F291202

General Info

Members Datasets Scaffolds Average Seq Length
189 138 378 274

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10035514|Ga0307414_100355142
Length 302
Sequence MASMAPDNAAASSKDPGRESWIFVGERRVSAIPPDDRALAYGDGLFETMRACRGELPWWDAHWSRLERGAVRLRLAMPSPAKVRSEAAQLLDGRDGVLKLQLGRGSGGRGYAPPLAPEPSWILSRHPLPSSHPAAGLTLRWCDTQLALQPALAGIKHCNRLEQVLARAEWQIPGAIDGDADEGLMRSTDGDVVCATAANLFVLHGERWRTPPVDRCGVAGVCRQWLLDRFEVEQARLSVADVETADAIVLTNAVRGILPVARLGSRRWAAHRRVAGWRRSLAQANPAFAVPGADPSNPPEMP

Samples

Sample ID Description Type Environment
1 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
31 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
37 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
38 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
39 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
44 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
46 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
69 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
81 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
82 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
83 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
84 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
85 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
86 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
87 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
88 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
89 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
92 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
93 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
94 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
95 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
96 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
97 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
103 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
104 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
117 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
118 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
121 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
122 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
124 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
125 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
126 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
127 2643221559 Lysobacter sp. Root559 Isolate Unclassified
128 2643221573 Lysobacter sp. Root604 Isolate Unclassified
129 2643221586 Lysobacter sp. Root667 Isolate Unclassified
130 2643221593 Lysobacter sp. Root690 Isolate Unclassified
131 2643221612 Lysobacter sp. Root76 Isolate Unclassified
132 2643221695 Lysobacter sp. Root494 Isolate Unclassified
133 2643221720 Lysobacter sp. Root916 Isolate Unclassified
134 2643221727 Lysobacter sp. Root96 Isolate Unclassified
135 2643221728 Lysobacter sp. Root983 Isolate Unclassified
136 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
137 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
138 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.06
Metatranscriptomes 0
Isolates 7.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.75
Nodule 0
Rhizoplane 3.17
Rhizosphere 66.67
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307414_10035514 3300032004 Bacteria 3318
2 JGI25151J46595_10004262 3300003187 Bacteria 7603
3 rootH2_10097869 3300003320 Bacteria 2698
4 rootH1_10221059 3300003323 Bacteria 1935
5 Ga0055526_1000139 3300003771 Bacteria 63930
6 Ga0055526_1017721 3300003771 Bacteria 2703
7 Ga0055537_1000323 3300003773 Bacteria 32553
8 Ga0055524_1000206 3300003775 Bacteria 63929
9 Ga0055524_1038124 3300003775 Bacteria 1262
10 Ga0055536_1013326 3300003781 Bacteria 2980
11 Ga0055534_1000164 3300003784 Bacteria 49529
12 Ga0055528_1000027 3300003790 Bacteria 126420
13 Ga0055531_10005719 3300003794 Bacteria 7207
14 Ga0055531_10016143 3300003794 Bacteria 3240
15 Ga0065715_10040322 3300005293 Bacteria 1091
16 Ga0065715_10106015 3300005293 Bacteria 2854
17 Ga0065715_10171189 3300005293 Bacteria 1536
