F291278

General Info

Members Datasets Scaffolds Average Seq Length
189 138 186 295

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_241780|Ga0400483_241780_204_1079
Length 291
Sequence MTGFDASPLPKRYAIVEGKQMAYHEVGDGRPVVFLHGNPTSSYLWRNIIPHLSDRARCIAPDLIGQGDSDKLDDTGPDSYRFVEHRRYLDGLLDQLDLGDDIVFVIHDWGSALGFDWARRHPERVGGVVFMEAIVRPIDSWNEWPEAARGIFQGFRSDAGEEMVITKNLFVEAVLPGSIMRTLSDDEHNQYRKPFLEPEHRRPTLSWPRQIPIEGEPADVVEIVADYAQWLPTTEFPKLFVNAEPGAILGDSQRAFVRTWPNLSEVTVAGIHFIQEDSPHDIGQAIADWLP

Samples

Sample ID Description Type Environment
1 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
2 2558860280 Kutzneria sp. 744 Isolate Unclassified
3 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
79 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
80 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
83 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
84 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
85 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
86 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
92 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
93 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
94 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
95 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
96 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
97 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
98 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
103 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
124 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
135 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
136 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
137 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
138 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.41
Metatranscriptomes 0
Isolates 1.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.29
Rhizosphere 87.83
Stem 0
Stem Tuber 0
Unclassified 6.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10038539 3300003203 Bacteria 1712
2 Ga0070676_10098473 3300005328 Bacteria 1803
3 Ga0070690_100191923 3300005330 Bacteria 1417
4 Ga0070666_10348317 3300005335 Bacteria 1059
5 Ga0070689_100089207 3300005340 Bacteria 2428
6 Ga0070691_10101776 3300005341 Bacteria 1428
7 Ga0070668_100481385 3300005347 Bacteria 1072
8 Ga0070674_100048266 3300005356 Bacteria 2921
9 Ga0070667_100085644 3300005367 Bacteria 2703
10 Ga0070714_100226500 3300005435 Bacteria 1721
11 Ga0070710_10029919 3300005437 Bacteria 2926
12 Ga0070700_100008120 3300005441 Bacteria 5706
13 Ga0070708_100003361 3300005445 Bacteria 12533
14 Ga0070708_100017470 3300005445 Bacteria 5986
15 Ga0070678_100014119 3300005456 Bacteria 5029
16 Ga0070706_100020207 3300005467 Bacteria 6136
17 Ga0070707_100012445 3300005468 Bacteria 7947
18 Ga0070707_100039070 3300005468 Bacteria 4535
19 Ga0070698_100038604 3300005471 Bacteria 4920
20 Ga0070698_100063402 3300005471 Bacteria 3727
21 Ga0070698_100331478 3300005471 Bacteria 1453
22 Ga0070699_100051508 3300005518 Bacteria 3564
23 Ga0070684_100051930 3300005535 Bacteria 3563
24 Ga0070697_100091760 3300005536 Bacteria 2512
25 Ga0070697_100133553 3300005536 Bacteria 2083
26 Ga0070697_100196934 3300005536 Bacteria 1711
27 Ga0070672_100054058 3300005543 Bacteria 3142
28 Ga0068859_100039004 3300005617 Bacteria 4764
29 Ga0068864_100206341 3300005618 Bacteria 1807
30 Ga0068861_100008044 3300005719 Bacteria 7258
31 Ga0068862_100605726 3300005844 Bacteria 1052
32 Ga0081539_10001258 3300005985 Bacteria 44901
33 Ga0081539_10050214 3300005985 Bacteria 2361
34 Ga0070715_10007334 3300006163 Bacteria 3794
35 Ga0070716_100235444 3300006173 Bacteria 1239
