F291176

General Info

Members Datasets Scaffolds Average Seq Length
189 153 170 202

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100120467|Ga0307408_1001204672
Length 218
Sequence MPSRFRNRTGDTGPMWRTLELAGADLRFDPHFLADGEAAEAFAALRDSLPWSVHRIRLFGREVDSPRLSAWLGEPGASYRYSGTRFEPHPWTPALRALRDRVAFAAGVEFNSVLANRYRSGADHMGWHSDDEPELGPEPVIASLSLGATRRFRLRHRRGDPALAIDLPPGSLLVMRGQTQRLYRHALPRTARPVGERLNLTFRWIRPVPAGAGRQGRA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
3 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
4 2643221593 Lysobacter sp. Root690 Isolate Unclassified
5 2739367700 Dyella sp. YR388 Isolate Unclassified
6 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
7 2818991457 Xanthomonas translucens 569 Isolate Unclassified
8 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
9 2884411467 Dyella sp. AD56 Isolate Rhizosphere
10 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
11 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
12 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
13 2928963466 Dyella japonica 1073 Isolate Unclassified
14 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
15 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
16 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
17 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
18 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
19 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
20 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
21 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
22 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
25 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
28 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
31 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
34 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
35 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
53 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
60 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
61 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
62 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
65 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
68 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
70 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
111 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
112 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
113 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
114 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
115 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
116 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
117 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
118 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
119 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
120 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
121 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
122 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
127 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
131 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
132 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
138 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
139 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
140 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
143 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
144 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
148 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
149 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
150 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
