F293281
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 190 | 132 | 380 | 367 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2643221575|2643885742 |
| Length | 417 |
| Sequence | DAPSFPETDLAPLEFAVTKNLASKSAAQRDEILVDPGFGKYFTDHMVDVCWSASGGWHRPRVQPYGPIALDPAAAVLHYGQEIFEGIKVYRHADGSIHTFRPDQNGLRLQRSARRLALPELPVEYFIQAIQEIVAADSAWVPCGEDQSLYLRPFMFAKEAFLGVRPAQKVAFYVIASPAGAYFTGGVQPVSLWLSEDHSRAGKGGTGAAKTGGNYAASLLPQSDAYANGCDQTVFLDEDRNVEEVGSMNVVFVYQDGRIVTPHSDSILEGITRDSLLQLAADRGHTIERGRVSVQDWRAGVASGDIVEVFACGTAAVVTPIGVLKGRXRSSPSRRHTIERGRVSVQDWRAGVASGDIVEVFACGTAAVVTPIGVLKGRDFVDEQPRGELALSLRQELTDIQYGRVADRHGWLLRLGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 2 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 3 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 6 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 7 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 8 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 9 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 10 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 11 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 12 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 13 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 14 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 15 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 16 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 17 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 18 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 19 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 20 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 21 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 22 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 23 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 36 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 37 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 38 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 39 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 40 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 41 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 42 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 43 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 44 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 45 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 46 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 47 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 48 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 49 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 50 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 51 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 52 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 53 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 54 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 55 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 56 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 57 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 58 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 59 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 60 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 61 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 62 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 63 