36 Ga0070712_100010381 3300006175 Bacteria 5875
37 Ga0070712_100064160 3300006175 Bacteria 2604
38 Ga0070712_100070194 3300006175 Bacteria 2502
39 Ga0075428_100118666 3300006844 Bacteria 2881
40 Ga0075428_100193634 3300006844 Bacteria 2199
41 Ga0075428_100220557 3300006844 Bacteria 2048
42 Ga0075428_100629844 3300006844 Bacteria 1144
43 Ga0075430_100024089 3300006846 Bacteria 5182
44 Ga0075430_100065572 3300006846 Bacteria 3050
45 Ga0075430_100219922 3300006846 Bacteria 1576
46 Ga0075431_100071350 3300006847 Bacteria 3584
47 Ga0075434_100130316 3300006871 Bacteria 2533
48 Ga0075429_100088577 3300006880 Bacteria 2698
49 Ga0075429_100384382 3300006880 Bacteria 1229
50 Ga0097620_100039003 3300006931 Bacteria 4764
51 Ga0075435_100043320 3300007076 Bacteria 3603
52 Ga0099794_10057956 3300007265 Bacteria 1877
53 Ga0099795_10000687 3300007788 Bacteria 6527
54 Ga0099795_10065467 3300007788 Bacteria 1359
55 Ga0111539_10023087 3300009094 Bacteria 7640
56 Ga0111539_10045263 3300009094 Bacteria 5268
57 Ga0111539_10075040 3300009094 Bacteria 3984
58 Ga0111539_10145109 3300009094 Bacteria 2779
59 Ga0105247_10012670 3300009101 Bacteria 5059
60 Ga0114129_10101531 3300009147 Bacteria 3980
61 Ga0114129_10173769 3300009147 Bacteria 2935
62 Ga0114129_10420306 3300009147 Bacteria 1758
63 Ga0114129_10641525 3300009147 Bacteria 1372
64 Ga0105248_10087092 3300009177 Bacteria 3514
65 Ga0105237_10034522 3300009545 Bacteria 5121
66 Ga0105238_10003598 3300009551 Bacteria 15440
67 Ga0105249_10159433 3300009553 Bacteria 2179
68 Ga0099796_10001114 3300010159 Bacteria 5165
69 Ga0099796_10103119 3300010159 Bacteria 1076
70 Ga0157375_10557217 3300013308 Bacteria 1307
71 Ga0163163_10032710 3300014325 Bacteria 5025
72 Ga0163163_10087129 3300014325 Bacteria 3132
73 Ga0213876_10085506 3300021384 Bacteria 1669
74 Ga0213876_10163499 3300021384 Bacteria 1184
75 Ga0213875_10022746 3300021388 Bacteria 2998
76 Ga0207682_10003255 3300025893 Bacteria 7104
77 Ga0207692_10040238 3300025898 Bacteria 2306
78 Ga0207645_10013981 3300025907 Bacteria 5384
79 Ga0207684_10008144 3300025910 Bacteria 9347
80 Ga0207693_10017056 3300025915 Bacteria 5797
81 Ga0207693_10059114 3300025915 Bacteria 3003
82 Ga0207693_10067101 3300025915 Bacteria 2809
83 Ga0207662_10031205 3300025918 Bacteria 3096
84 Ga0207646_10011647 3300025922 Bacteria 8504
85 Ga0207646_10118767 3300025922 Bacteria 2375
86 Ga0207646_10145019 3300025922 Bacteria 2139
87 Ga0207694_10081558 3300025924 Bacteria 2541
88 Ga0207650_10101141 3300025925 Bacteria 2219
89 Ga0207650_10250833 3300025925 Bacteria 1433
90 Ga0207664_10143742 3300025929 Bacteria 2021
91 Ga0207709_10047729 3300025935 Bacteria 2605
92 Ga0207669_10255196 3300025937 Bacteria 1308
93 Ga0207665_10232442 3300025939 Bacteria 1355
94 Ga0207691_10001672 3300025940 Bacteria 21925
95 Ga0207691_10073086 3300025940 Bacteria 3093
96 Ga0207689_10020061 3300025942 Bacteria 5627
97 Ga0207651_10336202 3300025960 Bacteria 1267
98 Ga0207658_10147292 3300025986 Bacteria 1914
99 Ga0207708_10403877 3300026075 Bacteria 1130
100 Ga0207648_10009261 3300026089 Bacteria 9461
101 Ga0207676_10010536 3300026095 Bacteria 6586
102 Ga0207675_100014581 3300026118 Bacteria 7324
103 Ga0207683_10004315 3300026121 Bacteria 12280
104 Ga0209588_1021858 3300027671 Bacteria 2012
105 Ga0207428_10096333 3300027907 Bacteria 2291
106 Ga0207428_10153502 3300027907 Bacteria 1752
107 Ga0207428_10322852 3300027907 Bacteria 1140
108 Ga0265330_10041027 3300031235 Bacteria 2053
109 Ga0265325_10034154 3300031241 Bacteria 2708
110 Ga0265340_10017112 3300031247 Bacteria 3749
111 Ga0265327_10128561 3300031251 Bacteria 1194
