F293281

General Info

Members Datasets Scaffolds Average Seq Length
190 132 380 367

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221575|2643885742
Length 417
Sequence DAPSFPETDLAPLEFAVTKNLASKSAAQRDEILVDPGFGKYFTDHMVDVCWSASGGWHRPRVQPYGPIALDPAAAVLHYGQEIFEGIKVYRHADGSIHTFRPDQNGLRLQRSARRLALPELPVEYFIQAIQEIVAADSAWVPCGEDQSLYLRPFMFAKEAFLGVRPAQKVAFYVIASPAGAYFTGGVQPVSLWLSEDHSRAGKGGTGAAKTGGNYAASLLPQSDAYANGCDQTVFLDEDRNVEEVGSMNVVFVYQDGRIVTPHSDSILEGITRDSLLQLAADRGHTIERGRVSVQDWRAGVASGDIVEVFACGTAAVVTPIGVLKGRXRSSPSRRHTIERGRVSVQDWRAGVASGDIVEVFACGTAAVVTPIGVLKGRDFVDEQPRGELALSLRQELTDIQYGRVADRHGWLLRLGA

Samples

Sample ID Description Type Environment
1 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
2 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
3 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
4 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
5 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
6 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
7 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
8 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
9 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
10 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
11 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
12 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
13 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
14 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
15 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
16 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
17 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
18 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
19 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
20 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
21 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
22 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
36 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
37 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
38 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
39 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
40 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
41 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
42 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
43 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
44 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
45 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
46 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
47 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
48 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
49 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
50 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
51 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
52 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
53 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
54 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
55 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
56 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
57 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
58 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
59 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
61 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
62 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
63 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
65 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
66 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
67 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
68 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
69 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
70 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
71 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
72 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
73 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
74 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
75 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
76 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
77 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
78 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 2643221575 Microbacterium sp. Root61 Isolate Unclassified
80 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
81 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
82 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
83 2643221546 Microbacterium sp. Root53 Isolate Unclassified
84 2643221553 Microbacterium sp. Root553 Isolate Unclassified
85 2643221566 Microbacterium sp. Root166 Isolate Unclassified
86 2643221597 Microbacterium sp. Root180 Isolate Unclassified
87 2643221630 Microbacterium sp. Root322 Isolate Unclassified
88 2643221649 Leifsonia sp. Root4 Isolate Unclassified
89 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
90 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
91 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
92 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
93 2773857759 Microbacterium sp. 1294 Isolate Unclassified
94 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
95 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
96 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
97 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
98 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
99 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
100 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
101 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
102 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
103 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
104 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
105 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
106 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
107 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
108 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
109 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
110 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
111 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
112 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
113 2914759650 Rhizosphaericola mali Isolate Rhizosphere
114 2919069694 Microbacterium sp. 1154 Isolate Unclassified
115 2919395869 Microbacterium resistens 2980 Isolate Unclassified
116 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
117 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
118 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
119 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
120 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
121 2952252522 Salinicola sp. DM10 Isolate Unclassified
122 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
123 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
124 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
125 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
126 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
127 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
128 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
129 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
130 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
131 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
132 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 69.47
Metatranscriptomes 1.58
Isolates 28.95