18 Ga0068868_100074388 3300005338 Bacteria 2713
19 Ga0070660_100050695 3300005339 Bacteria 3194
20 Ga0070661_100074982 3300005344 Bacteria 2492
21 Ga0070671_100079144 3300005355 Bacteria 2747
22 Ga0070659_100165585 3300005366 Bacteria 1809
23 Ga0070709_10008526 3300005434 Bacteria 5633
24 Ga0070678_100416600 3300005456 Bacteria 1170
25 Ga0070681_10131010 3300005458 Bacteria 2440
26 Ga0068867_100032858 3300005459 Bacteria 3754
27 Ga0070679_100066368 3300005530 Bacteria 3597
28 Ga0070679_100276983 3300005530 Bacteria 1631
29 Ga0068853_100615271 3300005539 Bacteria 1032
30 Ga0070672_100000541 3300005543 Bacteria 22176
31 Ga0070696_100120021 3300005546 Bacteria 1902
32 Ga0070664_100212579 3300005564 Bacteria 1729
33 Ga0068852_100168154 3300005616 Bacteria 2053
34 Ga0070716_100046311 3300006173 Unclassified 2447
35 Ga0070716_100349246 3300006173 Bacteria 1046
36 Ga0070712_100075739 3300006175 Bacteria 2421
37 Ga0157373_10305861 3300013100 Bacteria 1129
38 Ga0157371_10133369 3300013102 Bacteria 1767
39 Ga0157369_10025483 3300013105 Bacteria 6567
40 Ga0157372_10283400 3300013307 Bacteria 1927
41 Ga0163163_10664914 3300014325 Bacteria 1105
42 Ga0182008_10088084 3300014497 Bacteria 1529
43 Ga0183360_10001 3300015689 Bacteria 3943671
44 Ga0207425_1006891 3300025245 Bacteria 3064
45 Ga0209565_1000005 3300025263 Bacteria 947317
46 Ga0209565_1017237 3300025263 Bacteria 1587
47 Ga0209673_1000011 3300025273 Bacteria 586604
48 Ga0209673_1009173 3300025273 Bacteria 4318
49 Ga0209130_1004539 3300025284 Bacteria 5222
50 Ga0209675_1000004 3300025291 Bacteria 947166
51 Ga0209675_1030548 3300025291 Bacteria 1283
52 Ga0209675_1033308 3300025291 Bacteria 1197
53 Ga0209676_1000857 3300025292 Bacteria 39244
54 Ga0209676_1006052 3300025292 Bacteria 6094
55 Ga0209676_1006913 3300025292 Bacteria 5477
56 Ga0209676_1009277 3300025292 Bacteria 4262
57 Ga0209676_1009988 3300025292 Bacteria 4018
58 Ga0209676_1016423 3300025292 Bacteria 2672
59 Ga0209025_1000005 3300025294 Bacteria 1272149
60 Ga0209025_1002782 3300025294 Bacteria 17649
61 Ga0209025_1009657 3300025294 Bacteria 6678
62 Ga0209025_1058267 3300025294 Bacteria 1468
63 Ga0209564_1000018 3300025295 Bacteria 586913
64 Ga0209564_1023138 3300025295 Bacteria 2168
65 Ga0209758_1044666 3300025297 Bacteria 1616
66 Ga0209050_1001432 3300025298 Bacteria 25688
67 Ga0209050_1043369 3300025298 Bacteria 1216
68 Ga0209256_1000031 3300025299 Bacteria 410189
69 Ga0209256_1001506 3300025299 Bacteria 23600
70 Ga0209256_1004573 3300025299 Bacteria 8574
71 Ga0209256_1004581 3300025299 Bacteria 8565
72 Ga0209051_1003199 3300025303 Bacteria 10929
73 Ga0209257_1005633 3300025304 Bacteria 8668
74 Ga0209257_1005693 3300025304 Bacteria 8572
75 Ga0209257_1005702 3300025304 Bacteria 8551
76 Ga0207699_10005487 3300025906 Bacteria 6073
77 Ga0207705_10223641 3300025909 Bacteria 1430
78 Ga0207707_10151528 3300025912 Bacteria 2027
79 Ga0207693_10045032 3300025915 Bacteria 3467
80 Ga0207663_10225634 3300025916 Bacteria 1365
81 Ga0207657_10013572 3300025919 Bacteria 7991
82 Ga0207652_10165559 3300025921 Bacteria 1982
83 Ga0207644_10007872 3300025931 Bacteria 6964
84 Ga0207690_10123016 3300025932 Bacteria 1887
85 Ga0207665_10017580 3300025939 Bacteria 4699
86 Ga0207665_10292462 3300025939 Bacteria 1215
87 Ga0207691_10005113 3300025940 Bacteria 12659
88 Ga0207668_10012110 3300025972 Bacteria 5270
89 Ga0207677_10185308 3300026023 Bacteria 1641
90 Ga0209995_1004583 3300027471 Bacteria 2213
91 Ga0209999_1001382 3300027543 Bacteria 4159
92 Ga0209982_1000688 3300027552 Bacteria 4313
93 Ga0209970_1002597 3300027614 Bacteria 3059
94 Ga0209983_1001226 3300027665 Bacteria 5694
95 Ga0316177_1104201 3300030731 Bacteria 5162
96 Ga0314311_1226009 3300030733 Bacteria 6816
97 Ga0307408_100330827 3300031548 Bacteria 1286
98 Ga0307405_10442525 3300031731 Bacteria 1028
99 Ga0307412_10038451 3300031911 Bacteria 3082
100 Ga0307412_10052719 3300031911 Bacteria 2695
101 Ga0307412_10466957 3300031911 Bacteria 1043
102 Ga0307409_100362196 3300031995 Bacteria 1372
103 Ga0307416_100379906 3300032002 Bacteria 1442