112 Ga0373958_0022393 3300034819 Bacteria 1180
113 Ga0373949_0017021 3300035090 Bacteria 1635
114 Ga0373939_0003203 3300035114 Bacteria 3837
115 Ga0373962_0002477 3300035242 Bacteria 4386
116 Ga0373962_0007822 3300035242 Bacteria 2623
117 Ga0373931_0006769 3300035691 Bacteria 5380
118 Ga0373925_0230191 3300037068 Bacteria 1482
119 Ga0436364_0691299 3300037853 Bacteria 8254
120 Ga0436364_1549215 3300037853 Bacteria 2144
121 Ga0400483_088437 3300039062 Bacteria 3984
122 Ga0400483_099844 3300039062 Bacteria 15104
123 Ga0400483_241780 3300039062 Bacteria 1859
124 Ga0436365_0294076 3300039437 Bacteria 4411
125 Ga0436365_0773535 3300039437 Bacteria 4972
126 Ga0436365_1605642 3300039437 Bacteria 1218
127 Ga0436361_0780064 3300039447 Bacteria 2185
128 Ga0439453_0001627 3300041408 Bacteria 2927
129 Ga0439443_000773 3300042003 Bacteria 3154
130 Ga0439435_0019946 3300042436 Bacteria 1724
131 Ga0439440_0005999 3300042993 Bacteria 2431
132 Ga0466969_0016834 3300044656 Bacteria 3823
133 Ga0466972_0010373 3300044658 Bacteria 4678
134 Ga0466966_0000545 3300044684 Bacteria 24031
135 Ga0466963_0049874 3300044694 Bacteria 2769
136 Ga0466971_0007599 3300044719 Bacteria 4727
137 Ga0466957_0003037 3300044842 Bacteria 9121
138 Ga0466957_0026625 3300044842 Bacteria 3432
139 Ga0466959_0028462 3300045049 Bacteria 4144
140 Ga0466958_0008298 3300045836 Bacteria 5752
141 Ga0495630_0343645 3300046517 Bacteria 1142
142 Ga0495621_0013851 3300046539 Bacteria 2542
143 Ga0496102_0030319 3300048905 Bacteria 4841
144 Ga0496104_0013255 3300048907 Bacteria 7430
145 Ga0496105_0009199 3300048908 Bacteria 7715
146 Ga0496109_0041290 3300048912 Bacteria 4179
147 Ga0496109_0347151 3300048912 Bacteria 1402
148 Ga0496110_0053124 3300048913 Bacteria 3561
149 Ga0496112_0125715 3300048915 Bacteria 2535
150 Ga0496114_0099514 3300048917 Bacteria 2480
151 Ga0496115_0022206 3300048918 Bacteria 4913
152 Ga0496115_0080021 3300048918 Bacteria 2660
153 Ga0501032_0010245 3300049569 Bacteria 6764
154 Ga0501034_0038877 3300049571 Bacteria 4819
155 Ga0501036_0037004 3300049572 Bacteria 4128
156 Ga0501037_0000588 3300049573 Bacteria 28582
157 Ga0501038_0067568 3300049574 Bacteria 3040
158 Ga0501039_0021273 3300049575 Bacteria 4977
159 Ga0501043_0001623 3300049579 Bacteria 19576
160 Ga0501070_0159872 3300049586 Bacteria 1857
161 Ga0501072_0272957 3300049588 Bacteria 1345
162 Ga0501073_0027849 3300049589 Bacteria 4038
163 Ga0501074_0021728 3300049590 Bacteria 4659
164 Ga0501077_0028175 3300049593 Bacteria 3569
165 Ga0501079_0038134 3300049741 Bacteria 3706
166 Ga0501080_0023293 3300049742 Bacteria 5741
167 Ga0501083_0052568 3300049744 Bacteria 2737
168 nmdc:mga05p37_133508_c1 3300050507 Bacteria 3045
169 nmdc:mga09592_28491_c1 3300050508 Bacteria 4640
170 nmdc:mga0qj67_11536_c1 3300050509 Bacteria 6623
171 nmdc:mga0qj67_14747_c1 3300050509 Bacteria 5907
172 nmdc:mga0qj67_66381_c1 3300050509 Bacteria 2874
173 nmdc:mga06r32_31128_c1 3300050510 Bacteria 5009
174 nmdc:mga06r32_393653_c1 3300050510 Bacteria 1368
175 nmdc:mga06r32_49225_c1 3300050510 Bacteria 4030
176 nmdc:mga08y16_135669_c1 3300050511 Bacteria 2558
177 nmdc:mga08y16_150560_c1 3300050511 Bacteria 2419
178 nmdc:mga08y16_28432_c1 3300050511 Bacteria 5895
179 nmdc:mga08y16_4935_c1 3300050511 Bacteria 13938
180 nmdc:mga08y16_69774_c1 3300050511 Bacteria 3664
181 nmdc:mga0n895_17964_c1 3300050512 Bacteria 6536
182 nmdc:mga0n895_20277_c1 3300050512 Bacteria 6196
183 nmdc:mga0rr50_13534_c1 3300050513 Bacteria 5316
184 Ga0501084_0185756 3300054114 Bacteria 1754
185 Ga0501082_0009185 3300060353 Bacteria 8527
186 Ga0466962_0018300 3300061719 Bacteria 3370

