F292944

General Info

Members Datasets Scaffolds Average Seq Length
190 82 380 178

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0917875|Ga0453684_0917875_272_856
Length 194
Sequence MKVTVFGGASPKPGEQPYEEARKFGFLLGKAGHTVMTGGYIGVMEAVSRGANEAGGHVIGSTCKELDNWRGIKANKWVIEEWSFATLRERMYALIDKCDAAVAMPGGVGTLAEISVMWNEQIISQNSAKPIIIVGEAWNQTVSTFLQSLGSYVKQEDQKLILYSPGIEETIEIINQIHNLKSEKFVKTGHHNEQ

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
35 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
45 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
46 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
47 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
48 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
49 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
50 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
51 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
52 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
53 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
54 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
55 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
56 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
57 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
58 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
59 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
60 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
66 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
67 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
68 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
69 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
70 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
71 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
72 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
73 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
74 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
75 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
76 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
77 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
78 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
79 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
80 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
81 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
82 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.53
Rhizosphere 97.37
Stem 0
Stem Tuber 0
Unclassified 21.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0917875 3300044712 Bacteria 937
2 JGI25406J46586_10043445 3300003203 Bacteria 1564
3 Ga0065704_10070684 3300005289 Bacteria 17749
4 Ga0065715_10517456 3300005293 Unclassified 744
5 Ga0065707_10006225 3300005295 Bacteria 2841
6 Ga0065707_10082251 3300005295 Bacteria 18247
7 Ga0065707_10105886 3300005295 Bacteria 2624
8 Ga0065707_10115645 3300005295 Bacteria 2260
9 Ga0065707_10232667 3300005295 Unclassified 1183
10 Ga0065707_10242417 3300005295 Bacteria 1146
11 Ga0070676_10428899 3300005328 Unclassified 925
12 Ga0070689_101037440 3300005340 Bacteria 731
13 Ga0070700_100810387 3300005441 Unclassified 755
14 Ga0070707_100036423 3300005468 Bacteria 4695
15 Ga0070707_100149541 3300005468 Bacteria 2274
16 Ga0070698_100018393 3300005471 Bacteria 7358
17 Ga0070698_100035162 3300005471 Bacteria 5181
18 Ga0070698_100060981 3300005471 Unclassified 3805
19 Ga0070698_100078061 3300005471 Bacteria 3310
20 Ga0070698_100433382 3300005471 Bacteria 1249
21 Ga0070698_100947798 3300005471 Unclassified 807
22 Ga0070699_100005066 3300005518 Bacteria 11600
23 Ga0070699_100033304 3300005518 Bacteria 4451
24 Ga0070699_100232605 3300005518 Bacteria 1644
25 Ga0070699_100354132 3300005518 Bacteria 1323
26 Ga0070695_100680034 3300005545 Unclassified 815
27 Ga0070695_100816887 3300005545 Bacteria 748
28 Ga0070696_100058236 3300005546 Bacteria 2698
29 Ga0070704_100024786 3300005549 Unclassified 3940
30 Ga0070704_100124393 3300005549 Bacteria 1987
31 Ga0070704_100205578 3300005549 Bacteria 1592
32 Ga0070704_100368189 3300005549 Bacteria 1218