Biome Distribution

Category Percentage (%)
Aerial Root 1.05
Bulb 0
Endosphere 12.11
Nodule 0
Rhizoplane 5.26
Rhizosphere 38.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006562J51391_1156571 3300003578 Bacteria 9730
2 Ga0006562J51391_1156572 3300003578 Bacteria 4870
3 Ga0068853_100268200 3300005539 Bacteria 1571
4 Ga0070672_100251018 3300005543 Bacteria 1490
5 Ga0070665_100155453 3300005548 Bacteria 2289
6 Ga0068851_10000001 3300005834 Bacteria 495512
7 Ga0075365_10000638 3300006038 Bacteria 13886
8 Ga0075368_10048401 3300006042 Bacteria 1685
9 Ga0075364_10077314 3300006051 Bacteria 2197
10 Ga0075364_10077553 3300006051 Bacteria 2193
11 Ga0075367_10000690 3300006178 Bacteria 12986
12 Ga0075370_10018868 3300006353 Bacteria 3746
13 Ga0105240_10002391 3300009093 Bacteria 30231
14 Ga0105245_10051674 3300009098 Bacteria 3684
15 Ga0105241_10002890 3300009174 Bacteria 12843
16 Ga0105248_10032315 3300009177 Bacteria 5851
17 Ga0105237_10000341 3300009545 Bacteria 65672
18 Ga0105237_10076801 3300009545 Bacteria 3330
19 Ga0105238_10001701 3300009551 Bacteria 22154
20 Ga0105239_10054282 3300010375 Bacteria 4394
21 Ga0157369_10230454 3300013105 Bacteria 1937
22 Ga0171462_1003 3300013250 Bacteria 853796
23 Ga0157374_10374890 3300013296 Bacteria 1417
24 Ga0209148_1000528 3300025254 Bacteria 37646
25 Ga0207656_10000002 3300025321 Bacteria 792178
26 Ga0207655_1006870 3300025728 Bacteria 7468
27 Ga0207655_1011242 3300025728 Bacteria 5343
28 Ga0207705_10059745 3300025909 Bacteria 2752
29 Ga0207654_10000001 3300025911 Bacteria 1816198
30 Ga0207695_10002266 3300025913 Bacteria 28809
31 Ga0207671_10000002 3300025914 Bacteria 1144816
32 Ga0207657_10249107 3300025919 Bacteria 1417
33 Ga0207694_10000496 3300025924 Bacteria 35623
34 Ga0207687_10011256 3300025927 Bacteria 5844
35 Ga0207711_10015348 3300025941 Bacteria 6357
36 Ga0207639_10164202 3300026041 Bacteria 1874
37 Ga0207674_10083603 3300026116 Bacteria 3192
38 Ga0207698_10000183 3300026142 Bacteria 38581
39 Ga0207698_10001071 3300026142 Bacteria 15906
40 Ga0307514_10003692 3300031649 Bacteria 14475
41 Ga0307514_10052190 3300031649 Bacteria 3163
42 Ga0307406_10001073 3300031901 Bacteria 15209
43 Ga0307406_10188587 3300031901 Bacteria 1507
44 Ga0307412_10077077 3300031911 Bacteria 2292
45 Ga0307416_100091086 3300032002 Bacteria 2618
46 Ga0307414_10012378 3300032004 Bacteria 5042
47 Ga0307414_10311807 3300032004 Bacteria 1336
48 Ga0495590_0000478 3300046457 Bacteria 19827
49 Ga0495650_0001215 3300046471 Bacteria 27021
50 Ga0495625_0088585 3300046660 Bacteria 2144
51 Ga0496104_0297841 3300048907 Bacteria 1525
52 Ga0496105_0069230 3300048908 Bacteria 2916
53 Ga0496108_0206429 3300048911 Bacteria 1705
54 Ga0496109_0066428 3300048912 Bacteria 3302
55 Ga0496109_0157686 3300048912 Bacteria 2126
56 Ga0496111_0203347 3300048914 Bacteria 1472
57 Ga0496113_0180168 3300048916 Bacteria 1675
58 Ga0496114_0093518 3300048917 Bacteria 2556
59 Ga0496114_0178255 3300048917 Bacteria 1855
60 Ga0496114_0430706 3300048917 Bacteria 1168
61 Ga0496117_0000053 3300048920 Bacteria 279396
62 Ga0496117_0001098 3300048920 Bacteria 40887
63 Ga0496117_0014686 3300048920 Bacteria 6729
64 Ga0496117_0021630 3300048920 Bacteria 5194