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_1549215 Ga0436364_1549215_799_1623 274
2 3300005328 Ga0070676_10098473 Ga0070676_100984734 275
3 3300005330 Ga0070690_100191923 Ga0070690_1001919231 275
4 3300005356 Ga0070674_100048266 Ga0070674_1000482661 275
5 3300005367 Ga0070667_100085644 Ga0070667_1000856443 275
6 3300005456 Ga0070678_100014119 Ga0070678_1000141192 275
7 3300005719 Ga0068861_100008044 Ga0068861_1000080443 275
8 3300025940 Ga0207691_10001672 Ga0207691_1000167220 275
9 3300025960 Ga0207651_10336202 Ga0207651_103362022 275
10 3300025986 Ga0207658_10147292 Ga0207658_101472923 275
11 3300026089 Ga0207648_10009261 Ga0207648_100092614 275
12 3300026118 Ga0207675_100014581 Ga0207675_1000145817 275
13 3300050510 nmdc:mga06r32_49225_c1 nmdc:mga06r32_49225_c1_3189_4016 275
14 iso_pu_bacteria 2558860112 2558905734 285
15 3300014325 Ga0163163_10032710 Ga0163163_100327106 287
16 3300048905 Ga0496102_0030319 Ga0496102_0030319_887_1777 287
17 3300048907 Ga0496104_0013255 Ga0496104_0013255_1714_2604 287
18 3300048908 Ga0496105_0009199 Ga0496105_0009199_4332_5222 287
19 3300048912 Ga0496109_0041290 Ga0496109_0041290_1867_2757 287
20 3300048913 Ga0496110_0053124 Ga0496110_0053124_1526_2416 287
21 3300048915 Ga0496112_0125715 Ga0496112_0125715_115_1005 287
22 3300048917 Ga0496114_0099514 Ga0496114_0099514_955_1845 287
23 3300048918 Ga0496115_0022206 Ga0496115_0022206_332_1222 287
24 3300006844 Ga0075428_100220557 Ga0075428_1002205573 289
25 3300006846 Ga0075430_100219922 Ga0075430_1002199222 289
26 3300009147 Ga0114129_10101531 Ga0114129_101015313 289
27 3300039062 Ga0400483_241780 Ga0400483_241780_204_1079 289
28 3300050509 nmdc:mga0qj67_14747_c1 nmdc:mga0qj67_14747_c1_1336_2205 289
29 3300050510 nmdc:mga06r32_31128_c1 nmdc:mga06r32_31128_c1_3509_4378 289
30 iso_pu_bacteria 2558860280 2559431987 289
31 3300037853 Ga0436364_0691299 Ga0436364_0691299_6753_7676 290
32 3300039437 Ga0436365_0773535 Ga0436365_0773535_3265_4188 290
33 3300044656 Ga0466969_0016834 Ga0466969_0016834_2439_3323 290
34 3300044684 Ga0466966_0000545 Ga0466966_0000545_13019_13915 290
35 3300044694 Ga0466963_0049874 Ga0466963_0049874_1851_2747 290
36 3300044719 Ga0466971_0007599 Ga0466971_0007599_3463_4359 290
37 3300044842 Ga0466957_0003037 Ga0466957_0003037_4304_5200 290
38 3300044842 Ga0466957_0026625 Ga0466957_0026625_1043_1927 290
39 3300045049 Ga0466959_0028462 Ga0466959_0028462_192_1076 290
40 3300045836 Ga0466958_0008298 Ga0466958_0008298_3714_4610 290
41 3300061719 Ga0466962_0018300 Ga0466962_0018300_1221_2117 290
42 3300005471 Ga0070698_100331478 Ga0070698_1003314782 291
43 3300005518 Ga0070699_100051508 Ga0070699_1000515084 291
44 3300009147 Ga0114129_10420306 Ga0114129_104203061 291
45 3300013308 Ga0157375_10557217 Ga0157375_105572172 291
46 3300050511 nmdc:mga08y16_4935_c1 nmdc:mga08y16_4935_c1_9364_10239 291
47 iso_pu_bacteria 2775507255 2778125258 291