151 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
152 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
153 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.95
Metatranscriptomes 0
Isolates 10.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.75
Nodule 0
Rhizoplane 5.29
Rhizosphere 56.08
Stem 0
Stem Tuber 0
Unclassified 15.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_372769 2162886007 Bacteria 8162
2 SwRhRL2b_contig_944407 2162886007 Bacteria 2626
3 JGI25162J39368_1001798 3300002737 Bacteria 10104
4 JGI25164J39214_1007660 3300002772 Bacteria 1093
5 JGI25152J39213_1000025 3300002773 Bacteria 103262
6 JGI25150J39212_1000066 3300002774 Bacteria 63677
7 JGI25151J46595_10000048 3300003187 Bacteria 166842
8 JGI25151J46595_10000139 3300003187 Bacteria 96000
9 JGI25153J46596_10000101 3300003215 Bacteria 96639
10 rootH2_10119747 3300003320 Bacteria 1141
11 rootL2_10075803 3300003322 Bacteria 4235
12 Ga0055542_1000069 3300003762 Bacteria 148278
13 Ga0055526_1000005 3300003771 Bacteria 344542
14 Ga0055537_1000155 3300003773 Bacteria 51676
15 Ga0055524_1000005 3300003775 Bacteria 344542
16 Ga0055536_1001044 3300003781 Bacteria 17503
17 Ga0055534_1000002 3300003784 Bacteria 390762
18 Ga0055528_1000002 3300003790 Bacteria 368879
19 Ga0058692_1000026 3300003856 Bacteria 203096
20 Ga0058692_1000040 3300003856 Bacteria 132805
21 Ga0065704_10001079 3300005289 Bacteria 10025
22 Ga0065704_10070252 3300005289 Bacteria 48050
23 Ga0065715_10193267 3300005293 Bacteria 1402
24 Ga0070670_100000703 3300005331 Bacteria 25979
25 Ga0068869_100040514 3300005334 Bacteria 3331
26 Ga0070682_100320178 3300005337 Bacteria 1145
27 Ga0070661_100005371 3300005344 Bacteria 8832
28 Ga0070669_100174043 3300005353 Bacteria 1680
29 Ga0070669_100472531 3300005353 Bacteria 1036
30 Ga0070667_100063914 3300005367 Bacteria 3121
31 Ga0070665_100183660 3300005548 Bacteria 2092
32 Ga0068862_100000379 3300005844 Bacteria 48327
33 Ga0068862_100060730 3300005844 Bacteria 3248
34 Ga0081539_10007672 3300005985 Bacteria 9701
35 Ga0075363_100357040 3300006048 Bacteria 854
36 Ga0075364_10009249 3300006051 Bacteria 5907
37 Ga0105251_10000137 3300009011 Bacteria 74569
38 Ga0105243_10002790 3300009148 Bacteria 14512
39 Ga0105237_10248376 3300009545 Unclassified 1781
40 Ga0105238_10064859 3300009551 Bacteria 3652
41 Ga0105249_11335338 3300009553 Bacteria 789
42 Ga0105032_101629 3300009979 Bacteria 2038
43 Ga0105028_100356 3300009993 Bacteria 4910
44 Ga0157374_10038034 3300013296 Bacteria 4421
45 Ga0157378_10133713 3300013297 Bacteria 2298
46 Ga0163162_10181888 3300013306 Bacteria 2228
47 Ga0163162_11339100 3300013306 Bacteria 814
48 Ga0157375_10474376 3300013308 Bacteria 1416
49 Ga0157376_10019218 3300014969 Bacteria 5260
50 Ga0182006_1014274 3300015261 Bacteria 3427
51 Ga0182006_1036991 3300015261 Bacteria 1938
52 Ga0182005_1016793 3300015265 Bacteria 2031
53 Ga0183360_10001 3300015689 Bacteria 3943671
54 Ga0209566_106295 3300025225 Bacteria 1413
55 Ga0209672_101611 3300025228 Bacteria 7542
56 Ga0207427_100893 3300025231 Bacteria 12962
57 Ga0209437_100113 3300025233 Bacteria 211240
58 Ga0209258_105711 3300025242 Bacteria 2058
59 Ga0207425_1000040 3300025245 Bacteria 218121
60 Ga0207425_1009671 3300025245 Bacteria 2387
61 Ga0209148_1000005 3300025254 Bacteria 1806504
62 Ga0209759_1011209 3300025256 Bacteria 2566
63 Ga0209129_1000011 3300025258 Bacteria 568657
64 Ga0209233_1025313 3300025261 Bacteria 1470
65 Ga0209233_1031965 3300025261 Bacteria 1222
66 Ga0209565_1000001 3300025263 Bacteria 2950419
67 Ga0209565_1001194 3300025263 Bacteria 12379