104 Ga0307414_10081949 3300032004 Bacteria 2364
105 Ga0307414_10279585 3300032004 Bacteria 1402
106 Ga0307414_10472189 3300032004 Bacteria 1104
107 Ga0307411_10057893 3300032005 Bacteria 2562
108 Ga0307411_10076219 3300032005 Bacteria 2292
109 Ga0307411_10275620 3300032005 Bacteria 1336
110 Ga0395900_0244819 3300037418 Bacteria 1797
111 Ga0395900_0331717 3300037418 Bacteria 1499
112 Ga0395898_0085937 3300037466 Bacteria 3032
113 Ga0395898_0683317 3300037466 Bacteria 969
114 Ga0395905_0002519 3300037471 Bacteria 20234
115 Ga0395905_0022985 3300037471 Bacteria 5893
116 Ga0395901_0046440 3300038443 Bacteria 4511
117 Ga0395901_0109089 3300038443 Bacteria 2906
118 Ga0400483_231819 3300039062 Bacteria 3760
119 Ga0436362_0358162 3300039453 Bacteria 5283
120 Ga0439436_0002958 3300041404 Bacteria 5149
121 Ga0439465_0056326 3300041413 Bacteria 1295
122 Ga0439432_004051 3300042006 Bacteria 5375
123 Ga0439432_009679 3300042006 Bacteria 3354
124 Ga0439432_093981 3300042006 Bacteria 901
125 Ga0439449_0014700 3300042007 Bacteria 2942
126 Ga0439449_0039598 3300042007 Bacteria 1752
127 Ga0439452_025194 3300042010 Bacteria 1513
128 Ga0439457_027852 3300042014 Bacteria 1251
129 Ga0451577_0002646 3300042876 Bacteria 20977
130 Ga0453684_0000672 3300044712 Bacteria 122591
131 Ga0451576_0000268 3300045051 Bacteria 127422
132 Ga0495598_0054887 3300046537 Bacteria 1211
133 Ga0495621_0002707 3300046539 Bacteria 4804
134 Ga0495621_0050090 3300046539 Bacteria 1492
135 Ga0495668_0014086 3300046616 Bacteria 4699
136 Ga0495659_0012642 3300046664 Bacteria 2739
137 Ga0495659_0066314 3300046664 Bacteria 1344
138 Ga0495636_0003954 3300047318 Bacteria 5788
139 Ga0495636_0013687 3300047318 Bacteria 3220
140 Ga0495636_0042597 3300047318 Bacteria 1887
141 Ga0495636_0047562 3300047318 Bacteria 1791
142 Ga0495636_0059654 3300047318 Bacteria 1610
143 Ga0496100_0258249 3300048903 Bacteria 1291
144 Ga0496101_0103379 3300048904 Bacteria 2135
145 Ga0496104_0278493 3300048907 Bacteria 1586
146 Ga0496108_0143925 3300048911 Bacteria 2054
147 Ga0496110_0206912 3300048913 Bacteria 1783
148 Ga0496111_0124209 3300048914 Bacteria 1907
149 Ga0496121_0013987 3300048924 Bacteria 8570
150 Ga0501290_000566 3300049513 Bacteria 5604
151 Ga0501031_0168281 3300049568 Bacteria 1432
152 Ga0501032_0010334 3300049569 Bacteria 6731
153 Ga0501033_0003528 3300049570 Bacteria 12797
154 Ga0501033_0170077 3300049570 Bacteria 1565
155 Ga0501033_0310021 3300049570 Bacteria 1110
156 Ga0501034_0008927 3300049571 Bacteria 10538
157 Ga0501036_0027265 3300049572 Bacteria 4826
158 Ga0501037_0002138 3300049573 Bacteria 14302
159 Ga0501038_0023837 3300049574 Bacteria 5464
160 Ga0501039_0011088 3300049575 Bacteria 6868
161 Ga0501043_0003623 3300049579 Bacteria 12688
162 Ga0501043_0093771 3300049579 Bacteria 2360
163 Ga0501047_0016220 3300049581 Bacteria 7107
164 Ga0501047_0162054 3300049581 Bacteria 2108
165 Ga0501068_0149597 3300049584 Bacteria 1467
166 Ga0501071_0245557 3300049587 Bacteria 1350
167 Ga0501073_0005037 3300049589 Bacteria 9902
168 Ga0501223_018990 3300049663 Bacteria 1351
169 Ga0501225_0024754 3300049705 Bacteria 1652
170 Ga0501080_0002950 3300049742 Bacteria 14958
171 Ga0501266_012518 3300049763 Bacteria 1095
172 Ga0501275_000454 3300049772 Bacteria 4611
173 Ga0501035_0059988 3300049822 Bacteria 3387
174 Ga0501044_0006108 3300049823 Bacteria 13290
175 2525555890 2524614729 Bacteria 3091755
176 2572255275 2571042365 Bacteria 3289345
177 2630650904 2627854209 Bacteria 3093011
178 2643818724 2643221559 Bacteria 4424915
179 2643878379 2643221573 Bacteria 4784121
180 2643940975 2643221586 Bacteria 4446529
181 2643975799 2643221593 Bacteria 6296053
182 2644079983 2643221612 Bacteria 4361984
183 2644529942 2643221695 Bacteria 3441323
184 2644659683 2643221720 Bacteria 4694283
185 2644695578 2643221727 Bacteria 4415595
186 2644700572 2643221728 Bacteria 4797149
187 2941493428 2941489479 Bacteria 6313767
188 2995952477 2995948881 Bacteria 6358104
189 8003016322 8003014200 Bacteria 4059994
190 Ga0307414_10035514
191 JGI25151J46595_10004262
192 rootH2_10097869
