F291176
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 189 | 153 | 170 | 202 |
Family's Representative Sequence
| Representative Sequence | 3300031548|Ga0307408_100120467|Ga0307408_1001204672 |
| Length | 218 |
| Sequence | MPSRFRNRTGDTGPMWRTLELAGADLRFDPHFLADGEAAEAFAALRDSLPWSVHRIRLFGREVDSPRLSAWLGEPGASYRYSGTRFEPHPWTPALRALRDRVAFAAGVEFNSVLANRYRSGADHMGWHSDDEPELGPEPVIASLSLGATRRFRLRHRRGDPALAIDLPPGSLLVMRGQTQRLYRHALPRTARPVGERLNLTFRWIRPVPAGAGRQGRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 3 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 4 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 5 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 6 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 7 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 8 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 9 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 10 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 11 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 12 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 13 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 14 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 15 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 16 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 17 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 18 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 19 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 20 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 21 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 22 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 23 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 24 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 25 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 26 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 32 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 34 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 45 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 46 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 47 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 53 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 54 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 60 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 61 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 62 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 70 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 98 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 99 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 100 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 101 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 102 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 103 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 104 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 105 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 106 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 107 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 108 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 109 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 110 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 111 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 112 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 113 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 114 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 115 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 116 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 117 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 118 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 119 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 120 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 121 