48 3300005445 Ga0070708_100003361 Ga0070708_10000336110 292
49 3300005467 Ga0070706_100020207 Ga0070706_1000202077 292
50 3300005468 Ga0070707_100012445 Ga0070707_1000124454 292
51 3300005471 Ga0070698_100063402 Ga0070698_1000634024 292
52 3300005536 Ga0070697_100196934 Ga0070697_1001969343 292
53 3300025910 Ga0207684_10008144 Ga0207684_100081441 292
54 3300025922 Ga0207646_10011647 Ga0207646_100116478 292
55 3300039062 Ga0400483_088437 Ga0400483_088437_506_1387 292
56 3300005347 Ga0070668_100481385 Ga0070668_1004813851 293
57 3300039062 Ga0400483_099844 Ga0400483_099844_13391_14320 293
58 3300005445 Ga0070708_100017470 Ga0070708_1000174704 294
59 3300005468 Ga0070707_100039070 Ga0070707_1000390702 294
60 3300005471 Ga0070698_100038604 Ga0070698_1000386046 294
61 3300005536 Ga0070697_100091760 Ga0070697_1000917603 294
62 3300005985 Ga0081539_10050214 Ga0081539_100502143 294
63 3300009553 Ga0105249_10159433 Ga0105249_101594333 294
64 3300021384 Ga0213876_10163499 Ga0213876_101634991 294
65 3300021388 Ga0213875_10022746 Ga0213875_100227464 294
66 3300025922 Ga0207646_10118767 Ga0207646_101187672 294
67 3300039437 Ga0436365_1605642 Ga0436365_1605642_78_968 294
68 3300044658 Ga0466972_0010373 Ga0466972_0010373_2151_3041 294
69 3300049569 Ga0501032_0010245 Ga0501032_0010245_5375_6268 294
70 3300049571 Ga0501034_0038877 Ga0501034_0038877_271_1164 294
71 3300049572 Ga0501036_0037004 Ga0501036_0037004_2449_3342 294
72 3300049573 Ga0501037_0000588 Ga0501037_0000588_22309_23202 294
73 3300049574 Ga0501038_0067568 Ga0501038_0067568_1877_2770 294
74 3300049575 Ga0501039_0021273 Ga0501039_0021273_3365_4258 294
75 3300049579 Ga0501043_0001623 Ga0501043_0001623_18547_19440 294
76 3300049586 Ga0501070_0159872 Ga0501070_0159872_289_1182 294
77 3300049589 Ga0501073_0027849 Ga0501073_0027849_2390_3283 294
78 3300003203 JGI25406J46586_10038539 JGI25406J46586_100385392 295
79 3300005335 Ga0070666_10348317 Ga0070666_103483171 295
80 3300005340 Ga0070689_100089207 Ga0070689_1000892072 295
81 3300005341 Ga0070691_10101776 Ga0070691_101017761 295
82 3300005435 Ga0070714_100226500 Ga0070714_1002265002 295
83 3300005437 Ga0070710_10029919 Ga0070710_100299192 295
84 3300005441 Ga0070700_100008120 Ga0070700_1000081205 295
85 3300005535 Ga0070684_100051930 Ga0070684_1000519303 295
86 3300005536 Ga0070697_100133553 Ga0070697_1001335533 295
87 3300005543 Ga0070672_100054058 Ga0070672_1000540585 295
88 3300005617 Ga0068859_100039004 Ga0068859_1000390044 295
89 3300005618 Ga0068864_100206341 Ga0068864_1002063412 295
90 3300005844 Ga0068862_100605726 Ga0068862_1006057261 295
91 3300005985 Ga0081539_10001258 Ga0081539_1000125814 295
92 3300006163 Ga0070715_10007334 Ga0070715_100073344 295
93 3300006173 Ga0070716_100235444 Ga0070716_1002354441 295
94 3300006175 Ga0070712_100010381 Ga0070712_1000103813 295
95 3300006175 Ga0070712_100064160 Ga0070712_1000641603 295
96 3300006175 Ga0070712_100070194 Ga0070712_1000701943 295