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 64 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 65 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 66 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 67 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 68 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 69 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 70 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 71 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 72 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 73 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 74 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 75 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 76 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 77 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 78 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 79 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 80 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 81 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 82 | 2643221542 | Microbacterium sp. Root1433D1 | Isolate | Unclassified |
| 83 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 84 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 85 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 86 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 87 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 88 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 89 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 90 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 91 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 92 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 93 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 94 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 95 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 96 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 97 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 98 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 99 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 100 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 101 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 102 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 103 | 2852663356 | Microbacterium sp. JAI119 | Isolate | Rhizosphere |
| 104 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 105 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 106 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 107 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 108 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 109 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 110 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 111 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 112 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 113 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 114 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 115 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 116 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 117 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 118 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 119 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 120 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 121 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 122 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 123 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 124 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 125 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 126 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 127 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 128 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 129 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 130 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
| 131 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 132 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 69.47 |
| Metatranscriptomes | 1.58 |
| Isolates | 28.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 1.05 |
| Bulb | 0 |
| Endosphere | 12.11 |
| Nodule | 0 |
| Rhizoplane | 5.26 |
| Rhizosphere | 38.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006562J51391_1156571 | 3300003578 | Bacteria | 9730 |
| 2 | Ga0006562J51391_1156572 | 3300003578 | Bacteria | 4870 |
| 3 | Ga0068853_100268200 | 3300005539 | Bacteria | 1571 |
| 4 | Ga0070672_100251018 | 3300005543 | Bacteria | 1490 |
| 5 | Ga0070665_100155453 | 3300005548 | Bacteria | 2289 |
| 6 | Ga0068851_10000001 | 3300005834 | Bacteria | 495512 |
| 7 | Ga0075365_10000638 | 3300006038 | Bacteria | 13886 |
| 8 | Ga0075368_10048401 | 3300006042 | Bacteria | 1685 |
| 9 | Ga0075364_10077314 | 3300006051 | Bacteria | 2197 |
| 10 | Ga0075364_10077553 | 3300006051 | Bacteria | 2193 |
| 11 | Ga0075367_10000690 | 3300006178 | Bacteria | 12986 |
| 12 | Ga0075370_10018868 | 3300006353 | Bacteria | 3746 |
| 13 | Ga0105240_10002391 | 3300009093 | Bacteria | 30231 |
| 14 | Ga0105245_10051674 | 3300009098 | Bacteria | 3684 |
| 15 | Ga0105241_10002890 | 3300009174 | Bacteria | 12843 |
| 16 | Ga0105248_10032315 | 3300009177 | Bacteria | 5851 |
| 17 | Ga0105237_10000341 | 3300009545 | Bacteria | 65672 |
| 18 | Ga0105237_10076801 | 3300009545 | Bacteria | 3330 |
| 19 | Ga0105238_10001701 | 3300009551 | Bacteria | 22154 |
| 20 | Ga0105239_10054282 | 3300010375 | Bacteria | 4394 |
| 21 | Ga0157369_10230454 | 3300013105 | Bacteria | 1937 |
| 22 | Ga0171462_1003 | 3300013250 | Bacteria | 853796 |
| 23 | Ga0157374_10374890 | 3300013296 | Bacteria | 1417 |
| 24 | Ga0209148_1000528 | 3300025254 | Bacteria | 37646 |
| 25 | Ga0207656_10000002 | 3300025321 | Bacteria | 792178 |
| 26 | Ga0207655_1006870 | 3300025728 | Bacteria | 7468 |
| 27 | Ga0207655_1011242 | 3300025728 | Bacteria | 5343 |
| 28 | Ga0207705_10059745 | 3300025909 | Bacteria | 2752 |
| 29 | Ga0207654_10000001 | 3300025911 | Bacteria | 1816198 |
| 30 | Ga0207695_10002266 | 3300025913 | Bacteria | 28809 |
| 31 | Ga0207671_10000002 | 3300025914 | Bacteria | 1144816 |
| 32 | Ga0207657_10249107 | 3300025919 | Bacteria | 1417 |
| 33 | Ga0207694_10000496 | 3300025924 | Bacteria | 35623 |
| 34 | Ga0207687_10011256 | 3300025927 | Bacteria | 5844 |
| 35 | Ga0207711_10015348 | 3300025941 | Bacteria | 6357 |
| 36 | Ga0207639_10164202 | 3300026041 | Bacteria | 1874 |
| 37 | Ga0207674_10083603 | 3300026116 | Bacteria | 3192 |
| 38 | Ga0207698_10000183 | 3300026142 | Bacteria | 38581 |
| 39 | Ga0207698_10001071 | 3300026142 | Bacteria | 15906 |
| 40 | Ga0307514_10003692 | 3300031649 | Bacteria | 14475 |