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 122 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 123 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 135 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 136 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 137 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 138 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 139 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 140 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 141 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 142 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 143 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 144 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 145 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 146 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 148 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 149 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 150 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 151 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 152 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 153 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.95 |
| Metatranscriptomes | 0 |
| Isolates | 10.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 22.75 |
| Nodule | 0 |
| Rhizoplane | 5.29 |
| Rhizosphere | 56.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_372769 | 2162886007 | Bacteria | 8162 |
| 2 | SwRhRL2b_contig_944407 | 2162886007 | Bacteria | 2626 |
| 3 | JGI25162J39368_1001798 | 3300002737 | Bacteria | 10104 |
| 4 | JGI25164J39214_1007660 | 3300002772 | Bacteria | 1093 |
| 5 | JGI25152J39213_1000025 | 3300002773 | Bacteria | 103262 |
| 6 | JGI25150J39212_1000066 | 3300002774 | Bacteria | 63677 |
| 7 | JGI25151J46595_10000048 | 3300003187 | Bacteria | 166842 |
| 8 | JGI25151J46595_10000139 | 3300003187 | Bacteria | 96000 |
| 9 | JGI25153J46596_10000101 | 3300003215 | Bacteria | 96639 |
| 10 | rootH2_10119747 | 3300003320 | Bacteria | 1141 |
| 11 | rootL2_10075803 | 3300003322 | Bacteria | 4235 |
| 12 | Ga0055542_1000069 | 3300003762 | Bacteria | 148278 |
| 13 | Ga0055526_1000005 | 3300003771 | Bacteria | 344542 |
| 14 | Ga0055537_1000155 | 3300003773 | Bacteria | 51676 |
| 15 | Ga0055524_1000005 | 3300003775 | Bacteria | 344542 |
| 16 | Ga0055536_1001044 | 3300003781 | Bacteria | 17503 |
| 17 | Ga0055534_1000002 | 3300003784 | Bacteria | 390762 |
| 18 | Ga0055528_1000002 | 3300003790 | Bacteria | 368879 |
| 19 | Ga0058692_1000026 | 3300003856 | Bacteria | 203096 |
| 20 | Ga0058692_1000040 | 3300003856 | Bacteria | 132805 |
| 21 | Ga0065704_10001079 | 3300005289 | Bacteria | 10025 |
| 22 | Ga0065704_10070252 | 3300005289 | Bacteria | 48050 |
| 23 | Ga0065715_10193267 | 3300005293 | Bacteria | 1402 |
| 24 | Ga0070670_100000703 | 3300005331 | Bacteria | 25979 |
| 25 | Ga0068869_100040514 | 3300005334 | Bacteria | 3331 |
| 26 | Ga0070682_100320178 | 3300005337 | Bacteria | 1145 |
| 27 | Ga0070661_100005371 | 3300005344 | Bacteria | 8832 |
| 28 | Ga0070669_100174043 | 3300005353 | Bacteria | 1680 |
| 29 | Ga0070669_100472531 | 3300005353 | Bacteria | 1036 |
| 30 | Ga0070667_100063914 | 3300005367 | Bacteria | 3121 |
| 31 | Ga0070665_100183660 | 3300005548 | Bacteria | 2092 |
| 32 | Ga0068862_100000379 | 3300005844 | Bacteria | 48327 |
| 33 | Ga0068862_100060730 | 3300005844 | Bacteria | 3248 |
| 34 | Ga0081539_10007672 | 3300005985 | Bacteria | 9701 |
| 35 | Ga0075363_100357040 | 3300006048 | Bacteria | 854 |
| 36 | Ga0075364_10009249 | 3300006051 | Bacteria | 5907 |
| 37 | Ga0105251_10000137 | 3300009011 | Bacteria | 74569 |
| 38 | Ga0105243_10002790 | 3300009148 | Bacteria | 14512 |
| 39 | Ga0105237_10248376 | 3300009545 | Unclassified | 1781 |
| 40 | Ga0105238_10064859 | 3300009551 | Bacteria | 3652 |
| 41 | Ga0105249_11335338 | 3300009553 | Bacteria | 789 |