97 3300006844 Ga0075428_100118666 Ga0075428_1001186662 295
98 3300006844 Ga0075428_100193634 Ga0075428_1001936343 295
99 3300006844 Ga0075428_100629844 Ga0075428_1006298442 295
100 3300006846 Ga0075430_100024089 Ga0075430_1000240895 295
101 3300006846 Ga0075430_100065572 Ga0075430_1000655723 295
102 3300006847 Ga0075431_100071350 Ga0075431_1000713501 295
103 3300006871 Ga0075434_100130316 Ga0075434_1001303162 295
104 3300006880 Ga0075429_100088577 Ga0075429_1000885772 295
105 3300006880 Ga0075429_100384382 Ga0075429_1003843821 295
106 3300006931 Ga0097620_100039003 Ga0097620_1000390032 295
107 3300007076 Ga0075435_100043320 Ga0075435_1000433202 295
108 3300007265 Ga0099794_10057956 Ga0099794_100579562 295
109 3300007788 Ga0099795_10000687 Ga0099795_100006872 295
110 3300007788 Ga0099795_10065467 Ga0099795_100654672 295
111 3300009094 Ga0111539_10023087 Ga0111539_100230872 295
112 3300009094 Ga0111539_10045263 Ga0111539_100452634 295
113 3300009094 Ga0111539_10075040 Ga0111539_100750403 295
114 3300009094 Ga0111539_10145109 Ga0111539_101451092 295
115 3300009101 Ga0105247_10012670 Ga0105247_100126702 295
116 3300009147 Ga0114129_10173769 Ga0114129_101737693 295
117 3300009147 Ga0114129_10641525 Ga0114129_106415252 295
118 3300009177 Ga0105248_10087092 Ga0105248_100870922 295
119 3300009545 Ga0105237_10034522 Ga0105237_100345224 295
120 3300009551 Ga0105238_10003598 Ga0105238_1000359814 295
121 3300010159 Ga0099796_10001114 Ga0099796_100011145 295
122 3300010159 Ga0099796_10103119 Ga0099796_101031191 295
123 3300014325 Ga0163163_10087129 Ga0163163_100871292 295
124 3300021384 Ga0213876_10085506 Ga0213876_100855062 295
125 3300025893 Ga0207682_10003255 Ga0207682_100032555 295
126 3300025898 Ga0207692_10040238 Ga0207692_100402382 295
127 3300025907 Ga0207645_10013981 Ga0207645_100139813 295
128 3300025915 Ga0207693_10017056 Ga0207693_100170563 295
129 3300025915 Ga0207693_10059114 Ga0207693_100591142 295
130 3300025915 Ga0207693_10067101 Ga0207693_100671014 295
131 3300025918 Ga0207662_10031205 Ga0207662_100312053 295
132 3300025922 Ga0207646_10145019 Ga0207646_101450192 295
133 3300025924 Ga0207694_10081558 Ga0207694_100815585 295
134 3300025925 Ga0207650_10101141 Ga0207650_101011415 295
135 3300025925 Ga0207650_10250833 Ga0207650_102508332 295
136 3300025929 Ga0207664_10143742 Ga0207664_101437422 295
137 3300025935 Ga0207709_10047729 Ga0207709_100477292 295
138 3300025937 Ga0207669_10255196 Ga0207669_102551961 295
139 3300025939 Ga0207665_10232442 Ga0207665_102324422 295
140 3300025940 Ga0207691_10073086 Ga0207691_100730862 295
141 3300025942 Ga0207689_10020061 Ga0207689_100200612 295
142 3300026075 Ga0207708_10403877 Ga0207708_104038771 295
143 3300026095 Ga0207676_10010536 Ga0207676_100105362 295
144 3300026121 Ga0207683_10004315 Ga0207683_100043159 295
145 3300027671 Ga0209588_1021858 Ga0209588_10218582 295
146 3300027907 Ga0207428_10096333 Ga0207428_100963332 295