193 rootH1_10221059
194 Ga0055526_1000139
195 Ga0055526_1017721
196 Ga0055537_1000323
197 Ga0055524_1000206
198 Ga0055524_1038124
199 Ga0055536_1013326
200 Ga0055534_1000164
201 Ga0055528_1000027
202 Ga0055531_10005719
203 Ga0055531_10016143
204 Ga0065715_10040322
205 Ga0065715_10106015
206 Ga0065715_10171189
207 Ga0068868_100074388
208 Ga0070660_100050695
209 Ga0070661_100074982
210 Ga0070671_100079144
211 Ga0070659_100165585
212 Ga0070709_10008526
213 Ga0070678_100416600
214 Ga0070681_10131010
215 Ga0068867_100032858
216 Ga0070679_100066368
217 Ga0070679_100276983
218 Ga0068853_100615271
219 Ga0070672_100000541
220 Ga0070696_100120021
221 Ga0070664_100212579
222 Ga0068852_100168154
223 Ga0070716_100046311
224 Ga0070716_100349246
225 Ga0070712_100075739
226 Ga0157373_10305861
227 Ga0157371_10133369
228 Ga0157369_10025483
229 Ga0157372_10283400
230 Ga0163163_10664914
231 Ga0182008_10088084
232 Ga0183360_10001
233 Ga0207425_1006891
234 Ga0209565_1000005
235 Ga0209565_1017237
236 Ga0209673_1000011
237 Ga0209673_1009173
238 Ga0209130_1004539
239 Ga0209675_1000004
240 Ga0209675_1030548
241 Ga0209675_1033308
242 Ga0209676_1000857
243 Ga0209676_1006052
244 Ga0209676_1006913
245 Ga0209676_1009277
246 Ga0209676_1009988
247 Ga0209676_1016423
248 Ga0209025_1000005
249 Ga0209025_1002782
250 Ga0209025_1009657
251 Ga0209025_1058267
252 Ga0209564_1000018
253 Ga0209564_1023138
254 Ga0209758_1044666
255 Ga0209050_1001432
256 Ga0209050_1043369
257 Ga0209256_1000031
258 Ga0209256_1001506
259 Ga0209256_1004573
260 Ga0209256_1004581
261 Ga0209051_1003199
262 Ga0209257_1005633
263 Ga0209257_1005693
264 Ga0209257_1005702
265 Ga0207699_10005487
266 Ga0207705_10223641
267 Ga0207707_10151528
268 Ga0207693_10045032
269 Ga0207663_10225634
270 Ga0207657_10013572
271 Ga0207652_10165559
272 Ga0207644_10007872
273 Ga0207690_10123016
274 Ga0207665_10017580
275 Ga0207665_10292462
276 Ga0207691_10005113
277 Ga0207668_10012110
278 Ga0207677_10185308
279 Ga0209995_1004583
280 Ga0209999_1001382
281 Ga0209982_1000688
282 Ga0209970_1002597
283 Ga0209983_1001226
284 Ga0316177_1104201
285 Ga0314311_1226009
286 Ga0307408_100330827
287 Ga0307405_10442525
288 Ga0307412_10038451
289 Ga0307412_10052719
290 Ga0307412_10466957
291 Ga0307409_100362196
292 Ga0307416_100379906
293 Ga0307414_10081949
294 Ga0307414_10279585
295 Ga0307414_10472189
296 Ga0307411_10057893
297 Ga0307411_10076219
298 Ga0307411_10275620
299 Ga0395900_0244819
300 Ga0395900_0331717
301 Ga0395898_0085937
302 Ga0395898_0683317
303 Ga0395905_0002519
304 Ga0395905_0022985
305 Ga0395901_0046440
306 Ga0395901_0109089
307 Ga0400483_231819
308 Ga0436362_0358162
309 Ga0439436_0002958
310 Ga0439465_0056326
311 Ga0439432_004051
312 Ga0439432_009679
313 Ga0439432_093981
314 Ga0439449_0014700
315 Ga0439449_0039598
316 Ga0439452_025194
317 Ga0439457_027852
318 Ga0451577_0002646
319 Ga0453684_0000672
320 Ga0451576_0000268
321 Ga0495598_0054887
322 Ga0495621_0002707
323 Ga0495621_0050090
324 Ga0495668_0014086
325 Ga0495659_0012642
326 Ga0495659_0066314
327 Ga0495636_0003954
328 Ga0495636_0013687
329 Ga0495636_0042597
330 Ga0495636_0047562
331 Ga0495636_0059654
332 Ga0496100_0258249
333 Ga0496101_0103379
334 Ga0496104_0278493
335 Ga0496108_0143925
336 Ga0496110_0206912
337 Ga0496111_0124209
338 Ga0496121_0013987
339 Ga0501290_000566
340 Ga0501031_0168281
341 Ga0501032_0010334
342 Ga0501033_0003528
343 Ga0501033_0170077
344 Ga0501033_0310021
345 Ga0501034_0008927
346 Ga0501036_0027265
347 Ga0501037_0002138
348 Ga0501038_0023837
349 Ga0501039_0011088
350 Ga0501043_0003623
351 Ga0501043_0093771
352 Ga0501047_0016220
353 Ga0501047_0162054
354 Ga0501068_0149597
355 Ga0501071_0245557
356 Ga0501073_0005037
357 Ga0501223_018990
358 Ga0501225_0024754
359 Ga0501080_0002950
360 Ga0501266_012518
361 Ga0501275_000454
362 Ga0501035_0059988
363 Ga0501044_0006108
364 2525555890
365 2572255275
366 2630650904
367 2643818724
368 2643878379
369 2643940975
370 2643975799
371 2644079983
372 2644529942
373 2644659683
374 2644695578
375 2644700572
376 2941493428
377 2995952477
378 8003016322