| 41 | Ga0307514_10052190 | 3300031649 | Bacteria | 3163 |
| 42 | Ga0307406_10001073 | 3300031901 | Bacteria | 15209 |
| 43 | Ga0307406_10188587 | 3300031901 | Bacteria | 1507 |
| 44 | Ga0307412_10077077 | 3300031911 | Bacteria | 2292 |
| 45 | Ga0307416_100091086 | 3300032002 | Bacteria | 2618 |
| 46 | Ga0307414_10012378 | 3300032004 | Bacteria | 5042 |
| 47 | Ga0307414_10311807 | 3300032004 | Bacteria | 1336 |
| 48 | Ga0495590_0000478 | 3300046457 | Bacteria | 19827 |
| 49 | Ga0495650_0001215 | 3300046471 | Bacteria | 27021 |
| 50 | Ga0495625_0088585 | 3300046660 | Bacteria | 2144 |
| 51 | Ga0496104_0297841 | 3300048907 | Bacteria | 1525 |
| 52 | Ga0496105_0069230 | 3300048908 | Bacteria | 2916 |
| 53 | Ga0496108_0206429 | 3300048911 | Bacteria | 1705 |
| 54 | Ga0496109_0066428 | 3300048912 | Bacteria | 3302 |
| 55 | Ga0496109_0157686 | 3300048912 | Bacteria | 2126 |
| 56 | Ga0496111_0203347 | 3300048914 | Bacteria | 1472 |
| 57 | Ga0496113_0180168 | 3300048916 | Bacteria | 1675 |
| 58 | Ga0496114_0093518 | 3300048917 | Bacteria | 2556 |
| 59 | Ga0496114_0178255 | 3300048917 | Bacteria | 1855 |
| 60 | Ga0496114_0430706 | 3300048917 | Bacteria | 1168 |
| 61 | Ga0496117_0000053 | 3300048920 | Bacteria | 279396 |
| 62 | Ga0496117_0001098 | 3300048920 | Bacteria | 40887 |
| 63 | Ga0496117_0014686 | 3300048920 | Bacteria | 6729 |
| 64 | Ga0496117_0021630 | 3300048920 | Bacteria | 5194 |
| 65 | Ga0496117_0024842 | 3300048920 | Bacteria | 4723 |
| 66 | Ga0496118_0014834 | 3300048921 | Bacteria | 7263 |
| 67 | Ga0496118_0025702 | 3300048921 | Bacteria | 5040 |
| 68 | Ga0496119_0003990 | 3300048922 | Bacteria | 14942 |
| 69 | Ga0496119_0005494 | 3300048922 | Bacteria | 12110 |
| 70 | Ga0496119_0005852 | 3300048922 | Bacteria | 11607 |
| 71 | Ga0496119_0006393 | 3300048922 | Bacteria | 10950 |
| 72 | Ga0496119_0009735 | 3300048922 | Bacteria | 8182 |
| 73 | Ga0496119_0063894 | 3300048922 | Bacteria | 2188 |
| 74 | Ga0496120_0001595 | 3300048923 | Bacteria | 26374 |
| 75 | Ga0496120_0002066 | 3300048923 | Bacteria | 21596 |
| 76 | Ga0496120_0003435 | 3300048923 | Bacteria | 14452 |
| 77 | Ga0496120_0004880 | 3300048923 | Bacteria | 10930 |
| 78 | Ga0496120_0018603 | 3300048923 | Bacteria | 4471 |
| 79 | Ga0496120_0025900 | 3300048923 | Bacteria | 3633 |
| 80 | Ga0496122_0000031 | 3300048925 | Bacteria | 329726 |
| 81 | Ga0496122_0001019 | 3300048925 | Bacteria | 49576 |
| 82 | Ga0496122_0007272 | 3300048925 | Bacteria | 12379 |
| 83 | Ga0496122_0010174 | 3300048925 | Bacteria | 9747 |
| 84 | Ga0496122_0023928 | 3300048925 | Bacteria | 5363 |
| 85 | Ga0496122_0174796 | 3300048925 | Bacteria | 1289 |
| 86 | Ga0496122_0189412 | 3300048925 | Bacteria | 1216 |
| 87 | Ga0496123_0000013 | 3300048926 | Bacteria | 439694 |
| 88 | Ga0496123_0003480 | 3300048926 | Bacteria | 17593 |
| 89 | Ga0496123_0019322 | 3300048926 | Bacteria | 5375 |
| 90 | Ga0496124_0008502 | 3300048927 | Bacteria | 10721 |
| 91 | Ga0496124_0064792 | 3300048927 | Bacteria | 3049 |
| 92 | Ga0496125_0004508 | 3300048928 | Bacteria | 16017 |
| 93 | Ga0496125_0011152 | 3300048928 | Bacteria | 9010 |
| 94 | Ga0496125_0014151 | 3300048928 | Bacteria | 7782 |
| 95 | Ga0496125_0014909 | 3300048928 | Bacteria | 7549 |
| 96 | Ga0496125_0016720 | 3300048928 | Bacteria | 7034 |
| 97 | Ga0496125_0080053 | 3300048928 | Bacteria | 2502 |