| 42 | Ga0105032_101629 | 3300009979 | Bacteria | 2038 |
| 43 | Ga0105028_100356 | 3300009993 | Bacteria | 4910 |
| 44 | Ga0157374_10038034 | 3300013296 | Bacteria | 4421 |
| 45 | Ga0157378_10133713 | 3300013297 | Bacteria | 2298 |
| 46 | Ga0163162_10181888 | 3300013306 | Bacteria | 2228 |
| 47 | Ga0163162_11339100 | 3300013306 | Bacteria | 814 |
| 48 | Ga0157375_10474376 | 3300013308 | Bacteria | 1416 |
| 49 | Ga0157376_10019218 | 3300014969 | Bacteria | 5260 |
| 50 | Ga0182006_1014274 | 3300015261 | Bacteria | 3427 |
| 51 | Ga0182006_1036991 | 3300015261 | Bacteria | 1938 |
| 52 | Ga0182005_1016793 | 3300015265 | Bacteria | 2031 |
| 53 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 54 | Ga0209566_106295 | 3300025225 | Bacteria | 1413 |
| 55 | Ga0209672_101611 | 3300025228 | Bacteria | 7542 |
| 56 | Ga0207427_100893 | 3300025231 | Bacteria | 12962 |
| 57 | Ga0209437_100113 | 3300025233 | Bacteria | 211240 |
| 58 | Ga0209258_105711 | 3300025242 | Bacteria | 2058 |
| 59 | Ga0207425_1000040 | 3300025245 | Bacteria | 218121 |
| 60 | Ga0207425_1009671 | 3300025245 | Bacteria | 2387 |
| 61 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 62 | Ga0209759_1011209 | 3300025256 | Bacteria | 2566 |
| 63 | Ga0209129_1000011 | 3300025258 | Bacteria | 568657 |
| 64 | Ga0209233_1025313 | 3300025261 | Bacteria | 1470 |
| 65 | Ga0209233_1031965 | 3300025261 | Bacteria | 1222 |
| 66 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 67 | Ga0209565_1001194 | 3300025263 | Bacteria | 12379 |
| 68 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 69 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 70 | Ga0209676_1000052 | 3300025292 | Bacteria | 371539 |
| 71 | Ga0209025_1000002 | 3300025294 | Bacteria | 1393142 |
| 72 | Ga0209025_1000006 | 3300025294 | Bacteria | 1153444 |
| 73 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 74 | Ga0209758_1000003 | 3300025297 | Bacteria | 1398533 |
| 75 | Ga0209758_1037048 | 3300025297 | Bacteria | 1892 |
| 76 | Ga0209256_1000006 | 3300025299 | Bacteria | 1250310 |
| 77 | Ga0209257_1000067 | 3300025304 | Bacteria | 342468 |
| 78 | Ga0207713_1000253 | 3300025735 | Bacteria | 66728 |
| 79 | Ga0207649_10059006 | 3300025920 | Bacteria | 2406 |
| 80 | Ga0207681_10054648 | 3300025923 | Bacteria | 2716 |
| 81 | Ga0207681_10496267 | 3300025923 | Bacteria | 999 |
| 82 | Ga0207694_10126557 | 3300025924 | Bacteria | 2044 |
| 83 | Ga0207650_10002182 | 3300025925 | Bacteria | 13673 |
| 84 | Ga0207709_10001199 | 3300025935 | Bacteria | 18687 |
| 85 | Ga0207709_10011709 | 3300025935 | Bacteria | 4837 |
| 86 | Ga0207689_10081059 | 3300025942 | Bacteria | 2668 |
| 87 | Ga0207658_10054839 | 3300025986 | Bacteria | 2951 |
| 88 | Ga0207678_10369328 | 3300026067 | Bacteria | 1239 |
| 89 | Ga0209371_1000028 | 3300027312 | Bacteria | 429688 |
| 90 | Ga0209371_1000048 | 3300027312 | Bacteria | 281705 |
| 91 | Ga0209967_1025673 | 3300027364 | Bacteria | 872 |
| 92 | Ga0209970_1003272 | 3300027614 | Bacteria | 2731 |
| 93 | Ga0209974_10009896 | 3300027876 | Bacteria | 3225 |
| 94 | Ga0268266_10145984 | 3300028379 | Bacteria | 2127 |
| 95 | Ga0268265_10000163 | 3300028380 | Bacteria | 81425 |
| 96 | Ga0268264_10036857 | 3300028381 | Bacteria | 4030 |
| 97 | Ga0268264_10067984 | 3300028381 | Bacteria | 3009 |
| 98 | Ga0268256_1000030 | 3300030500 | Bacteria | 429688 |
| 99 | Ga0268256_1000049 | 3300030500 | Bacteria | 307229 |
| 100 | Ga0307408_100120467 | 3300031548 | Bacteria | 2032 |
| 101 | Ga0307408_100206005 | 3300031548 | Bacteria | 1595 |
| 102 | Ga0316575_10017433 | 3300031665 | Bacteria | 2727 |
| 103 | Ga0307406_10004205 | 3300031901 | Bacteria | 7839 |
| 104 | Ga0307406_10072247 | 3300031901 | Bacteria | 2264 |
| 105 | Ga0307409_100603824 | 3300031995 | Bacteria | 1085 |
| 106 | Ga0307414_10014168 | 3300032004 | Bacteria | 4768 |