68 Ga0209673_1000001 3300025273 Bacteria 3176258
69 Ga0209675_1000001 3300025291 Bacteria 2950293
70 Ga0209676_1000052 3300025292 Bacteria 371539
71 Ga0209025_1000002 3300025294 Bacteria 1393142
72 Ga0209025_1000006 3300025294 Bacteria 1153444
73 Ga0209564_1000001 3300025295 Bacteria 3176258
74 Ga0209758_1000003 3300025297 Bacteria 1398533
75 Ga0209758_1037048 3300025297 Bacteria 1892
76 Ga0209256_1000006 3300025299 Bacteria 1250310
77 Ga0209257_1000067 3300025304 Bacteria 342468
78 Ga0207713_1000253 3300025735 Bacteria 66728
79 Ga0207649_10059006 3300025920 Bacteria 2406
80 Ga0207681_10054648 3300025923 Bacteria 2716
81 Ga0207681_10496267 3300025923 Bacteria 999
82 Ga0207694_10126557 3300025924 Bacteria 2044
83 Ga0207650_10002182 3300025925 Bacteria 13673
84 Ga0207709_10001199 3300025935 Bacteria 18687
85 Ga0207709_10011709 3300025935 Bacteria 4837
86 Ga0207689_10081059 3300025942 Bacteria 2668
87 Ga0207658_10054839 3300025986 Bacteria 2951
88 Ga0207678_10369328 3300026067 Bacteria 1239
89 Ga0209371_1000028 3300027312 Bacteria 429688
90 Ga0209371_1000048 3300027312 Bacteria 281705
91 Ga0209967_1025673 3300027364 Bacteria 872
92 Ga0209970_1003272 3300027614 Bacteria 2731
93 Ga0209974_10009896 3300027876 Bacteria 3225
94 Ga0268266_10145984 3300028379 Bacteria 2127
95 Ga0268265_10000163 3300028380 Bacteria 81425
96 Ga0268264_10036857 3300028381 Bacteria 4030
97 Ga0268264_10067984 3300028381 Bacteria 3009
98 Ga0268256_1000030 3300030500 Bacteria 429688
99 Ga0268256_1000049 3300030500 Bacteria 307229
100 Ga0307408_100120467 3300031548 Bacteria 2032
101 Ga0307408_100206005 3300031548 Bacteria 1595
102 Ga0316575_10017433 3300031665 Bacteria 2727
103 Ga0307406_10004205 3300031901 Bacteria 7839
104 Ga0307406_10072247 3300031901 Bacteria 2264
105 Ga0307409_100603824 3300031995 Bacteria 1085
106 Ga0307414_10014168 3300032004 Bacteria 4768
107 Ga0307414_10268254 3300032004 Bacteria 1428
108 Ga0307414_10633187 3300032004 Bacteria 962
109 Ga0307411_10130811 3300032005 Bacteria 1834
110 Ga0316583_10144786 3300032133 Bacteria 828
111 Ga0395899_0022990 3300037312 Bacteria 4723
112 Ga0395900_0017998 3300037418 Bacteria 7214
113 Ga0395898_0027930 3300037466 Bacteria 5659
114 Ga0395905_0001074 3300037471 Bacteria 34427
115 Ga0395901_0047322 3300038443 Bacteria 4466
116 Ga0395901_0114295 3300038443 Bacteria 2835
117 Ga0237819_00359 3300038705 Bacteria 16293
118 Ga0439447_000572 3300041407 Bacteria 13707
119 Ga0439465_0005919 3300041413 Bacteria 3887
120 Ga0439465_0079394 3300041413 Bacteria 1111
121 Ga0451791_0365146 3300041451 Bacteria 833
122 Ga0451791_1643403 3300041451 Bacteria 2035
123 Ga0451797_1275424 3300041453 Bacteria 1069
124 Ga0451807_1755858 3300041486 Bacteria 1036
125 Ga0451837_0735071 3300041494 Bacteria 1095
126 Ga0451841_0118527 3300041498 Bacteria 1381
127 Ga0451853_2063701 3300041512 Bacteria 846
128 Ga0439445_0010694 3300042004 Bacteria 2177
129 Ga0439432_026763 3300042006 Bacteria 1887
130 Ga0439449_0000110 3300042007 Bacteria 26752
131 Ga0439449_0019533 3300042007 Bacteria 2540
132 Ga0439449_0102651 3300042007 Bacteria 1057
133 Ga0439446_0086787 3300042156 Bacteria 975
134 Ga0495638_0000144 3300046460 Bacteria 113604
135 Ga0495638_0000479 3300046460 Bacteria 47958
136 Ga0495650_0000134 3300046471 Bacteria 173331
137 Ga0495606_0000386 3300046507 Bacteria 74605
138 Ga0495633_0017245 3300046558 Bacteria 3698
139 Ga0495656_0001726 3300046615 Bacteria 7154
140 Ga0495668_0002362 3300046616 Bacteria 15701
141 Ga0495625_0030039 3300046660 Bacteria 4058
142 Ga0495670_0047922 3300046691 Bacteria 2137