65 Ga0496117_0024842 3300048920 Bacteria 4723
66 Ga0496118_0014834 3300048921 Bacteria 7263
67 Ga0496118_0025702 3300048921 Bacteria 5040
68 Ga0496119_0003990 3300048922 Bacteria 14942
69 Ga0496119_0005494 3300048922 Bacteria 12110
70 Ga0496119_0005852 3300048922 Bacteria 11607
71 Ga0496119_0006393 3300048922 Bacteria 10950
72 Ga0496119_0009735 3300048922 Bacteria 8182
73 Ga0496119_0063894 3300048922 Bacteria 2188
74 Ga0496120_0001595 3300048923 Bacteria 26374
75 Ga0496120_0002066 3300048923 Bacteria 21596
76 Ga0496120_0003435 3300048923 Bacteria 14452
77 Ga0496120_0004880 3300048923 Bacteria 10930
78 Ga0496120_0018603 3300048923 Bacteria 4471
79 Ga0496120_0025900 3300048923 Bacteria 3633
80 Ga0496122_0000031 3300048925 Bacteria 329726
81 Ga0496122_0001019 3300048925 Bacteria 49576
82 Ga0496122_0007272 3300048925 Bacteria 12379
83 Ga0496122_0010174 3300048925 Bacteria 9747
84 Ga0496122_0023928 3300048925 Bacteria 5363
85 Ga0496122_0174796 3300048925 Bacteria 1289
86 Ga0496122_0189412 3300048925 Bacteria 1216
87 Ga0496123_0000013 3300048926 Bacteria 439694
88 Ga0496123_0003480 3300048926 Bacteria 17593
89 Ga0496123_0019322 3300048926 Bacteria 5375
90 Ga0496124_0008502 3300048927 Bacteria 10721
91 Ga0496124_0064792 3300048927 Bacteria 3049
92 Ga0496125_0004508 3300048928 Bacteria 16017
93 Ga0496125_0011152 3300048928 Bacteria 9010
94 Ga0496125_0014151 3300048928 Bacteria 7782
95 Ga0496125_0014909 3300048928 Bacteria 7549
96 Ga0496125_0016720 3300048928 Bacteria 7034
97 Ga0496125_0080053 3300048928 Bacteria 2502
98 Ga0496125_0119148 3300048928 Bacteria 1888
99 Ga0496126_0002399 3300048929 Bacteria 25438
100 Ga0496126_0005769 3300048929 Bacteria 14001
101 Ga0496126_0020487 3300048929 Bacteria 6479
102 Ga0496126_0023996 3300048929 Bacteria 5897
103 Ga0496126_0030768 3300048929 Bacteria 5082
104 Ga0496126_0032561 3300048929 Bacteria 4910
105 Ga0496126_0101639 3300048929 Bacteria 2515
106 Ga0501032_0080034 3300049569 Bacteria 2175
107 Ga0501034_0201375 3300049571 Bacteria 1949
108 Ga0501038_0061140 3300049574 Bacteria 3222
109 Ga0501042_0001713 3300049578 Bacteria 13108
110 Ga0501043_0072374 3300049579 Bacteria 2708
111 Ga0501043_0142983 3300049579 Bacteria 1873
112 Ga0501047_0003104 3300049581 Bacteria 15762
113 Ga0501047_0166191 3300049581 Bacteria 2077
114 Ga0501047_0293693 3300049581 Bacteria 1469
115 Ga0501083_0000788 3300049744 Bacteria 20791
116 Ga0501083_0013823 3300049744 Bacteria 5644
117 Ga0501035_0027726 3300049822 Bacteria 5176
118 Ga0501044_0005591 3300049823 Bacteria 13954
119 nmdc:mga03n38_30591_c1 3300050490 Bacteria 2265
120 nmdc:mga00v17_26032_c1 3300050491 Bacteria 3404
121 nmdc:mga00v17_7098_c1 3300050491 Bacteria 5965
122 nmdc:mga06z11_1299_c1 3300050494 Bacteria 9234
123 nmdc:mga04h51_23608_c1 3300050495 Bacteria 1874
124 nmdc:mga07m45_26337_c1 3300050496 Bacteria 3196
125 Ga0500643_000128 3300053087 Bacteria 78472
126 Ga0500559_0000159 3300053136 Bacteria 53218
127 Ga0500559_0000671 3300053136 Bacteria 22878
128 Ga0500559_0051095 3300053136 Bacteria 1825
129 Ga0500568_0002477 3300053139 Bacteria 10836
130 Ga0500573_0000001 3300053140 Bacteria 436394
131 Ga0500573_0001475 3300053140 Bacteria 11302
132 Ga0500573_0092480 3300053140 Bacteria 1707