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01063

Aminotran_4

Amino-transferase class IV

44

263

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2y4r-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate lyase from pseudomonas aeruginosa 0.9272 6 262
1i2k-assembly1.cif.gz_A aminodeoxychorismate lyase from escherichia coli 0.9255 3 256
3lul-assembly1.cif.gz_A crystal structure of putative 4-amino-4-deoxychorismate lyase. (yp_094631.1) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 1.78 a resolution 0.9153 13 264
1et0-assembly1.cif.gz_A crystal structure of aminodeoxychorismate lyase from escherichia coli 0.9122 3 267
1et0-assembly1.cif.gz_A crystal structure of aminodeoxychorismate lyase from escherichia coli 0.9053 3 267
ID Description Score Start End Superfamily
2xpfB02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9509 118 262 3.20.10.10
3lulA02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9062 116 264 3.20.10.10
3qqmH02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9031 111 241 3.20.10.10
3wwiB02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9028 118 262 3.20.10.10
4cmdA02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.8924 119 264 3.20.10.10
ID Description Score Start End GO Terms
AF-A0A6J4LS03-F1-model_v4 Aminodeoxychorismate lyase (EC 4.1.3.38) 0.9777 2 269 GO:0005829
GO:0008153
GO:0008696
GO:0030170
GO:0046656
AF-A0A352QUN4-F1-model_v4 Aminodeoxychorismate lyase (EC 4.1.3.38) 0.9724 3 266 GO:0005829
GO:0008153
GO:0008696
GO:0030170
GO:0046656
AF-A0A3B9K3I0-F1-model_v4 Probable branched-chain-amino-acid aminotransferase (EC 4.1.3.38) 0.9584 13 263 GO:0005829
GO:0008153
GO:0008696
GO:0030170
GO:0046656
AF-A0A6J4LS03-F1-model_v4 Aminodeoxychorismate lyase (EC 4.1.3.38) 0.9565 2 269 GO:0005829
GO:0008153
GO:0008696
GO:0030170
GO:0046656
AF-A0A0B8P106-F1-model_v4 Aminodeoxychorismate lyase (EC 4.1.3.38) 0.9504 124 262 GO:0005829
GO:0008153
GO:0008696

Map