| 98 | Ga0496125_0119148 | 3300048928 | Bacteria | 1888 |
| 99 | Ga0496126_0002399 | 3300048929 | Bacteria | 25438 |
| 100 | Ga0496126_0005769 | 3300048929 | Bacteria | 14001 |
| 101 | Ga0496126_0020487 | 3300048929 | Bacteria | 6479 |
| 102 | Ga0496126_0023996 | 3300048929 | Bacteria | 5897 |
| 103 | Ga0496126_0030768 | 3300048929 | Bacteria | 5082 |
| 104 | Ga0496126_0032561 | 3300048929 | Bacteria | 4910 |
| 105 | Ga0496126_0101639 | 3300048929 | Bacteria | 2515 |
| 106 | Ga0501032_0080034 | 3300049569 | Bacteria | 2175 |
| 107 | Ga0501034_0201375 | 3300049571 | Bacteria | 1949 |
| 108 | Ga0501038_0061140 | 3300049574 | Bacteria | 3222 |
| 109 | Ga0501042_0001713 | 3300049578 | Bacteria | 13108 |
| 110 | Ga0501043_0072374 | 3300049579 | Bacteria | 2708 |
| 111 | Ga0501043_0142983 | 3300049579 | Bacteria | 1873 |
| 112 | Ga0501047_0003104 | 3300049581 | Bacteria | 15762 |
| 113 | Ga0501047_0166191 | 3300049581 | Bacteria | 2077 |
| 114 | Ga0501047_0293693 | 3300049581 | Bacteria | 1469 |
| 115 | Ga0501083_0000788 | 3300049744 | Bacteria | 20791 |
| 116 | Ga0501083_0013823 | 3300049744 | Bacteria | 5644 |
| 117 | Ga0501035_0027726 | 3300049822 | Bacteria | 5176 |
| 118 | Ga0501044_0005591 | 3300049823 | Bacteria | 13954 |
| 119 | nmdc:mga03n38_30591_c1 | 3300050490 | Bacteria | 2265 |
| 120 | nmdc:mga00v17_26032_c1 | 3300050491 | Bacteria | 3404 |
| 121 | nmdc:mga00v17_7098_c1 | 3300050491 | Bacteria | 5965 |
| 122 | nmdc:mga06z11_1299_c1 | 3300050494 | Bacteria | 9234 |
| 123 | nmdc:mga04h51_23608_c1 | 3300050495 | Bacteria | 1874 |
| 124 | nmdc:mga07m45_26337_c1 | 3300050496 | Bacteria | 3196 |
| 125 | Ga0500643_000128 | 3300053087 | Bacteria | 78472 |
| 126 | Ga0500559_0000159 | 3300053136 | Bacteria | 53218 |
| 127 | Ga0500559_0000671 | 3300053136 | Bacteria | 22878 |
| 128 | Ga0500559_0051095 | 3300053136 | Bacteria | 1825 |
| 129 | Ga0500568_0002477 | 3300053139 | Bacteria | 10836 |
| 130 | Ga0500573_0000001 | 3300053140 | Bacteria | 436394 |
| 131 | Ga0500573_0001475 | 3300053140 | Bacteria | 11302 |
| 132 | Ga0500573_0092480 | 3300053140 | Bacteria | 1707 |
| 133 | Ga0500573_0141818 | 3300053140 | Bacteria | 1322 |
| 134 | Ga0500577_0082082 | 3300053142 | Bacteria | 1287 |
| 135 | Ga0587091_004008 | 3300059511 | Bacteria | 1899 |
| 136 | 2643885742 | 2643221575 | Bacteria | 4022601 |
| 137 | 2587863231 | 2585428094 | Bacteria | 3604039 |
| 138 | 2588108906 | 2585428157 | Bacteria | 3018951 |
| 139 | 2643733927 | 2643221542 | Bacteria | 3563959 |
| 140 | 2643753652 | 2643221546 | Bacteria | 2910897 |
| 141 | 2643785490 | 2643221553 | Bacteria | 3544260 |
| 142 | 2643848637 | 2643221566 | Bacteria | 3460379 |
| 143 | 2643885744 | 2643221575 | Bacteria | 4022601 |
| 144 | 2643996138 | 2643221597 | Bacteria | 3347721 |
| 145 | 2644170508 | 2643221630 | Bacteria | 3601215 |
| 146 | 2644277183 | 2643221649 | Bacteria | 3867359 |
| 147 | 2644679904 | 2643221724 | Bacteria | 3593515 |
| 148 | 2730229370 | 2728369380 | Bacteria | 3620317 |
| 149 | 2758226383 | 2757320536 | Bacteria | 3629334 |
| 150 | 2774380135 | 2773857758 | Bacteria | 3592392 |
| 151 | 2774384246 | 2773857759 | Bacteria | 2963774 |
| 152 | 2774399207 | 2773857763 | Bacteria | 4180068 |
| 153 | 2808630950 | 2808606306 | Bacteria | 3608896 |
| 154 | 2808885851 | 2808606368 | Bacteria | 3174172 |