143 Ga0495649_0002304 3300046694 Bacteria 13555
144 Ga0495636_0028224 3300047318 Bacteria 2287
145 Ga0495672_0026950 3300047320 Bacteria 3659
146 Ga0496104_0116687 3300048907 Bacteria 2562
147 Ga0496114_0076079 3300048917 Bacteria 2828
148 Ga0496114_0361402 3300048917 Bacteria 1284
149 Ga0496115_0000193 3300048918 Bacteria 56720
150 Ga0496115_0000776 3300048918 Bacteria 23410
151 Ga0496115_0016660 3300048918 Bacteria 5601
152 Ga0496117_0002697 3300048920 Bacteria 21945
153 Ga0496118_0104047 3300048921 Bacteria 1907
154 Ga0496118_0157451 3300048921 Bacteria 1410
155 Ga0496119_0009580 3300048922 Bacteria 8276
156 Ga0496120_0000262 3300048923 Bacteria 88205
157 Ga0496121_0004653 3300048924 Bacteria 18233
158 Ga0496122_0004336 3300048925 Bacteria 17741
159 Ga0496123_0002493 3300048926 Bacteria 22713
160 Ga0496124_0001915 3300048927 Bacteria 28557
161 Ga0496126_0020962 3300048929 Bacteria 6396
162 Ga0496126_0052845 3300048929 Bacteria 3690
163 Ga0496126_0059056 3300048929 Bacteria 3455
164 Ga0496126_0112121 3300048929 Bacteria 2375
165 Ga0501034_0002118 3300049571 Bacteria 24708
166 Ga0501034_0815391 3300049571 Bacteria 825
167 nmdc:mga00v17_11071_c1 3300050491 Bacteria 4948
168 Ga0500610_0000620 3300053079 Bacteria 10852
169 Ga0500658_0260982 3300053134 Bacteria 796
170 Ga0500634_0000151 3300053161 Bacteria 24470

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8021622325 8021625218 187
2 iso_pu_bacteria 8021648035 8021649256 187
3 iso_pu_bacteria 2852684882 2852687762 189
4 iso_pu_bacteria 2919130084 2919132070 189
5 iso_pu_bacteria 2929195423 2929199191 189
6 iso_pu_bacteria 8021626552 8021627495 189
7 3300006048 Ga0075363_100357040 Ga0075363_1003570402 191
8 iso_pu_bacteria 2818991457 2819662512 191
9 iso_pu_bacteria 2919134579 2919135172 191
10 iso_pu_bacteria 2961064222 2961065483 191
11 3300002773 JGI25152J39213_1000025 JGI25152J39213_100002578 192
12 3300002774 JGI25150J39212_1000066 JGI25150J39212_100006621 192
13 3300003187 JGI25151J46595_10000139 JGI25151J46595_1000013923 192
14 3300003215 JGI25153J46596_10000101 JGI25153J46596_1000010123 192
15 3300025245 Ga0207425_1000040 Ga0207425_1000040141 192
16 3300025258 Ga0209129_1000011 Ga0209129_1000011121 192
17 3300025294 Ga0209025_1000002 Ga0209025_1000002676 192
18 3300025297 Ga0209758_1000003 Ga0209758_1000003683 192
19 iso_pu_bacteria 2643221593 2643973111 192
20 2162886007 SwRhRL2b_contig_944407 SwRhRL2b_0269.00001130 193
21 3300003856 Ga0058692_1000040 Ga0058692_100004092 193
22 3300005289 Ga0065704_10070252 Ga0065704_1007025211 193
23 3300005331 Ga0070670_100000703 Ga0070670_10000070321 193
24 3300005353 Ga0070669_100174043 Ga0070669_1001740432 193
25 3300009011 Ga0105251_10000137 Ga0105251_1000013729 193
26 3300009148 Ga0105243_10002790 Ga0105243_100027903 193
27 3300015261 Ga0182006_1036991 Ga0182006_10369912 193
28 3300015265 Ga0182005_1016793 Ga0182005_10167932 193
29 3300025304 Ga0209257_1000067 Ga0209257_100006784 193
30 3300025735 Ga0207713_1000253 Ga0207713_100025357 193
31 3300025923 Ga0207681_10054648 Ga0207681_100546482 193
32 3300025925 Ga0207650_10002182 Ga0207650_100021825 193
33 3300025935 Ga0207709_10011709 Ga0207709_100117093 193
34 3300027312 Ga0209371_1000048 Ga0209371_1000048221 193
35 3300030500 Ga0268256_1000049 Ga0268256_100004947 193
36 3300038705 Ga0237819_00359 Ga0237819_00359_6903_7484 193
37 3300041451 Ga0451791_0365146 Ga0451791_0365146_96_677 193
38 3300048920 Ga0496117_0002697 Ga0496117_0002697_14285_14866 193
39 3300048921 Ga0496118_0104047 Ga0496118_0104047_975_1556 193
40 3300048921 Ga0496118_0157451 Ga0496118_0157451_810_1391 193