| 107 | Ga0307414_10268254 | 3300032004 | Bacteria | 1428 |
| 108 | Ga0307414_10633187 | 3300032004 | Bacteria | 962 |
| 109 | Ga0307411_10130811 | 3300032005 | Bacteria | 1834 |
| 110 | Ga0316583_10144786 | 3300032133 | Bacteria | 828 |
| 111 | Ga0395899_0022990 | 3300037312 | Bacteria | 4723 |
| 112 | Ga0395900_0017998 | 3300037418 | Bacteria | 7214 |
| 113 | Ga0395898_0027930 | 3300037466 | Bacteria | 5659 |
| 114 | Ga0395905_0001074 | 3300037471 | Bacteria | 34427 |
| 115 | Ga0395901_0047322 | 3300038443 | Bacteria | 4466 |
| 116 | Ga0395901_0114295 | 3300038443 | Bacteria | 2835 |
| 117 | Ga0237819_00359 | 3300038705 | Bacteria | 16293 |
| 118 | Ga0439447_000572 | 3300041407 | Bacteria | 13707 |
| 119 | Ga0439465_0005919 | 3300041413 | Bacteria | 3887 |
| 120 | Ga0439465_0079394 | 3300041413 | Bacteria | 1111 |
| 121 | Ga0451791_0365146 | 3300041451 | Bacteria | 833 |
| 122 | Ga0451791_1643403 | 3300041451 | Bacteria | 2035 |
| 123 | Ga0451797_1275424 | 3300041453 | Bacteria | 1069 |
| 124 | Ga0451807_1755858 | 3300041486 | Bacteria | 1036 |
| 125 | Ga0451837_0735071 | 3300041494 | Bacteria | 1095 |
| 126 | Ga0451841_0118527 | 3300041498 | Bacteria | 1381 |
| 127 | Ga0451853_2063701 | 3300041512 | Bacteria | 846 |
| 128 | Ga0439445_0010694 | 3300042004 | Bacteria | 2177 |
| 129 | Ga0439432_026763 | 3300042006 | Bacteria | 1887 |
| 130 | Ga0439449_0000110 | 3300042007 | Bacteria | 26752 |
| 131 | Ga0439449_0019533 | 3300042007 | Bacteria | 2540 |
| 132 | Ga0439449_0102651 | 3300042007 | Bacteria | 1057 |
| 133 | Ga0439446_0086787 | 3300042156 | Bacteria | 975 |
| 134 | Ga0495638_0000144 | 3300046460 | Bacteria | 113604 |
| 135 | Ga0495638_0000479 | 3300046460 | Bacteria | 47958 |
| 136 | Ga0495650_0000134 | 3300046471 | Bacteria | 173331 |
| 137 | Ga0495606_0000386 | 3300046507 | Bacteria | 74605 |
| 138 | Ga0495633_0017245 | 3300046558 | Bacteria | 3698 |
| 139 | Ga0495656_0001726 | 3300046615 | Bacteria | 7154 |
| 140 | Ga0495668_0002362 | 3300046616 | Bacteria | 15701 |
| 141 | Ga0495625_0030039 | 3300046660 | Bacteria | 4058 |
| 142 | Ga0495670_0047922 | 3300046691 | Bacteria | 2137 |
| 143 | Ga0495649_0002304 | 3300046694 | Bacteria | 13555 |
| 144 | Ga0495636_0028224 | 3300047318 | Bacteria | 2287 |
| 145 | Ga0495672_0026950 | 3300047320 | Bacteria | 3659 |
| 146 | Ga0496104_0116687 | 3300048907 | Bacteria | 2562 |
| 147 | Ga0496114_0076079 | 3300048917 | Bacteria | 2828 |
| 148 | Ga0496114_0361402 | 3300048917 | Bacteria | 1284 |
| 149 | Ga0496115_0000193 | 3300048918 | Bacteria | 56720 |
| 150 | Ga0496115_0000776 | 3300048918 | Bacteria | 23410 |
| 151 | Ga0496115_0016660 | 3300048918 | Bacteria | 5601 |
| 152 | Ga0496117_0002697 | 3300048920 | Bacteria | 21945 |
| 153 | Ga0496118_0104047 | 3300048921 | Bacteria | 1907 |
| 154 | Ga0496118_0157451 | 3300048921 | Bacteria | 1410 |
| 155 | Ga0496119_0009580 | 3300048922 | Bacteria | 8276 |
| 156 | Ga0496120_0000262 | 3300048923 | Bacteria | 88205 |
| 157 | Ga0496121_0004653 | 3300048924 | Bacteria | 18233 |
| 158 | Ga0496122_0004336 | 3300048925 | Bacteria | 17741 |
| 159 | Ga0496123_0002493 | 3300048926 | Bacteria | 22713 |
| 160 | Ga0496124_0001915 | 3300048927 | Bacteria | 28557 |
| 161 | Ga0496126_0020962 | 3300048929 | Bacteria | 6396 |
| 162 | Ga0496126_0052845 | 3300048929 | Bacteria | 3690 |
| 163 | Ga0496126_0059056 | 3300048929 | Bacteria | 3455 |
| 164 | Ga0496126_0112121 | 3300048929 | Bacteria | 2375 |
| 165 | Ga0501034_0002118 | 3300049571 | Bacteria | 24708 |
| 166 | Ga0501034_0815391 | 3300049571 | Bacteria | 825 |
| 167 | nmdc:mga00v17_11071_c1 | 3300050491 | Bacteria | 4948 |
| 168 | Ga0500610_0000620 | 3300053079 | Bacteria | 10852 |
| 169 | Ga0500658_0260982 | 3300053134 | Bacteria | 796 |
| 170 | Ga0500634_0000151 | 3300053161 | Bacteria | 24470 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 8021622325 | 8021625218 | 187 |