| 155 | 2809227634 | 2808606447 | Bacteria | 3572005 |
| 156 | 2812323517 | 2811994872 | Bacteria | 4121241 |
| 157 | 2821270256 | 2821268502 | Bacteria | 3750023 |
| 158 | 2833711218 | 2833709550 | Bacteria | 4008291 |
| 159 | 2852634399 | 2852632344 | Bacteria | 3463163 |
| 160 | 2852647089 | 2852646457 | Bacteria | 3408613 |
| 161 | 2852664957 | 2852663356 | Bacteria | 4090475 |
| 162 | 2857720085 | 2857720070 | Bacteria | 3189373 |
| 163 | 2857723539 | 2857723135 | Bacteria | 4217853 |
| 164 | 2857730206 | 2857729791 | Bacteria | 4040535 |
| 165 | 2862994831 | 2862993130 | Bacteria | 3860849 |
| 166 | 2870624413 | 2870622029 | Bacteria | 3643329 |
| 167 | 2870630588 | 2870628048 | Bacteria | 3696012 |
| 168 | 2904511751 | 2904509784 | Bacteria | 3520416 |
| 169 | 2906803102 | 2906799679 | Bacteria | 4031749 |
| 170 | 2908680673 | 2908678064 | Bacteria | 3482747 |
| 171 | 2914763764 | 2914759650 | Bacteria | 4701441 |
| 172 | 2919071770 | 2919069694 | Bacteria | 3622919 |
| 173 | 2919396336 | 2919395869 | Bacteria | 3704152 |
| 174 | 2928092085 | 2928090899 | Bacteria | 3158267 |
| 175 | 2939660778 | 2939657138 | Bacteria | 3740283 |
| 176 | 2945971545 | 2945968032 | Bacteria | 4111363 |
| 177 | 2946034037 | 2946033335 | Bacteria | 3835514 |
| 178 | 2946081204 | 2946080515 | Bacteria | 4310960 |
| 179 | 2952253678 | 2952252522 | Bacteria | 4171745 |
| 180 | 2974297408 | 2974294766 | Bacteria | 3767688 |
| 181 | 2974326355 | 2974324384 | Bacteria | 3750535 |
| 182 | 2977237007 | 2977236895 | Bacteria | 3569373 |
| 183 | 2977254170 | 2977251589 | Bacteria | 2952848 |
| 184 | 2977266876 | 2977264416 | Bacteria | 3750737 |
| 185 | 2984545200 | 2984542743 | Bacteria | 3569378 |
| 186 | 2984581150 | 2984580707 | Bacteria | 3351387 |
| 187 | 8004185399 | 8004182704 | Bacteria | 3391155 |
| 188 | 8004213879 | 8004212874 | Bacteria | 2861420 |
| 189 | 8016257302 | 8016254467 | Bacteria | 3797036 |
| 190 | 8046353207 | 8046352972 | Bacteria | 3613806 |
| 191 | Ga0006562J51391_1156571 | |||
| 192 | Ga0006562J51391_1156572 | |||
| 193 | Ga0068853_100268200 | |||
| 194 | Ga0070672_100251018 | |||
| 195 | Ga0070665_100155453 | |||
| 196 | Ga0068851_10000001 | |||
| 197 | Ga0075365_10000638 | |||
| 198 | Ga0075368_10048401 | |||
| 199 | Ga0075364_10077314 | |||
| 200 | Ga0075364_10077553 | |||
| 201 | Ga0075367_10000690 | |||
| 202 | Ga0075370_10018868 | |||
| 203 | Ga0105240_10002391 | |||
| 204 | Ga0105245_10051674 | |||
| 205 | Ga0105241_10002890 | |||
| 206 | Ga0105248_10032315 | |||
| 207 | Ga0105237_10000341 | |||
| 208 | Ga0105237_10076801 | |||
| 209 | Ga0105238_10001701 | |||
| 210 | Ga0105239_10054282 | |||
| 211 | Ga0157369_10230454 | |||
| 212 | Ga0171462_1003 | |||
| 213 | Ga0157374_10374890 | |||
| 214 | Ga0209148_1000528 | |||
| 215 | Ga0207656_10000002 | |||
| 216 | Ga0207655_1006870 | |||
| 217 | Ga0207655_1011242 | |||
| 218 | Ga0207705_10059745 | |||
| 219 | Ga0207654_10000001 | |||
| 220 | Ga0207695_10002266 | |||
| 221 | Ga0207671_10000002 | |||
| 222 | Ga0207657_10249107 | |||
| 223 | Ga0207694_10000496 | |||
| 224 | Ga0207687_10011256 | |||
| 225 | Ga0207711_10015348 | |||
| 226 | Ga0207639_10164202 | |||
| 227 | Ga0207674_10083603 | |||
| 228 | Ga0207698_10000183 | |||
| 229 | Ga0207698_10001071 | |||
| 230 | Ga0307514_10003692 | |||
| 231 | Ga0307514_10052190 | |||
| 232 | Ga0307406_10001073 | |||