41 3300048922 Ga0496119_0009580 Ga0496119_0009580_6159_6740 193
42 3300048923 Ga0496120_0000262 Ga0496120_0000262_71669_72250 193
43 3300048925 Ga0496122_0004336 Ga0496122_0004336_5997_6578 193
44 3300048926 Ga0496123_0002493 Ga0496123_0002493_15954_16535 193
45 3300048927 Ga0496124_0001915 Ga0496124_0001915_12239_12820 193
46 3300048929 Ga0496126_0112121 Ga0496126_0112121_513_1094 193
47 iso_pu_bacteria 2995948881 2995949863 193
48 3300032004 Ga0307414_10633187 Ga0307414_106331872 194
49 3300037466 Ga0395898_0027930 Ga0395898_0027930_1599_2183 194
50 3300038443 Ga0395901_0047322 Ga0395901_0047322_2083_2667 194
51 3300046558 Ga0495633_0017245 Ga0495633_0017245_1204_1788 194
52 3300049571 Ga0501034_0815391 Ga0501034_0815391_186_770 194
53 iso_pu_bacteria 2747842501 2748019028 194
54 3300003856 Ga0058692_1000026 Ga0058692_1000026165 195
55 3300005985 Ga0081539_10007672 Ga0081539_100076728 195
56 3300025935 Ga0207709_10001199 Ga0207709_100011998 195
57 3300027312 Ga0209371_1000028 Ga0209371_1000028187 195
58 3300030500 Ga0268256_1000030 Ga0268256_1000030207 195
59 3300042006 Ga0439432_026763 Ga0439432_026763_1110_1697 195
60 3300042007 Ga0439449_0019533 Ga0439449_0019533_1781_2368 195
61 3300049571 Ga0501034_0002118 Ga0501034_0002118_14501_15088 195
62 iso_pu_bacteria 2941489479 2941493469 195
63 3300003187 JGI25151J46595_10000048 JGI25151J46595_1000004839 196
64 3300025245 Ga0207425_1009671 Ga0207425_10096712 196
65 3300025294 Ga0209025_1000006 Ga0209025_1000006401 196
66 3300025297 Ga0209758_1037048 Ga0209758_10370481 196
67 3300031995 Ga0307409_100603824 Ga0307409_1006038242 196
68 3300037312 Ga0395899_0022990 Ga0395899_0022990_1380_1985 196
69 3300037418 Ga0395900_0017998 Ga0395900_0017998_4444_5049 196
70 3300037471 Ga0395905_0001074 Ga0395905_0001074_28540_29145 196
71 3300038443 Ga0395901_0114295 Ga0395901_0114295_1432_2037 196
72 3300041498 Ga0451841_0118527 Ga0451841_0118527_390_983 196
73 3300041512 Ga0451853_2063701 Ga0451853_2063701_185_778 196
74 3300046615 Ga0495656_0001726 Ga0495656_0001726_4596_5186 196
75 3300046691 Ga0495670_0047922 Ga0495670_0047922_499_1089 196
76 3300047318 Ga0495636_0028224 Ga0495636_0028224_1334_1924 196
77 3300053161 Ga0500634_0000151 Ga0500634_0000151_12224_12841 196
78 3300003322 rootL2_10075803 rootL2_100758032 197
79 3300003771 Ga0055526_1000005 Ga0055526_100000593 197
80 3300003773 Ga0055537_1000155 Ga0055537_100015510 197
81 3300003775 Ga0055524_1000005 Ga0055524_100000594 197
82 3300003784 Ga0055534_1000002 Ga0055534_1000002235 197
83 3300003790 Ga0055528_1000002 Ga0055528_1000002235 197
84 3300013306 Ga0163162_11339100 Ga0163162_113391001 197
85 3300013308 Ga0157375_10474376 Ga0157375_104743762 197
86 3300015689 Ga0183360_10001 Ga0183360_100013173 197
87 3300025263 Ga0209565_1000001 Ga0209565_1000001685 197
88 3300025263 Ga0209565_1001194 Ga0209565_10011947 197
89 3300025273 Ga0209673_1000001 Ga0209673_1000001685 197
90 3300025291 Ga0209675_1000001 Ga0209675_10000011847 197
91 3300025295 Ga0209564_1000001 Ga0209564_10000012009 197
92 3300025299 Ga0209256_1000006 Ga0209256_1000006445 197
93 3300027364 Ga0209967_1025673 Ga0209967_10256731 197
94 3300027614 Ga0209970_1003272 Ga0209970_10032723 197
95 3300027876 Ga0209974_10009896 Ga0209974_100098962 197
96 3300031548 Ga0307408_100206005 Ga0307408_1002060052 197
97 3300031901 Ga0307406_10004205 Ga0307406_100042057 197
98 3300032005 Ga0307411_10130811 Ga0307411_101308111 197
99 3300003320 rootH2_10119747 rootH2_101197471 198
100 3300009979 Ga0105032_101629 Ga0105032_1016292 198
101 3300013297 Ga0157378_10133713 Ga0157378_101337133 198