| 2 | iso_pu_bacteria | 8021648035 | 8021649256 | 187 |
| 3 | iso_pu_bacteria | 2852684882 | 2852687762 | 189 |
| 4 | iso_pu_bacteria | 2919130084 | 2919132070 | 189 |
| 5 | iso_pu_bacteria | 2929195423 | 2929199191 | 189 |
| 6 | iso_pu_bacteria | 8021626552 | 8021627495 | 189 |
| 7 | 3300006048 | Ga0075363_100357040 | Ga0075363_1003570402 | 191 |
| 8 | iso_pu_bacteria | 2818991457 | 2819662512 | 191 |
| 9 | iso_pu_bacteria | 2919134579 | 2919135172 | 191 |
| 10 | iso_pu_bacteria | 2961064222 | 2961065483 | 191 |
| 11 | 3300002773 | JGI25152J39213_1000025 | JGI25152J39213_100002578 | 192 |
| 12 | 3300002774 | JGI25150J39212_1000066 | JGI25150J39212_100006621 | 192 |
| 13 | 3300003187 | JGI25151J46595_10000139 | JGI25151J46595_1000013923 | 192 |
| 14 | 3300003215 | JGI25153J46596_10000101 | JGI25153J46596_1000010123 | 192 |
| 15 | 3300025245 | Ga0207425_1000040 | Ga0207425_1000040141 | 192 |
| 16 | 3300025258 | Ga0209129_1000011 | Ga0209129_1000011121 | 192 |
| 17 | 3300025294 | Ga0209025_1000002 | Ga0209025_1000002676 | 192 |
| 18 | 3300025297 | Ga0209758_1000003 | Ga0209758_1000003683 | 192 |
| 19 | iso_pu_bacteria | 2643221593 | 2643973111 | 192 |
| 20 | 2162886007 | SwRhRL2b_contig_944407 | SwRhRL2b_0269.00001130 | 193 |
| 21 | 3300003856 | Ga0058692_1000040 | Ga0058692_100004092 | 193 |
| 22 | 3300005289 | Ga0065704_10070252 | Ga0065704_1007025211 | 193 |
| 23 | 3300005331 | Ga0070670_100000703 | Ga0070670_10000070321 | 193 |
| 24 | 3300005353 | Ga0070669_100174043 | Ga0070669_1001740432 | 193 |
| 25 | 3300009011 | Ga0105251_10000137 | Ga0105251_1000013729 | 193 |
| 26 | 3300009148 | Ga0105243_10002790 | Ga0105243_100027903 | 193 |
| 27 | 3300015261 | Ga0182006_1036991 | Ga0182006_10369912 | 193 |
| 28 | 3300015265 | Ga0182005_1016793 | Ga0182005_10167932 | 193 |
| 29 | 3300025304 | Ga0209257_1000067 | Ga0209257_100006784 | 193 |
| 30 | 3300025735 | Ga0207713_1000253 | Ga0207713_100025357 | 193 |
| 31 | 3300025923 | Ga0207681_10054648 | Ga0207681_100546482 | 193 |
| 32 | 3300025925 | Ga0207650_10002182 | Ga0207650_100021825 | 193 |
| 33 | 3300025935 | Ga0207709_10011709 | Ga0207709_100117093 | 193 |
| 34 | 3300027312 | Ga0209371_1000048 | Ga0209371_1000048221 | 193 |
| 35 | 3300030500 | Ga0268256_1000049 | Ga0268256_100004947 | 193 |
| 36 | 3300038705 | Ga0237819_00359 | Ga0237819_00359_6903_7484 | 193 |
| 37 | 3300041451 | Ga0451791_0365146 | Ga0451791_0365146_96_677 | 193 |
| 38 | 3300048920 | Ga0496117_0002697 | Ga0496117_0002697_14285_14866 | 193 |
| 39 | 3300048921 | Ga0496118_0104047 | Ga0496118_0104047_975_1556 | 193 |
| 40 | 3300048921 | Ga0496118_0157451 | Ga0496118_0157451_810_1391 | 193 |
| 41 | 3300048922 | Ga0496119_0009580 | Ga0496119_0009580_6159_6740 | 193 |
| 42 | 3300048923 | Ga0496120_0000262 | Ga0496120_0000262_71669_72250 | 193 |
| 43 | 3300048925 | Ga0496122_0004336 | Ga0496122_0004336_5997_6578 | 193 |
| 44 | 3300048926 | Ga0496123_0002493 | Ga0496123_0002493_15954_16535 | 193 |
| 45 | 3300048927 | Ga0496124_0001915 | Ga0496124_0001915_12239_12820 | 193 |
| 46 | 3300048929 | Ga0496126_0112121 | Ga0496126_0112121_513_1094 | 193 |
| 47 | iso_pu_bacteria | 2995948881 | 2995949863 | 193 |
| 48 | 3300032004 | Ga0307414_10633187 | Ga0307414_106331872 | 194 |
| 49 | 3300037466 | Ga0395898_0027930 | Ga0395898_0027930_1599_2183 | 194 |
| 50 | 3300038443 | Ga0395901_0047322 | Ga0395901_0047322_2083_2667 | 194 |
| 51 | 3300046558 | Ga0495633_0017245 | Ga0495633_0017245_1204_1788 | 194 |
| 52 | 3300049571 | Ga0501034_0815391 | Ga0501034_0815391_186_770 | 194 |
| 53 | iso_pu_bacteria | 2747842501 | 2748019028 | 194 |
| 54 | 3300003856 | Ga0058692_1000026 | Ga0058692_1000026165 | 195 |
| 55 | 3300005985 | Ga0081539_10007672 | Ga0081539_100076728 | 195 |
| 56 | 3300025935 | Ga0207709_10001199 | Ga0207709_100011998 | 195 |