147 3300027907 Ga0207428_10153502 Ga0207428_101535021 295
148 3300027907 Ga0207428_10322852 Ga0207428_103228521 295
149 3300031235 Ga0265330_10041027 Ga0265330_100410273 295
150 3300031241 Ga0265325_10034154 Ga0265325_100341542 295
151 3300031247 Ga0265340_10017112 Ga0265340_100171123 295
152 3300031251 Ga0265327_10128561 Ga0265327_101285611 295
153 3300034819 Ga0373958_0022393 Ga0373958_0022393_40_957 295
154 3300035090 Ga0373949_0017021 Ga0373949_0017021_120_1037 295
155 3300035114 Ga0373939_0003203 Ga0373939_0003203_1617_2534 295
156 3300035242 Ga0373962_0002477 Ga0373962_0002477_521_1438 295
157 3300035242 Ga0373962_0007822 Ga0373962_0007822_606_1511 295
158 3300035691 Ga0373931_0006769 Ga0373931_0006769_3805_4722 295
159 3300037068 Ga0373925_0230191 Ga0373925_0230191_198_1094 295
160 3300039437 Ga0436365_0294076 Ga0436365_0294076_486_1373 295
161 3300039447 Ga0436361_0780064 Ga0436361_0780064_927_1817 295
162 3300041408 Ga0439453_0001627 Ga0439453_0001627_391_1278 295
163 3300042003 Ga0439443_000773 Ga0439443_000773_1115_2002 295
164 3300042436 Ga0439435_0019946 Ga0439435_0019946_13_900 295
165 3300042993 Ga0439440_0005999 Ga0439440_0005999_267_1154 295
166 3300046517 Ga0495630_0343645 Ga0495630_0343645_108_995 295
167 3300046539 Ga0495621_0013851 Ga0495621_0013851_1211_2098 295
168 3300048912 Ga0496109_0347151 Ga0496109_0347151_330_1226 295
169 3300048918 Ga0496115_0080021 Ga0496115_0080021_585_1472 295
170 3300049588 Ga0501072_0272957 Ga0501072_0272957_304_1197 295
171 3300049590 Ga0501074_0021728 Ga0501074_0021728_2048_2941 295
172 3300049593 Ga0501077_0028175 Ga0501077_0028175_69_962 295
173 3300049741 Ga0501079_0038134 Ga0501079_0038134_1282_2175 295
174 3300049742 Ga0501080_0023293 Ga0501080_0023293_2056_2949 295
175 3300049744 Ga0501083_0052568 Ga0501083_0052568_1684_2571 295
176 3300050507 nmdc:mga05p37_133508_c1 nmdc:mga05p37_133508_c1_1482_2372 295
177 3300050508 nmdc:mga09592_28491_c1 nmdc:mga09592_28491_c1_3039_3926 295
178 3300050509 nmdc:mga0qj67_11536_c1 nmdc:mga0qj67_11536_c1_2698_3585 295
179 3300050509 nmdc:mga0qj67_66381_c1 nmdc:mga0qj67_66381_c1_1614_2501 295
180 3300050510 nmdc:mga06r32_393653_c1 nmdc:mga06r32_393653_c1_54_944 295
181 3300050511 nmdc:mga08y16_135669_c1 nmdc:mga08y16_135669_c1_1240_2130 295
182 3300050511 nmdc:mga08y16_150560_c1 nmdc:mga08y16_150560_c1_192_1082 295
183 3300050511 nmdc:mga08y16_28432_c1 nmdc:mga08y16_28432_c1_2502_3392 295
184 3300050511 nmdc:mga08y16_69774_c1 nmdc:mga08y16_69774_c1_190_1107 295
185 3300050512 nmdc:mga0n895_17964_c1 nmdc:mga0n895_17964_c1_52_969 295
186 3300050512 nmdc:mga0n895_20277_c1 nmdc:mga0n895_20277_c1_4148_5050 295
187 3300050513 nmdc:mga0rr50_13534_c1 nmdc:mga0rr50_13534_c1_77_979 295
188 3300054114 Ga0501084_0185756 Ga0501084_0185756_806_1699 295
189 3300060353 Ga0501082_0009185 Ga0501082_0009185_2257_3150 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