102 3300015261 Ga0182006_1014274 Ga0182006_10142742 198
103 3300005293 Ga0065715_10193267 Ga0065715_101932672 199
104 3300005334 Ga0068869_100040514 Ga0068869_1000405144 199
105 3300005353 Ga0070669_100472531 Ga0070669_1004725311 199
106 3300005367 Ga0070667_100063914 Ga0070667_1000639142 199
107 3300006051 Ga0075364_10009249 Ga0075364_100092492 199
108 3300009545 Ga0105237_10248376 Ga0105237_102483763 199
109 3300009553 Ga0105249_11335338 Ga0105249_113353382 199
110 3300013296 Ga0157374_10038034 Ga0157374_100380342 199
111 3300025923 Ga0207681_10496267 Ga0207681_104962672 199
112 3300025942 Ga0207689_10081059 Ga0207689_100810591 199
113 3300025986 Ga0207658_10054839 Ga0207658_100548393 199
114 3300031548 Ga0307408_100120467 Ga0307408_1001204672 199
115 3300031901 Ga0307406_10072247 Ga0307406_100722471 199
116 3300032004 Ga0307414_10014168 Ga0307414_100141686 199
117 3300050491 nmdc:mga00v17_11071_c1 nmdc:mga00v17_11071_c1_4247_4855 199
118 3300053134 Ga0500658_0260982 Ga0500658_0260982_111_719 202
119 3300005548 Ga0070665_100183660 Ga0070665_1001836602 203
120 3300025225 Ga0209566_106295 Ga0209566_1062952 203
121 3300025256 Ga0209759_1011209 Ga0209759_10112092 203
122 3300025261 Ga0209233_1025313 Ga0209233_10253133 203
123 3300028379 Ga0268266_10145984 Ga0268266_101459842 203
124 3300032004 Ga0307414_10268254 Ga0307414_102682542 203
125 3300041451 Ga0451791_1643403 Ga0451791_1643403_828_1439 203
126 3300041486 Ga0451807_1755858 Ga0451807_1755858_47_658 203
127 3300041494 Ga0451837_0735071 Ga0451837_0735071_377_988 203
128 iso_pu_bacteria 2643221579 2643907004 203
129 iso_pu_bacteria 2643221581 2643913596 203
130 iso_pu_bacteria 2884411467 2884416077 203
131 iso_pu_bacteria 2923516293 2923519527 203
132 iso_pu_bacteria 2928963466 2928965978 203
133 3300002737 JGI25162J39368_1001798 JGI25162J39368_10017988 204
134 3300002772 JGI25164J39214_1007660 JGI25164J39214_10076602 204
135 3300003762 Ga0055542_1000069 Ga0055542_100006952 204
136 3300005337 Ga0070682_100320178 Ga0070682_1003201782 204
137 3300005344 Ga0070661_100005371 Ga0070661_1000053713 204
138 3300005844 Ga0068862_100000379 Ga0068862_10000037937 204
139 3300005844 Ga0068862_100060730 Ga0068862_1000607303 204
140 3300009551 Ga0105238_10064859 Ga0105238_100648593 204
141 3300025231 Ga0207427_100893 Ga0207427_1008935 204
142 3300025233 Ga0209437_100113 Ga0209437_10011353 204
143 3300025242 Ga0209258_105711 Ga0209258_1057112 204
144 3300025254 Ga0209148_1000005 Ga0209148_10000051420 204
145 3300025261 Ga0209233_1031965 Ga0209233_10319652 204
146 3300025920 Ga0207649_10059006 Ga0207649_100590063 204
147 3300025924 Ga0207694_10126557 Ga0207694_101265572 204
148 3300028380 Ga0268265_10000163 Ga0268265_1000016376 204
149 3300028381 Ga0268264_10036857 Ga0268264_100368574 204
150 3300028381 Ga0268264_10067984 Ga0268264_100679842 204
151 3300041407 Ga0439447_000572 Ga0439447_000572_6815_7516 204
152 3300041413 Ga0439465_0005919 Ga0439465_0005919_428_1042 204
153 3300042007 Ga0439449_0102651 Ga0439449_0102651_373_987 204
154 3300042156 Ga0439446_0086787 Ga0439446_0086787_76_690 204
155 3300046616 Ga0495668_0002362 Ga0495668_0002362_10209_10901 204
156 3300048917 Ga0496114_0361402 Ga0496114_0361402_215_847 204
157 iso_pu_bacteria 2739367700 2739729838 204
158 3300048918 Ga0496115_0016660 Ga0496115_0016660_1648_2280 205
159 3300009993 Ga0105028_100356 Ga0105028_1003566 206
160 3300013306 Ga0163162_10181888 Ga0163162_101818882 206
161 3300014969 Ga0157376_10019218 Ga0157376_100192183 206
162 3300046460 Ga0495638_0000479 Ga0495638_0000479_45499_46176 206
163 3300046471 Ga0495650_0000134 Ga0495650_0000134_119911_120588 206