33 Ga0070704_100372776 3300005549 Bacteria 1211
34 Ga0068857_100204052 3300005577 Bacteria 1803
35 Ga0068859_100471452 3300005617 Bacteria 1351
36 Ga0068859_100535860 3300005617 Bacteria 1265
37 Ga0068859_100557217 3300005617 Bacteria 1240
38 Ga0068859_101505606 3300005617 Bacteria 743
39 Ga0068864_100515430 3300005618 Bacteria 1152
40 Ga0068861_100102104 3300005719 Bacteria 2282
41 Ga0068858_100295319 3300005842 Bacteria 1545
42 Ga0068862_100021353 3300005844 Bacteria 5409
43 Ga0068862_100195256 3300005844 Bacteria 1823
44 Ga0081539_10053007 3300005985 Bacteria 2274
45 Ga0075428_100061824 3300006844 Bacteria 4101
46 Ga0075428_100315961 3300006844 Bacteria 1679
47 Ga0075428_100325388 3300006844 Bacteria 1651
48 Ga0075428_100631855 3300006844 Bacteria 1142
49 Ga0075428_101086631 3300006844 Bacteria 845
50 Ga0075430_100263551 3300006846 Bacteria 1427
51 Ga0075430_100286581 3300006846 Bacteria 1362
52 Ga0075430_100332580 3300006846 Bacteria 1255
53 Ga0075430_100479794 3300006846 Bacteria 1026
54 Ga0075430_100719799 3300006846 Unclassified 823
55 Ga0075430_100991704 3300006846 Unclassified 692
56 Ga0075431_100722501 3300006847 Bacteria 973
57 Ga0075433_10195042 3300006852 Bacteria 1801
58 Ga0075433_10601115 3300006852 Bacteria 966
59 Ga0075434_100153356 3300006871 Bacteria 2324
60 Ga0075434_100739491 3300006871 Unclassified 1001
61 Ga0075429_100001291 3300006880 Bacteria 20423
62 Ga0075429_100033601 3300006880 Bacteria 4458
63 Ga0075429_100218032 3300006880 Unclassified 1672
64 Ga0075429_100252162 3300006880 Bacteria 1545
65 Ga0075429_100362306 3300006880 Bacteria 1269
66 Ga0075429_100373377 3300006880 Bacteria 1248
67 Ga0097620_100471448 3300006931 Bacteria 1351
68 Ga0097620_100535907 3300006931 Bacteria 1265
69 Ga0097620_100557220 3300006931 Bacteria 1240
70 Ga0097620_101505471 3300006931 Bacteria 743
71 Ga0105240_10228825 3300009093 Unclassified 2162
72 Ga0111539_10015096 3300009094 Bacteria 9626
73 Ga0111539_11315266 3300009094 Unclassified 839
74 Ga0114129_10041153 3300009147 Bacteria 6513
75 Ga0114129_10068217 3300009147 Bacteria 4959
76 Ga0114129_10110956 3300009147 Unclassified 3785
77 Ga0114129_10113536 3300009147 Bacteria 3735
78 Ga0114129_10117945 3300009147 Bacteria 3656
79 Ga0114129_10477800 3300009147 Unclassified 1631
80 Ga0105243_10144488 3300009148 Bacteria 2034
81 Ga0105243_10333930 3300009148 Bacteria 1386
82 Ga0105243_11488829 3300009148 Unclassified 700
83 Ga0105249_10122783 3300009553 Bacteria 2470
84 Ga0157377_10538736 3300014745 Unclassified 823
85 Ga0207662_10081534 3300025918 Bacteria 1975
86 Ga0207646_10094950 3300025922 Bacteria 2671
87 Ga0207709_10047209 3300025935 Bacteria 2616
88 Ga0207709_10170976 3300025935 Bacteria 1525
89 Ga0207670_10282636 3300025936 Bacteria 1294
90 Ga0207708_10113168 3300026075 Bacteria 2108
91 Ga0207676_10486241 3300026095 Unclassified 1170
92 Ga0207674_10139149 3300026116 Bacteria 2388
93 Ga0207675_100156360 3300026118 Unclassified 2173
94 Ga0268265_10023296 3300028380 Unclassified 4364
95 Ga0268265_10565012 3300028380 Bacteria 1082
96 Ga0307405_10297489 3300031731 Bacteria 1223
97 Ga0307405_10419882 3300031731 Bacteria 1052
98 Ga0307406_10121735 3300031901 Bacteria 1816
99 Ga0307407_10046094 3300031903 Bacteria 2467
100 Ga0307415_100297707 3300032126 Bacteria 1335
101 Ga0316585_10099890 3300032137 Unclassified 952
102 Ga0373940_0102969 3300035088 Bacteria 869
103 Ga0316584_0051130 3300036712 Bacteria 3091
104 Ga0316584_0303764 3300036712 Bacteria 1155
105 Ga0400484_14469 3300038725 Bacteria 1591
106 Ga0400490_38667 3300038726 Unclassified 1430
107 Ga0400488_55446 3300038741 Unclassified 2286
108 Ga0400487_54467 3300039110 Unclassified 2967
109 Ga0451577_0003594 3300042876 Bacteria 17047
110 Ga0451577_0017192 3300042876 Bacteria 6685
111 Ga0451577_0215619 3300042876 Bacteria 1734
112 Ga0451577_0531173 3300042876 Bacteria 1068
113 Ga0451577_0537853 3300042876 Bacteria 1061
114 Ga0451577_0807549 3300042876 Unclassified 847
115 Ga0453683_0000232 3300044673 Bacteria 74369
116 Ga0453683_0083221 3300044673 Bacteria 2005