30

279

0.89

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

32

285

0.53

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h77-assembly1.cif.gz_A crystal structure of haloalkane dehalogenase linb from sphingobium sp. mi1205 0.9931 3 293
4h7j-assembly1.cif.gz_A crystal structure of haloalkane dehalogenase linb h247a mutant from sphingobium sp. mi1205 0.993 3 293
4h7f-assembly1.cif.gz_A crystal structure of haloalkane dehalogenase linb v134i mutant from sphingobium sp. mi1205 0.993 3 293
4h7i-assembly1.cif.gz_A crystal structure of haloalkane dehalogenase linb l138i mutant from sphingobium sp. mi1205 0.9929 3 293
4h7d-assembly1.cif.gz_A crystal structure of haloalkane dehalogenase linb t81a mutant from sphingobium sp. mi1205 0.9928 3 293
ID Description Score Start End Superfamily
4brzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9862 11 290 3.40.50.1820
4brzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9493 11 290 3.40.50.1820
5mxpA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9442 10 290 3.40.50.1820
2psfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9389 11 291 3.40.50.1820
3a2nA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9358 12 293 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A537L374-F1-model_v4 Haloalkane dehalogenase (EC 3.8.1.5) 0.9934 1 292 GO:0018786
AF-A0A0M2ZFI6-F1-model_v4 Haloalkane dehalogenase (EC 3.8.1.5) 0.9933 3 292 GO:0018786
AF-W1KLX9-F1-model_v4 deleted 0.9933 1 144
AF-A0A6G9GSI9-F1-model_v4 Haloalkane dehalogenase (EC 3.8.1.5) 0.993 3 292 GO:0018786
AF-A0A1A0LT33-F1-model_v4 deleted 0.9927 9 292

Feature Viewer

pLDDT pTM Quality
95.64 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map