164 3300048907 Ga0496104_0116687 Ga0496104_0116687_1857_2534 206
165 3300048918 Ga0496115_0000776 Ga0496115_0000776_20420_21097 206
166 2162886007 SwRhRL2b_contig_372769 SwRhRL2b_0657.00001590 207
167 3300003781 Ga0055536_1001044 Ga0055536_10010444 207
168 3300005289 Ga0065704_10001079 Ga0065704_100010797 207
169 3300025228 Ga0209672_101611 Ga0209672_1016117 207
170 3300025292 Ga0209676_1000052 Ga0209676_100005227 207
171 3300026067 Ga0207678_10369328 Ga0207678_103693282 207
172 3300031665 Ga0316575_10017433 Ga0316575_100174332 207
173 3300032133 Ga0316583_10144786 Ga0316583_101447861 207
174 3300041413 Ga0439465_0079394 Ga0439465_0079394_199_846 207
175 3300041453 Ga0451797_1275424 Ga0451797_1275424_45_674 207
176 3300042004 Ga0439445_0010694 Ga0439445_0010694_1007_1654 207
177 3300042007 Ga0439449_0000110 Ga0439449_0000110_14679_15326 207
178 3300046460 Ga0495638_0000144 Ga0495638_0000144_44337_45020 207
179 3300046507 Ga0495606_0000386 Ga0495606_0000386_5236_5907 207
180 3300046660 Ga0495625_0030039 Ga0495625_0030039_1135_1818 207
181 3300046694 Ga0495649_0002304 Ga0495649_0002304_11449_12120 207
182 3300047320 Ga0495672_0026950 Ga0495672_0026950_735_1385 207
183 3300048917 Ga0496114_0076079 Ga0496114_0076079_717_1340 207
184 3300048918 Ga0496115_0000193 Ga0496115_0000193_8369_9040 207
185 3300048924 Ga0496121_0004653 Ga0496121_0004653_4948_5625 207
186 3300048929 Ga0496126_0020962 Ga0496126_0020962_4266_4937 207
187 3300048929 Ga0496126_0052845 Ga0496126_0052845_2660_3283 207
188 3300048929 Ga0496126_0059056 Ga0496126_0059056_1180_1851 207
189 3300053079 Ga0500610_0000620 Ga0500610_0000620_4779_5438 207

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13532

2OG-FeII_Oxy_2

2OG-Fe(II) oxygenase superfamily

25

203

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3btz-assembly1.cif.gz_A crystal structure of human abh2 cross-linked to dsdna 0.9616 12 201
3buc-assembly1.cif.gz_A x-ray structure of human abh2 bound to dsdna with mn(ii) and 2kg 0.956 11 201
3rzl-assembly2.cif.gz_D duplex interrogation by a direct dna repair protein in the search of damage 0.9478 11 201
3rzl-assembly1.cif.gz_A duplex interrogation by a direct dna repair protein in the search of damage 0.9417 8 201
3rzm-assembly1.cif.gz_A duplex interrogation by a direct dna repair protein in the search of damage 0.94 11 201
ID Description Score Start End Superfamily
3rzlA00 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9417 8 201 2.60.120.590
af_Q9SIE0_90_314_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9393 11 201 2.60.120.590
3rzlA00 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9276 8 201 2.60.120.590
2iuwA00 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.8843 7 203 2.60.120.590
af_I1MFT0_7_203_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.8665 24 201 2.60.120.590
ID Description Score Start End GO Terms
AF-A0A354Y6V4-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB 0.9977 103 201 GO:0006307
GO:0008198
GO:0035516
GO:0051747
AF-A0A1Y6H3Z7-F1-model_v4 DNA repair system specific for alkylated DNA 0.9938 110 202 GO:0006307
GO:0008198
GO:0035516
GO:0051747
AF-A0A7Y3C6G6-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB 0.993 117 202 GO:0006307
GO:0008198
GO:0035516
GO:0051747
AF-A0A432C9F2-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB 0.9916 105 202 GO:0006307
GO:0051213
AF-Q609W8-F1-model_v4 2OG-Fe(II) oxygenase family domain protein 0.9909 65 203 GO:0006307
GO:0051213

Feature Viewer

pLDDT pTM Quality
90.96 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map