| 57 | 3300027312 | Ga0209371_1000028 | Ga0209371_1000028187 | 195 |
| 58 | 3300030500 | Ga0268256_1000030 | Ga0268256_1000030207 | 195 |
| 59 | 3300042006 | Ga0439432_026763 | Ga0439432_026763_1110_1697 | 195 |
| 60 | 3300042007 | Ga0439449_0019533 | Ga0439449_0019533_1781_2368 | 195 |
| 61 | 3300049571 | Ga0501034_0002118 | Ga0501034_0002118_14501_15088 | 195 |
| 62 | iso_pu_bacteria | 2941489479 | 2941493469 | 195 |
| 63 | 3300003187 | JGI25151J46595_10000048 | JGI25151J46595_1000004839 | 196 |
| 64 | 3300025245 | Ga0207425_1009671 | Ga0207425_10096712 | 196 |
| 65 | 3300025294 | Ga0209025_1000006 | Ga0209025_1000006401 | 196 |
| 66 | 3300025297 | Ga0209758_1037048 | Ga0209758_10370481 | 196 |
| 67 | 3300031995 | Ga0307409_100603824 | Ga0307409_1006038242 | 196 |
| 68 | 3300037312 | Ga0395899_0022990 | Ga0395899_0022990_1380_1985 | 196 |
| 69 | 3300037418 | Ga0395900_0017998 | Ga0395900_0017998_4444_5049 | 196 |
| 70 | 3300037471 | Ga0395905_0001074 | Ga0395905_0001074_28540_29145 | 196 |
| 71 | 3300038443 | Ga0395901_0114295 | Ga0395901_0114295_1432_2037 | 196 |
| 72 | 3300041498 | Ga0451841_0118527 | Ga0451841_0118527_390_983 | 196 |
| 73 | 3300041512 | Ga0451853_2063701 | Ga0451853_2063701_185_778 | 196 |
| 74 | 3300046615 | Ga0495656_0001726 | Ga0495656_0001726_4596_5186 | 196 |
| 75 | 3300046691 | Ga0495670_0047922 | Ga0495670_0047922_499_1089 | 196 |
| 76 | 3300047318 | Ga0495636_0028224 | Ga0495636_0028224_1334_1924 | 196 |
| 77 | 3300053161 | Ga0500634_0000151 | Ga0500634_0000151_12224_12841 | 196 |
| 78 | 3300003322 | rootL2_10075803 | rootL2_100758032 | 197 |
| 79 | 3300003771 | Ga0055526_1000005 | Ga0055526_100000593 | 197 |
| 80 | 3300003773 | Ga0055537_1000155 | Ga0055537_100015510 | 197 |
| 81 | 3300003775 | Ga0055524_1000005 | Ga0055524_100000594 | 197 |
| 82 | 3300003784 | Ga0055534_1000002 | Ga0055534_1000002235 | 197 |
| 83 | 3300003790 | Ga0055528_1000002 | Ga0055528_1000002235 | 197 |
| 84 | 3300013306 | Ga0163162_11339100 | Ga0163162_113391001 | 197 |
| 85 | 3300013308 | Ga0157375_10474376 | Ga0157375_104743762 | 197 |
| 86 | 3300015689 | Ga0183360_10001 | Ga0183360_100013173 | 197 |
| 87 | 3300025263 | Ga0209565_1000001 | Ga0209565_1000001685 | 197 |
| 88 | 3300025263 | Ga0209565_1001194 | Ga0209565_10011947 | 197 |
| 89 | 3300025273 | Ga0209673_1000001 | Ga0209673_1000001685 | 197 |
| 90 | 3300025291 | Ga0209675_1000001 | Ga0209675_10000011847 | 197 |
| 91 | 3300025295 | Ga0209564_1000001 | Ga0209564_10000012009 | 197 |
| 92 | 3300025299 | Ga0209256_1000006 | Ga0209256_1000006445 | 197 |
| 93 | 3300027364 | Ga0209967_1025673 | Ga0209967_10256731 | 197 |
| 94 | 3300027614 | Ga0209970_1003272 | Ga0209970_10032723 | 197 |
| 95 | 3300027876 | Ga0209974_10009896 | Ga0209974_100098962 | 197 |
| 96 | 3300031548 | Ga0307408_100206005 | Ga0307408_1002060052 | 197 |
| 97 | 3300031901 | Ga0307406_10004205 | Ga0307406_100042057 | 197 |
| 98 | 3300032005 | Ga0307411_10130811 | Ga0307411_101308111 | 197 |
| 99 | 3300003320 | rootH2_10119747 | rootH2_101197471 | 198 |
| 100 | 3300009979 | Ga0105032_101629 | Ga0105032_1016292 | 198 |
| 101 | 3300013297 | Ga0157378_10133713 | Ga0157378_101337133 | 198 |
| 102 | 3300015261 | Ga0182006_1014274 | Ga0182006_10142742 | 198 |
| 103 | 3300005293 | Ga0065715_10193267 | Ga0065715_101932672 | 199 |
| 104 | 3300005334 | Ga0068869_100040514 | Ga0068869_1000405144 | 199 |
| 105 | 3300005353 | Ga0070669_100472531 | Ga0070669_1004725311 | 199 |
| 106 | 3300005367 | Ga0070667_100063914 | Ga0070667_1000639142 | 199 |
| 107 | 3300006051 | Ga0075364_10009249 | Ga0075364_100092492 | 199 |
| 108 | 3300009545 | Ga0105237_10248376 | Ga0105237_102483763 | 199 |
| 109 | 3300009553 | Ga0105249_11335338 | Ga0105249_113353382 | 199 |
| 110 | 3300013296 | Ga0157374_10038034 | Ga0157374_100380342 | 199 |