117 Ga0453683_0218170 3300044673 Bacteria 1212
118 Ga0453683_0349359 3300044673 Unclassified 950
119 Ga0453683_0359537 3300044673 Bacteria 936
120 Ga0453684_0000007 3300044712 Bacteria 1301482
121 Ga0453684_0003096 3300044712 Bacteria 38321
122 Ga0453684_0007902 3300044712 Bacteria 19304
123 Ga0453684_0008167 3300044712 Bacteria 18886
124 Ga0453684_0026558 3300044712 Bacteria 8351
125 Ga0453684_0030231 3300044712 Bacteria 7658
126 Ga0453684_0116418 3300044712 Bacteria 3237
127 Ga0453684_0121211 3300044712 Bacteria 3157
128 Ga0453684_0124564 3300044712 Bacteria 3104
129 Ga0453684_0124911 3300044712 Bacteria 3099
130 Ga0453684_0145632 3300044712 Bacteria 2822
131 Ga0453684_0171162 3300044712 Bacteria 2559
132 Ga0453684_0269020 3300044712 Bacteria 1948
133 Ga0453684_0407719 3300044712 Bacteria 1521
134 Ga0453684_0561655 3300044712 Bacteria 1256
135 Ga0453684_0561742 3300044712 Bacteria 1256
136 Ga0453684_0578711 3300044712 Bacteria 1233
137 Ga0453684_0934519 3300044712 Bacteria 926
138 Ga0453684_1032411 3300044712 Bacteria 872
139 Ga0453684_1370964 3300044712 Unclassified 735
140 Ga0453684_1688026 3300044712 Unclassified 647
141 Ga0451576_0009450 3300045051 Bacteria 11302
142 Ga0451576_0018607 3300045051 Bacteria 7603
143 Ga0451576_0033395 3300045051 Bacteria 5469
144 Ga0451576_0078985 3300045051 Bacteria 3423
145 Ga0451576_0112134 3300045051 Bacteria 2838
146 Ga0451576_0246864 3300045051 Unclassified 1866
147 Ga0451576_0568552 3300045051 Bacteria 1191
148 Ga0451576_0767996 3300045051 Unclassified 1012
149 Ga0496106_0096151 3300048909 Bacteria 2292
150 Ga0501036_0706485 3300049572 Bacteria 833
151 Ga0501039_0858388 3300049575 Bacteria 707
152 Ga0501040_0136792 3300049576 Bacteria 1725
153 Ga0501041_0043272 3300049577 Bacteria 2738
154 Ga0501046_0747932 3300049580 Unclassified 687
155 Ga0501048_0197671 3300049582 Bacteria 1425
156 Ga0501068_0167902 3300049584 Bacteria 1384
157 Ga0501068_0239111 3300049584 Bacteria 1156
158 Ga0501071_0290880 3300049587 Bacteria 1237
159 Ga0501072_0109405 3300049588 Bacteria 2199
160 Ga0501074_0524622 3300049590 Unclassified 839
161 Ga0501075_0062357 3300049591 Bacteria 2810
162 Ga0501075_0349480 3300049591 Bacteria 1127
163 Ga0501075_0721402 3300049591 Unclassified 759
164 Ga0501076_0063781 3300049592 Bacteria 2936
165 Ga0501076_0935511 3300049592 Unclassified 714
166 Ga0501079_0309811 3300049741 Bacteria 1235
167 Ga0501080_0036093 3300049742 Bacteria 4615
168 Ga0501081_0146555 3300049743 Bacteria 1694
169 nmdc:mga05p37_114801_c1 3300050507 Bacteria 3310
170 nmdc:mga05p37_280871_c1 3300050507 Bacteria 1986
171 nmdc:mga05p37_37406_c1 3300050507 Bacteria 5950
172 nmdc:mga05p37_396819_c1 3300050507 Bacteria 1612
173 nmdc:mga05p37_444553_c1 3300050507 Unclassified 1502
174 nmdc:mga05p37_452000_c1 3300050507 Bacteria 1487
175 nmdc:mga09592_385532_c1 3300050508 Bacteria 1212
176 nmdc:mga09592_3955_c1 3300050508 Bacteria 11939
177 nmdc:mga09592_450831_c1 3300050508 Unclassified 1110
178 nmdc:mga09592_6045_c1 3300050508 Bacteria 9873
179 nmdc:mga0qj67_139603_c1 3300050509 Bacteria 1964
180 nmdc:mga0qj67_829098_c1 3300050509 Unclassified 731
181 nmdc:mga0qj67_861313_c1 3300050509 Unclassified 715
182 nmdc:mga06r32_147096_c1 3300050510 Bacteria 2333
183 nmdc:mga06r32_283863_c1 3300050510 Bacteria 1642
184 nmdc:mga06r32_440017_c1 3300050510 Bacteria 1284
185 nmdc:mga08y16_27426_c1 3300050511 Bacteria 6002
186 nmdc:mga0n895_1108689_c1 3300050512 Unclassified 768
187 nmdc:mga0n895_421447_c1 3300050512 Bacteria 1349
188 Ga0501084_0990344 3300054114 Bacteria 706
189 Ga0501082_0213050 3300060353 Bacteria 1680
190 Ga0530510_0044312 3300061734 Unclassified 3214
191 Ga0453684_0917875
192 JGI25406J46586_10043445
193 Ga0065704_10070684
194 Ga0065715_10517456
195 Ga0065707_10006225
196 Ga0065707_10082251
197 Ga0065707_10105886
198 Ga0065707_10115645
199 Ga0065707_10232667
200 Ga0065707_10242417
201 Ga0070676_10428899
202 Ga0070689_101037440
203 Ga0070700_100810387
204 Ga0070707_100036423
205 Ga0070707_100149541
206 Ga0070698_100018393
207 Ga0070698_100035162