| 233 | Ga0307406_10188587 | |||
| 234 | Ga0307412_10077077 | |||
| 235 | Ga0307416_100091086 | |||
| 236 | Ga0307414_10012378 | |||
| 237 | Ga0307414_10311807 | |||
| 238 | Ga0495590_0000478 | |||
| 239 | Ga0495650_0001215 | |||
| 240 | Ga0495625_0088585 | |||
| 241 | Ga0496104_0297841 | |||
| 242 | Ga0496105_0069230 | |||
| 243 | Ga0496108_0206429 | |||
| 244 | Ga0496109_0066428 | |||
| 245 | Ga0496109_0157686 | |||
| 246 | Ga0496111_0203347 | |||
| 247 | Ga0496113_0180168 | |||
| 248 | Ga0496114_0093518 | |||
| 249 | Ga0496114_0178255 | |||
| 250 | Ga0496114_0430706 | |||
| 251 | Ga0496117_0000053 | |||
| 252 | Ga0496117_0001098 | |||
| 253 | Ga0496117_0014686 | |||
| 254 | Ga0496117_0021630 | |||
| 255 | Ga0496117_0024842 | |||
| 256 | Ga0496118_0014834 | |||
| 257 | Ga0496118_0025702 | |||
| 258 | Ga0496119_0003990 | |||
| 259 | Ga0496119_0005494 | |||
| 260 | Ga0496119_0005852 | |||
| 261 | Ga0496119_0006393 | |||
| 262 | Ga0496119_0009735 | |||
| 263 | Ga0496119_0063894 | |||
| 264 | Ga0496120_0001595 | |||
| 265 | Ga0496120_0002066 | |||
| 266 | Ga0496120_0003435 | |||
| 267 | Ga0496120_0004880 | |||
| 268 | Ga0496120_0018603 | |||
| 269 | Ga0496120_0025900 | |||
| 270 | Ga0496122_0000031 | |||
| 271 | Ga0496122_0001019 | |||
| 272 | Ga0496122_0007272 | |||
| 273 | Ga0496122_0010174 | |||
| 274 | Ga0496122_0023928 | |||
| 275 | Ga0496122_0174796 | |||
| 276 | Ga0496122_0189412 | |||
| 277 | Ga0496123_0000013 | |||
| 278 | Ga0496123_0003480 | |||
| 279 | Ga0496123_0019322 | |||
| 280 | Ga0496124_0008502 | |||
| 281 | Ga0496124_0064792 | |||
| 282 | Ga0496125_0004508 | |||
| 283 | Ga0496125_0011152 | |||
| 284 | Ga0496125_0014151 | |||
| 285 | Ga0496125_0014909 | |||
| 286 | Ga0496125_0016720 | |||
| 287 | Ga0496125_0080053 | |||
| 288 | Ga0496125_0119148 | |||
| 289 | Ga0496126_0002399 | |||
| 290 | Ga0496126_0005769 | |||
| 291 | Ga0496126_0020487 | |||
| 292 | Ga0496126_0023996 | |||
| 293 | Ga0496126_0030768 | |||
| 294 | Ga0496126_0032561 | |||
| 295 | Ga0496126_0101639 | |||
| 296 | Ga0501032_0080034 | |||
| 297 | Ga0501034_0201375 | |||
| 298 | Ga0501038_0061140 | |||
| 299 | Ga0501042_0001713 | |||
| 300 | Ga0501043_0072374 | |||
| 301 | Ga0501043_0142983 | |||
| 302 | Ga0501047_0003104 | |||
| 303 | Ga0501047_0166191 | |||
| 304 | Ga0501047_0293693 | |||
| 305 | Ga0501083_0000788 | |||
| 306 | Ga0501083_0013823 | |||
| 307 | Ga0501035_0027726 | |||
| 308 | Ga0501044_0005591 | |||
| 309 | nmdc:mga03n38_30591_c1 | |||
| 310 | nmdc:mga00v17_26032_c1 | |||
| 311 | nmdc:mga00v17_7098_c1 | |||
| 312 | nmdc:mga06z11_1299_c1 | |||
| 313 | nmdc:mga04h51_23608_c1 | |||
| 314 | nmdc:mga07m45_26337_c1 | |||
| 315 | Ga0500643_000128 | |||
| 316 | Ga0500559_0000159 | |||
| 317 | Ga0500559_0000671 | |||
| 318 | Ga0500559_0051095 | |||
| 319 | Ga0500568_0002477 | |||
| 320 | Ga0500573_0000001 | |||
| 321 | Ga0500573_0001475 | |||
| 322 | Ga0500573_0092480 | |||
| 323 | Ga0500573_0141818 | |||
| 324 | Ga0500577_0082082 | |||
| 325 | Ga0587091_004008 | |||
| 326 | 2643885742 | |||
| 327 | 2587863231 | |||
| 328 | 2588108906 | |||
| 329 | 2643733927 | |||
| 330 | 2643753652 | |||
| 331 | 2643785490 | |||
| 332 | 2643848637 | |||
| 333 | 2643885744 | |||
| 334 | 2643996138 | |||
| 335 | 2644170508 | |||
| 336 | 2644277183 | |||
| 337 | 2644679904 | |||
| 338 | 2730229370 | |||
| 339 | 2758226383 | |||
| 340 | 2774380135 | |||
| 341 | 2774384246 | |||
| 342 | 2774399207 | |||
| 343 | 2808630950 | |||
| 344 | 2808885851 | |||
| 345 | 2809227634 | |||
| 346 | 2812323517 | |||
| 347 | 2821270256 | |||
| 348 | 2833711218 | |||
| 349 | 2852634399 | |||
| 350 | 2852647089 | |||
| 351 | 2852664957 | |||
| 352 | 2857720085 | |||
| 353 | 2857723539 | |||
| 354 | 2857730206 | |||
| 355 | 2862994831 | |||
| 356 | 2870624413 | |||
| 357 | 2870630588 | |||
| 358 | 2904511751 | |||
| 359 | 2906803102 | |||
| 360 | 2908680673 | |||
| 361 | 2914763764 | |||
| 362 | 2919071770 | |||
| 363 | 2919396336 | |||
| 364 | 2928092085 | |||
| 365 | 2939660778 | |||
| 366 | 2945971545 | |||
| 367 | 2946034037 | |||
| 368 | 2946081204 | |||
| 369 | 2952253678 | |||
| 370 | 2974297408 | |||
| 371 | 2974326355 | |||
| 372 | 2977237007 | |||
| 373 | 2977254170 | |||
| 374 | 2977266876 | |||
| 375 | 2984545200 | |||
| 376 | 2984581150 | |||
| 377 | 8004185399 | |||
| 378 | 8004213879 | |||
| 379 | 8016257302 | |||
| 380 | 8046353207 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3jz6-assembly1.cif.gz_B | crystal structure of mycobacterium smegmatis branched chain aminotransferase in complex with pyridoxal-5'-phosphate at 1.9 angstrom. | 0.9537 | 11 | 363 |
| 3ht5-assembly1.cif.gz_A-2 | crystal structure of ilve a branched chain amino acid transaminase from mycobacterium tuberculosis | 0.9436 | 39 | 362 |
| 3jz6-assembly1.cif.gz_B | crystal structure of mycobacterium smegmatis branched chain aminotransferase in complex with pyridoxal-5'-phosphate at 1.9 angstrom. | 0.9257 | 11 | 363 |
| 5u3f-assembly1.cif.gz_B | structure of mycobacterium tuberculosis ilve, a branched-chain amino acid transaminase, in complex with d-cycloserine derivative | 0.923 | 39 | 362 |
| 5u3f-assembly1.cif.gz_A | structure of mycobacterium tuberculosis ilve, a branched-chain amino acid transaminase, in complex with d-cycloserine derivative | 0.9202 | 41 | 362 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WQ75_8_180_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9554 | 13 | 184 | 3.90.180.10 |
| 3jz6B01 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain | 0.9496 | 11 | 182 | 3.30.470.10 |
| af_P9WQ75_8_180_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9447 | 13 | 184 | 3.90.180.10 |
| 5u3fA01 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain | 0.9439 | 41 | 177 | 3.30.470.10 |
| af_Q54N47_13_190_3.30.470.10 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain | 0.9377 | 13 | 184 | 3.30.470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W6U3X1-F1-model_v4 | Branched chain amino acid aminotransferase (EC 2.6.1.42) | 0.9862 | 238 | 364 |
GO:0004084
GO:0009081 |
| AF-A0A2W6U3X1-F1-model_v4 | Branched chain amino acid aminotransferase (EC 2.6.1.42) | 0.9785 | 238 | 364 |
GO:0004084
GO:0009081 |
| AF-A0A1X0FIJ2-F1-model_v4 | Branched-chain-amino-acid aminotransferase (EC 2.6.1.42) | 0.957 | 9 | 364 |
GO:0009097
GO:0009098 GO:0009099 GO:0052655 GO:0052656 |
| AF-A0A261F602-F1-model_v4 | Branched-chain-amino-acid aminotransferase (EC 2.6.1.42) | 0.9566 | 13 | 362 |
GO:0009097
GO:0009098 GO:0009099 GO:0052655 GO:0052656 |
| AF-A0A4V2MU24-F1-model_v4 | Branched-chain-amino-acid aminotransferase (EC 2.6.1.42) | 0.9542 | 13 | 364 |
GO:0009097
GO:0009098 GO:0009099 GO:0052655 GO:0052656 |