| 111 | 3300025923 | Ga0207681_10496267 | Ga0207681_104962672 | 199 |
| 112 | 3300025942 | Ga0207689_10081059 | Ga0207689_100810591 | 199 |
| 113 | 3300025986 | Ga0207658_10054839 | Ga0207658_100548393 | 199 |
| 114 | 3300031548 | Ga0307408_100120467 | Ga0307408_1001204672 | 199 |
| 115 | 3300031901 | Ga0307406_10072247 | Ga0307406_100722471 | 199 |
| 116 | 3300032004 | Ga0307414_10014168 | Ga0307414_100141686 | 199 |
| 117 | 3300050491 | nmdc:mga00v17_11071_c1 | nmdc:mga00v17_11071_c1_4247_4855 | 199 |
| 118 | 3300053134 | Ga0500658_0260982 | Ga0500658_0260982_111_719 | 202 |
| 119 | 3300005548 | Ga0070665_100183660 | Ga0070665_1001836602 | 203 |
| 120 | 3300025225 | Ga0209566_106295 | Ga0209566_1062952 | 203 |
| 121 | 3300025256 | Ga0209759_1011209 | Ga0209759_10112092 | 203 |
| 122 | 3300025261 | Ga0209233_1025313 | Ga0209233_10253133 | 203 |
| 123 | 3300028379 | Ga0268266_10145984 | Ga0268266_101459842 | 203 |
| 124 | 3300032004 | Ga0307414_10268254 | Ga0307414_102682542 | 203 |
| 125 | 3300041451 | Ga0451791_1643403 | Ga0451791_1643403_828_1439 | 203 |
| 126 | 3300041486 | Ga0451807_1755858 | Ga0451807_1755858_47_658 | 203 |
| 127 | 3300041494 | Ga0451837_0735071 | Ga0451837_0735071_377_988 | 203 |
| 128 | iso_pu_bacteria | 2643221579 | 2643907004 | 203 |
| 129 | iso_pu_bacteria | 2643221581 | 2643913596 | 203 |
| 130 | iso_pu_bacteria | 2884411467 | 2884416077 | 203 |
| 131 | iso_pu_bacteria | 2923516293 | 2923519527 | 203 |
| 132 | iso_pu_bacteria | 2928963466 | 2928965978 | 203 |
| 133 | 3300002737 | JGI25162J39368_1001798 | JGI25162J39368_10017988 | 204 |
| 134 | 3300002772 | JGI25164J39214_1007660 | JGI25164J39214_10076602 | 204 |
| 135 | 3300003762 | Ga0055542_1000069 | Ga0055542_100006952 | 204 |
| 136 | 3300005337 | Ga0070682_100320178 | Ga0070682_1003201782 | 204 |
| 137 | 3300005344 | Ga0070661_100005371 | Ga0070661_1000053713 | 204 |
| 138 | 3300005844 | Ga0068862_100000379 | Ga0068862_10000037937 | 204 |
| 139 | 3300005844 | Ga0068862_100060730 | Ga0068862_1000607303 | 204 |
| 140 | 3300009551 | Ga0105238_10064859 | Ga0105238_100648593 | 204 |
| 141 | 3300025231 | Ga0207427_100893 | Ga0207427_1008935 | 204 |
| 142 | 3300025233 | Ga0209437_100113 | Ga0209437_10011353 | 204 |
| 143 | 3300025242 | Ga0209258_105711 | Ga0209258_1057112 | 204 |
| 144 | 3300025254 | Ga0209148_1000005 | Ga0209148_10000051420 | 204 |
| 145 | 3300025261 | Ga0209233_1031965 | Ga0209233_10319652 | 204 |
| 146 | 3300025920 | Ga0207649_10059006 | Ga0207649_100590063 | 204 |
| 147 | 3300025924 | Ga0207694_10126557 | Ga0207694_101265572 | 204 |
| 148 | 3300028380 | Ga0268265_10000163 | Ga0268265_1000016376 | 204 |
| 149 | 3300028381 | Ga0268264_10036857 | Ga0268264_100368574 | 204 |
| 150 | 3300028381 | Ga0268264_10067984 | Ga0268264_100679842 | 204 |
| 151 | 3300041407 | Ga0439447_000572 | Ga0439447_000572_6815_7516 | 204 |
| 152 | 3300041413 | Ga0439465_0005919 | Ga0439465_0005919_428_1042 | 204 |
| 153 | 3300042007 | Ga0439449_0102651 | Ga0439449_0102651_373_987 | 204 |
| 154 | 3300042156 | Ga0439446_0086787 | Ga0439446_0086787_76_690 | 204 |
| 155 | 3300046616 | Ga0495668_0002362 | Ga0495668_0002362_10209_10901 | 204 |
| 156 | 3300048917 | Ga0496114_0361402 | Ga0496114_0361402_215_847 | 204 |
| 157 | iso_pu_bacteria | 2739367700 | 2739729838 | 204 |
| 158 | 3300048918 | Ga0496115_0016660 | Ga0496115_0016660_1648_2280 | 205 |
| 159 | 3300009993 | Ga0105028_100356 | Ga0105028_1003566 | 206 |
| 160 | 3300013306 | Ga0163162_10181888 | Ga0163162_101818882 | 206 |
| 161 | 3300014969 | Ga0157376_10019218 | Ga0157376_100192183 | 206 |
| 162 | 3300046460 | Ga0495638_0000479 | Ga0495638_0000479_45499_46176 | 206 |
| 163 | 3300046471 | Ga0495650_0000134 | Ga0495650_0000134_119911_120588 | 206 |
| 164 | 3300048907 | Ga0496104_0116687 | Ga0496104_0116687_1857_2534 | 206 |
| 165 | 3300048918 | Ga0496115_0000776 | Ga0496115_0000776_20420_21097 | 206 |