133 Ga0500573_0141818 3300053140 Bacteria 1322
134 Ga0500577_0082082 3300053142 Bacteria 1287
135 Ga0587091_004008 3300059511 Bacteria 1899
136 2643885742 2643221575 Bacteria 4022601
137 2587863231 2585428094 Bacteria 3604039
138 2588108906 2585428157 Bacteria 3018951
139 2643733927 2643221542 Bacteria 3563959
140 2643753652 2643221546 Bacteria 2910897
141 2643785490 2643221553 Bacteria 3544260
142 2643848637 2643221566 Bacteria 3460379
143 2643885744 2643221575 Bacteria 4022601
144 2643996138 2643221597 Bacteria 3347721
145 2644170508 2643221630 Bacteria 3601215
146 2644277183 2643221649 Bacteria 3867359
147 2644679904 2643221724 Bacteria 3593515
148 2730229370 2728369380 Bacteria 3620317
149 2758226383 2757320536 Bacteria 3629334
150 2774380135 2773857758 Bacteria 3592392
151 2774384246 2773857759 Bacteria 2963774
152 2774399207 2773857763 Bacteria 4180068
153 2808630950 2808606306 Bacteria 3608896
154 2808885851 2808606368 Bacteria 3174172
155 2809227634 2808606447 Bacteria 3572005
156 2812323517 2811994872 Bacteria 4121241
157 2821270256 2821268502 Bacteria 3750023
158 2833711218 2833709550 Bacteria 4008291
159 2852634399 2852632344 Bacteria 3463163
160 2852647089 2852646457 Bacteria 3408613
161 2852664957 2852663356 Bacteria 4090475
162 2857720085 2857720070 Bacteria 3189373
163 2857723539 2857723135 Bacteria 4217853
164 2857730206 2857729791 Bacteria 4040535
165 2862994831 2862993130 Bacteria 3860849
166 2870624413 2870622029 Bacteria 3643329
167 2870630588 2870628048 Bacteria 3696012
168 2904511751 2904509784 Bacteria 3520416
169 2906803102 2906799679 Bacteria 4031749
170 2908680673 2908678064 Bacteria 3482747
171 2914763764 2914759650 Bacteria 4701441
172 2919071770 2919069694 Bacteria 3622919
173 2919396336 2919395869 Bacteria 3704152
174 2928092085 2928090899 Bacteria 3158267
175 2939660778 2939657138 Bacteria 3740283
176 2945971545 2945968032 Bacteria 4111363
177 2946034037 2946033335 Bacteria 3835514
178 2946081204 2946080515 Bacteria 4310960
179 2952253678 2952252522 Bacteria 4171745
180 2974297408 2974294766 Bacteria 3767688
181 2974326355 2974324384 Bacteria 3750535
182 2977237007 2977236895 Bacteria 3569373
183 2977254170 2977251589 Bacteria 2952848
184 2977266876 2977264416 Bacteria 3750737
185 2984545200 2984542743 Bacteria 3569378
186 2984581150 2984580707 Bacteria 3351387
187 8004185399 8004182704 Bacteria 3391155
188 8004213879 8004212874 Bacteria 2861420
189 8016257302 8016254467 Bacteria 3797036
190 8046353207 8046352972 Bacteria 3613806
191 Ga0006562J51391_1156571
192 Ga0006562J51391_1156572
193 Ga0068853_100268200
194 Ga0070672_100251018
195 Ga0070665_100155453
196 Ga0068851_10000001
197 Ga0075365_10000638
198 Ga0075368_10048401
199 Ga0075364_10077314
200 Ga0075364_10077553
201 Ga0075367_10000690
202 Ga0075370_10018868
203 Ga0105240_10002391
204 Ga0105245_10051674
205 Ga0105241_10002890
206 Ga0105248_10032315
207 Ga0105237_10000341
208 Ga0105237_10076801
209 Ga0105238_10001701
210 Ga0105239_10054282
211 Ga0157369_10230454
212 Ga0171462_1003
213 Ga0157374_10374890
214 Ga0209148_1000528
215 Ga0207656_10000002
216 Ga0207655_1006870
217 Ga0207655_1011242
218 Ga0207705_10059745
219 Ga0207654_10000001