208 Ga0070698_100060981
209 Ga0070698_100078061
210 Ga0070698_100433382
211 Ga0070698_100947798
212 Ga0070699_100005066
213 Ga0070699_100033304
214 Ga0070699_100232605
215 Ga0070699_100354132
216 Ga0070695_100680034
217 Ga0070695_100816887
218 Ga0070696_100058236
219 Ga0070704_100024786
220 Ga0070704_100124393
221 Ga0070704_100205578
222 Ga0070704_100368189
223 Ga0070704_100372776
224 Ga0068857_100204052
225 Ga0068859_100471452
226 Ga0068859_100535860
227 Ga0068859_100557217
228 Ga0068859_101505606
229 Ga0068864_100515430
230 Ga0068861_100102104
231 Ga0068858_100295319
232 Ga0068862_100021353
233 Ga0068862_100195256
234 Ga0081539_10053007
235 Ga0075428_100061824
236 Ga0075428_100315961
237 Ga0075428_100325388
238 Ga0075428_100631855
239 Ga0075428_101086631
240 Ga0075430_100263551
241 Ga0075430_100286581
242 Ga0075430_100332580
243 Ga0075430_100479794
244 Ga0075430_100719799
245 Ga0075430_100991704
246 Ga0075431_100722501
247 Ga0075433_10195042
248 Ga0075433_10601115
249 Ga0075434_100153356
250 Ga0075434_100739491
251 Ga0075429_100001291
252 Ga0075429_100033601
253 Ga0075429_100218032
254 Ga0075429_100252162
255 Ga0075429_100362306
256 Ga0075429_100373377
257 Ga0097620_100471448
258 Ga0097620_100535907
259 Ga0097620_100557220
260 Ga0097620_101505471
261 Ga0105240_10228825
262 Ga0111539_10015096
263 Ga0111539_11315266
264 Ga0114129_10041153
265 Ga0114129_10068217
266 Ga0114129_10110956
267 Ga0114129_10113536
268 Ga0114129_10117945
269 Ga0114129_10477800
270 Ga0105243_10144488
271 Ga0105243_10333930
272 Ga0105243_11488829
273 Ga0105249_10122783
274 Ga0157377_10538736
275 Ga0207662_10081534
276 Ga0207646_10094950
277 Ga0207709_10047209
278 Ga0207709_10170976
279 Ga0207670_10282636
280 Ga0207708_10113168
281 Ga0207676_10486241
282 Ga0207674_10139149
283 Ga0207675_100156360
284 Ga0268265_10023296
285 Ga0268265_10565012
286 Ga0307405_10297489
287 Ga0307405_10419882
288 Ga0307406_10121735
289 Ga0307407_10046094
290 Ga0307415_100297707
291 Ga0316585_10099890
292 Ga0373940_0102969
293 Ga0316584_0051130
294 Ga0316584_0303764
295 Ga0400484_14469
296 Ga0400490_38667
297 Ga0400488_55446
298 Ga0400487_54467
299 Ga0451577_0003594
300 Ga0451577_0017192
301 Ga0451577_0215619
302 Ga0451577_0531173
303 Ga0451577_0537853
304 Ga0451577_0807549
305 Ga0453683_0000232
306 Ga0453683_0083221
307 Ga0453683_0218170
308 Ga0453683_0349359
309 Ga0453683_0359537
310 Ga0453684_0000007
311 Ga0453684_0003096
312 Ga0453684_0007902
313 Ga0453684_0008167
314 Ga0453684_0026558
315 Ga0453684_0030231
316 Ga0453684_0116418
317 Ga0453684_0121211
318 Ga0453684_0124564
319 Ga0453684_0124911
320 Ga0453684_0145632
321 Ga0453684_0171162
322 Ga0453684_0269020
323 Ga0453684_0407719
324 Ga0453684_0561655
325 Ga0453684_0561742
326 Ga0453684_0578711
327 Ga0453684_0934519
328 Ga0453684_1032411
329 Ga0453684_1370964
330 Ga0453684_1688026
331 Ga0451576_0009450
332 Ga0451576_0018607
333 Ga0451576_0033395
334 Ga0451576_0078985
335 Ga0451576_0112134
336 Ga0451576_0246864
337 Ga0451576_0568552
338 Ga0451576_0767996
339 Ga0496106_0096151
340 Ga0501036_0706485
341 Ga0501039_0858388
342 Ga0501040_0136792
343 Ga0501041_0043272
344 Ga0501046_0747932
345 Ga0501048_0197671
346 Ga0501068_0167902
347 Ga0501068_0239111
348 Ga0501071_0290880
349 Ga0501072_0109405
350 Ga0501074_0524622
351 Ga0501075_0062357
352 Ga0501075_0349480
353 Ga0501075_0721402
354 Ga0501076_0063781
355 Ga0501076_0935511
356 Ga0501079_0309811
357 Ga0501080_0036093
358 Ga0501081_0146555
359 nmdc:mga05p37_114801_c1
360 nmdc:mga05p37_280871_c1
361 nmdc:mga05p37_37406_c1
362 nmdc:mga05p37_396819_c1
363 nmdc:mga05p37_444553_c1
364 nmdc:mga05p37_452000_c1
365 nmdc:mga09592_385532_c1
366 nmdc:mga09592_3955_c1
367 nmdc:mga09592_450831_c1
368 nmdc:mga09592_6045_c1
369 nmdc:mga0qj67_139603_c1
370 nmdc:mga0qj67_829098_c1
371 nmdc:mga0qj67_861313_c1
372 nmdc:mga06r32_147096_c1
373 nmdc:mga06r32_283863_c1
374 nmdc:mga06r32_440017_c1
375 nmdc:mga08y16_27426_c1
376 nmdc:mga0n895_1108689_c1
377 nmdc:mga0n895_421447_c1
378 Ga0501084_0990344
379 Ga0501082_0213050
380 Ga0530510_0044312

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03641

Lysine_decarbox

Possible lysine decarboxylase

44

177

0.86

PF18306

LDcluster4

SLOG cluster4 family

1

162

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wek-assembly1.cif.gz_F crystal structure of the conserved hypothetical protein tt1465 from thermus thermophilus hb8 0.9191 2 175
1wek-assembly1.cif.gz_C crystal structure of the conserved hypothetical protein tt1465 from thermus thermophilus hb8 0.9167 2 176
1wek-assembly1.cif.gz_E crystal structure of the conserved hypothetical protein tt1465 from thermus thermophilus hb8 0.9163 2 175
1wek-assembly1.cif.gz_B crystal structure of the conserved hypothetical protein tt1465 from thermus thermophilus hb8 0.9132 2 176
5wq3-assembly1.cif.gz_C-3 crystal structure of type-ii log from corynebacterium glutamicum 0.9077 1 175
ID Description Score Start End Superfamily
1wekF01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9185 2 175 3.40.50.450
5wq3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8997 2 175 3.40.50.450
af_A4IB94_6_208_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8993 2 175 3.40.50.450
af_A4HXF6_126_320_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8895 2 176 3.40.50.450
af_A4IB94_6_208_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8847 2 175 3.40.50.450
ID Description Score Start End GO Terms
AF-A0A350WRY8-F1-model_v4 DNA-binding protein 1 1 106 GO:0003677
GO:0005829
AF-A0A350FZU4-F1-model_v4 DNA-binding protein 0.9979 1 174 GO:0003677
GO:0005829
AF-A0A7C4K0S5-F1-model_v4 LOG family protein 0.9972 1 175 GO:0005829
AF-A0A2M8S7L3-F1-model_v4 LOG family protein 0.9956 91 174
AF-A0A351G601-F1-model_v4 LOG family protein 0.9927 1 174 GO:0005829

Map