| 166 | 2162886007 | SwRhRL2b_contig_372769 | SwRhRL2b_0657.00001590 | 207 |
| 167 | 3300003781 | Ga0055536_1001044 | Ga0055536_10010444 | 207 |
| 168 | 3300005289 | Ga0065704_10001079 | Ga0065704_100010797 | 207 |
| 169 | 3300025228 | Ga0209672_101611 | Ga0209672_1016117 | 207 |
| 170 | 3300025292 | Ga0209676_1000052 | Ga0209676_100005227 | 207 |
| 171 | 3300026067 | Ga0207678_10369328 | Ga0207678_103693282 | 207 |
| 172 | 3300031665 | Ga0316575_10017433 | Ga0316575_100174332 | 207 |
| 173 | 3300032133 | Ga0316583_10144786 | Ga0316583_101447861 | 207 |
| 174 | 3300041413 | Ga0439465_0079394 | Ga0439465_0079394_199_846 | 207 |
| 175 | 3300041453 | Ga0451797_1275424 | Ga0451797_1275424_45_674 | 207 |
| 176 | 3300042004 | Ga0439445_0010694 | Ga0439445_0010694_1007_1654 | 207 |
| 177 | 3300042007 | Ga0439449_0000110 | Ga0439449_0000110_14679_15326 | 207 |
| 178 | 3300046460 | Ga0495638_0000144 | Ga0495638_0000144_44337_45020 | 207 |
| 179 | 3300046507 | Ga0495606_0000386 | Ga0495606_0000386_5236_5907 | 207 |
| 180 | 3300046660 | Ga0495625_0030039 | Ga0495625_0030039_1135_1818 | 207 |
| 181 | 3300046694 | Ga0495649_0002304 | Ga0495649_0002304_11449_12120 | 207 |
| 182 | 3300047320 | Ga0495672_0026950 | Ga0495672_0026950_735_1385 | 207 |
| 183 | 3300048917 | Ga0496114_0076079 | Ga0496114_0076079_717_1340 | 207 |
| 184 | 3300048918 | Ga0496115_0000193 | Ga0496115_0000193_8369_9040 | 207 |
| 185 | 3300048924 | Ga0496121_0004653 | Ga0496121_0004653_4948_5625 | 207 |
| 186 | 3300048929 | Ga0496126_0020962 | Ga0496126_0020962_4266_4937 | 207 |
| 187 | 3300048929 | Ga0496126_0052845 | Ga0496126_0052845_2660_3283 | 207 |
| 188 | 3300048929 | Ga0496126_0059056 | Ga0496126_0059056_1180_1851 | 207 |
| 189 | 3300053079 | Ga0500610_0000620 | Ga0500610_0000620_4779_5438 | 207 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3btz-assembly1.cif.gz_A | crystal structure of human abh2 cross-linked to dsdna | 0.9616 | 12 | 201 |
| 3buc-assembly1.cif.gz_A | x-ray structure of human abh2 bound to dsdna with mn(ii) and 2kg | 0.956 | 11 | 201 |
| 3rzl-assembly2.cif.gz_D | duplex interrogation by a direct dna repair protein in the search of damage | 0.9478 | 11 | 201 |
| 3rzl-assembly1.cif.gz_A | duplex interrogation by a direct dna repair protein in the search of damage | 0.9417 | 8 | 201 |
| 3rzm-assembly1.cif.gz_A | duplex interrogation by a direct dna repair protein in the search of damage | 0.94 | 11 | 201 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3rzlA00 | Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like | 0.9417 | 8 | 201 | 2.60.120.590 |
| af_Q9SIE0_90_314_2.60.120.590 | Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like | 0.9393 | 11 | 201 | 2.60.120.590 |
| 3rzlA00 | Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like | 0.9276 | 8 | 201 | 2.60.120.590 |
| 2iuwA00 | Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like | 0.8843 | 7 | 203 | 2.60.120.590 |
| af_I1MFT0_7_203_2.60.120.590 | Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like | 0.8665 | 24 | 201 | 2.60.120.590 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A354Y6V4-F1-model_v4 | Alpha-ketoglutarate-dependent dioxygenase AlkB | 0.9977 | 103 | 201 |
GO:0006307
GO:0008198 GO:0035516 GO:0051747 |
| AF-A0A1Y6H3Z7-F1-model_v4 | DNA repair system specific for alkylated DNA | 0.9938 | 110 | 202 |
GO:0006307
GO:0008198 GO:0035516 GO:0051747 |
| AF-A0A7Y3C6G6-F1-model_v4 | Alpha-ketoglutarate-dependent dioxygenase AlkB | 0.993 | 117 | 202 |
GO:0006307
GO:0008198 GO:0035516 GO:0051747 |
| AF-A0A432C9F2-F1-model_v4 | Alpha-ketoglutarate-dependent dioxygenase AlkB | 0.9916 | 105 | 202 |
GO:0006307
GO:0051213 |
| AF-Q609W8-F1-model_v4 | 2OG-Fe(II) oxygenase family domain protein | 0.9909 | 65 | 203 |
GO:0006307
GO:0051213 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar