489_16099 513
156 3300046691 Ga0495670_0007926 Ga0495670_0007926_2932_4542 514
157 3300005329 Ga0070683_100015776 Ga0070683_1000157764 515
158 3300005535 Ga0070684_100014993 Ga0070684_1000149931 515
159 3300009098 Ga0105245_10000835 Ga0105245_1000083514 515
160 3300009098 Ga0105245_10001339 Ga0105245_100013399 515
161 3300013297 Ga0157378_10003549 Ga0157378_100035495 515
162 3300017792 Ga0163161_10000357 Ga0163161_100003578 515
163 3300025927 Ga0207687_10000013 Ga0207687_1000001335 515
164 3300025927 Ga0207687_10001581 Ga0207687_100015819 515
165 3300025944 Ga0207661_10003835 Ga0207661_100038358 515
166 3300025945 Ga0207679_10012839 Ga0207679_100128392 515
167 3300026023 Ga0207677_10000340 Ga0207677_1000034011 515
168 3300046674 Ga0495588_0000340 Ga0495588_0000340_5020_6630 515
169 3300047321 Ga0495676_0030604 Ga0495676_0030604_2627_4246 515
170 3300048911 Ga0496108_0170316 Ga0496108_0170316_45_1658 515
171 3300048912 Ga0496109_0009604 Ga0496109_0009604_214_1821 515
172 3300053085 Ga0495619_0001012 Ga0495619_0001012_15035_16723 515
173 3300005530 Ga0070679_100000068 Ga0070679_10000006863 516
174 3300013296 Ga0157374_10009554 Ga0157374_100095546 516
175 3300025921 Ga0207652_10000044 Ga0207652_1000004466 516
176 3300041512 Ga0451853_3536374 Ga0451853_3536374_1426_3048 516
177 3300046642 Ga0495634_0000561 Ga0495634_0000561_11910_13532 516
178 3300046681 Ga0495647_0000018 Ga0495647_0000018_56885_58504 516
179 3300046694 Ga0495649_0009668 Ga0495649_0009668_121_1743 516
180 3300053083 Ga0495655_0000001 Ga0495655_0000001_232891_234516 516
181 3300053085 Ga0495619_0005899 Ga0495619_0005899_1800_3494 516
182 3300053129 Ga0500628_000010 Ga0500628_000010_107092_108717 516
183 3300009101 Ga0105247_10000628 Ga0105247_100006282 517
184 3300025900 Ga0207710_10000239 Ga0207710_1000023910 517
185 3300025934 Ga0207686_10000886 Ga0207686_1000088613 517
186 3300013297 Ga0157378_10143936 Ga0157378_101439362 518
187 3300048907 Ga0496104_0000004 Ga0496104_0000004_325276_326895 518
188 3300048908 Ga0496105_0000001 Ga0496105_0000001_314936_316555 518
189 3300001979 JGI24740J21852_10002984 JGI24740J21852_100029842 519

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

255

408

0.88

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

251

401

0.81

Feature Viewer

pLDDT pTM Quality
55.13 0.39 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map