220 Ga0207695_10002266
221 Ga0207671_10000002
222 Ga0207657_10249107
223 Ga0207694_10000496
224 Ga0207687_10011256
225 Ga0207711_10015348
226 Ga0207639_10164202
227 Ga0207674_10083603
228 Ga0207698_10000183
229 Ga0207698_10001071
230 Ga0307514_10003692
231 Ga0307514_10052190
232 Ga0307406_10001073
233 Ga0307406_10188587
234 Ga0307412_10077077
235 Ga0307416_100091086
236 Ga0307414_10012378
237 Ga0307414_10311807
238 Ga0495590_0000478
239 Ga0495650_0001215
240 Ga0495625_0088585
241 Ga0496104_0297841
242 Ga0496105_0069230
243 Ga0496108_0206429
244 Ga0496109_0066428
245 Ga0496109_0157686
246 Ga0496111_0203347
247 Ga0496113_0180168
248 Ga0496114_0093518
249 Ga0496114_0178255
250 Ga0496114_0430706
251 Ga0496117_0000053
252 Ga0496117_0001098
253 Ga0496117_0014686
254 Ga0496117_0021630
255 Ga0496117_0024842
256 Ga0496118_0014834
257 Ga0496118_0025702
258 Ga0496119_0003990
259 Ga0496119_0005494
260 Ga0496119_0005852
261 Ga0496119_0006393
262 Ga0496119_0009735
263 Ga0496119_0063894
264 Ga0496120_0001595
265 Ga0496120_0002066
266 Ga0496120_0003435
267 Ga0496120_0004880
268 Ga0496120_0018603
269 Ga0496120_0025900
270 Ga0496122_0000031
271 Ga0496122_0001019
272 Ga0496122_0007272
273 Ga0496122_0010174
274 Ga0496122_0023928
275 Ga0496122_0174796
276 Ga0496122_0189412
277 Ga0496123_0000013
278 Ga0496123_0003480
279 Ga0496123_0019322
280 Ga0496124_0008502
281 Ga0496124_0064792
282 Ga0496125_0004508
283 Ga0496125_0011152
284 Ga0496125_0014151
285 Ga0496125_0014909
286 Ga0496125_0016720
287 Ga0496125_0080053
288 Ga0496125_0119148
289 Ga0496126_0002399
290 Ga0496126_0005769
291 Ga0496126_0020487
292 Ga0496126_0023996
293 Ga0496126_0030768
294 Ga0496126_0032561
295 Ga0496126_0101639
296 Ga0501032_0080034
297 Ga0501034_0201375
298 Ga0501038_0061140
299 Ga0501042_0001713
300 Ga0501043_0072374
301 Ga0501043_0142983
302 Ga0501047_0003104
303 Ga0501047_0166191
304 Ga0501047_0293693
305 Ga0501083_0000788
306 Ga0501083_0013823
307 Ga0501035_0027726
308 Ga0501044_0005591
309 nmdc:mga03n38_30591_c1
310 nmdc:mga00v17_26032_c1
311 nmdc:mga00v17_7098_c1
312 nmdc:mga06z11_1299_c1
313 nmdc:mga04h51_23608_c1
314 nmdc:mga07m45_26337_c1
315 Ga0500643_000128
316 Ga0500559_0000159
317 Ga0500559_0000671
318 Ga0500559_0051095
319 Ga0500568_0002477
320 Ga0500573_0000001
321 Ga0500573_0001475
322 Ga0500573_0092480
323 Ga0500573_0141818
324 Ga0500577_0082082
325 Ga0587091_004008
326 2643885742
327 2587863231
328 2588108906
329 2643733927
330 2643753652
331 2643785490
332 2643848637
333 2643885744
334 2643996138
335 2644170508
336 2644277183
337 2644679904
338 2730229370
339 2758226383
340 2774380135
341 2774384246
342 2774399207
343 2808630950
344 2808885851
345 2809227634
346 2812323517
347 2821270256
348 2833711218
349 2852634399
350 2852647089
351 2852664957
352 2857720085
353 2857723539
354 2857730206
355 2862994831
356 2870624413
357 2870630588
358 2904511751
359 2906803102
360 2908680673
361 2914763764
362 2919071770
363 2919396336
364 2928092085
365 2939660778
366 2945971545
367 2946034037
368 2946081204
369 2952253678
370 2974297408
371 2974326355
372 2977237007
373 2977254170
374 2977266876
375 2984545200
376 2984581150
377 8004185399
378 8004213879
379 8016257302
380 8046353207

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01063

Aminotran_4

Amino-transferase class IV

82

324

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jz6-assembly1.cif.gz_B crystal structure of mycobacterium smegmatis branched chain aminotransferase in complex with pyridoxal-5'-phosphate at 1.9 angstrom. 0.9537 11 363
3ht5-assembly1.cif.gz_A-2 crystal structure of ilve a branched chain amino acid transaminase from mycobacterium tuberculosis 0.9436 39 362
3jz6-assembly1.cif.gz_B crystal structure of mycobacterium smegmatis branched chain aminotransferase in complex with pyridoxal-5'-phosphate at 1.9 angstrom. 0.9257 11 363
5u3f-assembly1.cif.gz_B structure of mycobacterium tuberculosis ilve, a branched-chain amino acid transaminase, in complex with d-cycloserine derivative 0.923 39 362
5u3f-assembly1.cif.gz_A structure of mycobacterium tuberculosis ilve, a branched-chain amino acid transaminase, in complex with d-cycloserine derivative 0.9202 41 362
ID Description Score Start End Superfamily
af_P9WQ75_8_180_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9554 13 184 3.90.180.10
3jz6B01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9496 11 182 3.30.470.10
af_P9WQ75_8_180_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9447 13 184 3.90.180.10
5u3fA01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9439 41 177 3.30.470.10
af_Q54N47_13_190_3.30.470.10 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9377 13 184 3.30.470.10
ID Description Score Start End GO Terms
AF-A0A2W6U3X1-F1-model_v4 Branched chain amino acid aminotransferase (EC 2.6.1.42) 0.9862 238 364 GO:0004084
GO:0009081
AF-A0A2W6U3X1-F1-model_v4 Branched chain amino acid aminotransferase (EC 2.6.1.42) 0.9785 238 364 GO:0004084
GO:0009081
AF-A0A1X0FIJ2-F1-model_v4 Branched-chain-amino-acid aminotransferase (EC 2.6.1.42) 0.957 9 364 GO:0009097
GO:0009098
GO:0009099
GO:0052655
GO:0052656
AF-A0A261F602-F1-model_v4 Branched-chain-amino-acid aminotransferase (EC 2.6.1.42) 0.9566 13 362 GO:0009097
GO:0009098
GO:0009099
GO:0052655
GO:0052656
AF-A0A4V2MU24-F1-model_v4 Branched-chain-amino-acid aminotransferase (EC 2.6.1.42) 0.9542 13 364 GO:0009097
GO:0009098
GO:0009099
GO:0052655
GO:0052656

Map