F293312

General Info

Members Datasets Scaffolds Average Seq Length
190 145 175 470

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2886848708|2886853329
Length 511
Sequence ALAIFLVIAGGLLAGGGFVLGRSTGHSLTAPTAAAPAASSAAEGERRVLYWHDPMVPGPRFDKPGKSPFMDMQLVPVYADEAGDAGDAGHSGVKVSPAIQQNLGIRTARVKRSDVSASFDAVGTVQFDERLDIAVQTRVAGYVEHLAVRAPMEQVRKGQALATVFAPEWLAPQNELLALKRAGVSADLIAAARDRMRAMSIPDGLIRQSEETGIAQARFTLSAPATGVVAELGVREGVQVQPGTTLFRIAGLEKVWAVAEIPETQVTRLARGQKVKAVLQADPAQAFDGELKELLPQVSANTRTLQARFEVDNKAGRLTPGMLLRLQVTGAPASRLAVPSEAVIRTGTRAVAIVRNGNGGFSPRDIQLGADLGDQLEVLEGLRDGDEVVASGQFLIDSEARLKSVLDAMAPPQPKASAASSAGSDAGAGAGVPAGGSYSAEGKVEDVEADTLTISHGPIAALKWPAMTMGFSKPRAKAFPEVKAGDRVRFEFKKAGDDYELVAVYRMGDAK

Samples

Sample ID Description Type Environment
1 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
2 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
3 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
4 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
5 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
6 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
7 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
8 2885198086 Variovorax sp. 679 Isolate Unclassified
9 2885211737 Variovorax sp. 553 Isolate Unclassified
10 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
11 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
12 2904456579 Variovorax sp. 2002 Isolate Unclassified
13 2928070936 Variovorax gossypii 1167 Isolate Unclassified
14 2929520902 Variovorax beijingensis 502 Isolate Unclassified
15 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
16 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
50 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
69 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
70 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
99 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
105 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
112 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
113 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
121 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
122 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
123 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
124 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
125 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
126 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
127 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
128 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
129 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
130 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
131 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
132 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
133 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
134 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
135 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
136 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
137 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
138 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
139 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
140 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
141 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
142 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
143 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
144 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
145 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.58
Metatranscriptomes 0.53
Isolates 7.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 36.32
Nodule 2.11
Rhizoplane 1.05
Rhizosphere 46.32
Stem 0
Stem Tuber 0
Unclassified 14.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000769 3300003187 Bacteria 25987
2 JGI25151J46595_10004730 3300003187 Bacteria 7155
3 JGI25153J46596_10002405 3300003215 Bacteria 10811
4 JGI25153J46596_10003030 3300003215 Bacteria 9502
5 rootL2_10028537 3300003322 Bacteria 13732
6 rootH1_10004398 3300003323 Bacteria 61450
7 rootH1_10116076 3300003323 Bacteria 6083
8 Ga0006562J51391_1031081 3300003578 Bacteria 3540
9 Ga0055537_1002041 3300003773 Bacteria 7124
10 Ga0055536_1002627 3300003781 Bacteria 10001
11 Ga0055536_1003465 3300003781 Bacteria 8456
12 Ga0055528_1004088 3300003790 Bacteria 7120
13 Ga0055530_10001049 3300003791 Bacteria 21923
14 Ga0055530_10008651 3300003791 Bacteria 4033
15 Ga0055540_1000375 3300003792 Bacteria 37385
16 Ga0055540_1001417 3300003792 Bacteria 14286
17 Ga0055540_1002501 3300003792 Bacteria 9628
18 Ga0055531_10001380 3300003794 Bacteria 18013
19 Ga0065165_1006860 3300005262 Bacteria 5792
20 Ga0070660_100019100 3300005339 Bacteria 5017
21 Ga0070659_100004316 3300005366 Bacteria 10153
22 Ga0070667_100177964 3300005367 Bacteria 1880
23 Ga0070700_100004134 3300005441 Bacteria 7569
24 Ga0068867_100008938 3300005459 Bacteria 7070
25 Ga0070672_100010178 3300005543 Bacteria 6514
26 Ga0070665_100054976 3300005548 Bacteria 3992
27 Ga0068855_100113388 3300005563 Bacteria 3110
28 Ga0068866_10007032 3300005718 Bacteria 4704
29 Ga0068861_100044095 3300005719 Bacteria 3352
30 Ga0068858_100040481 3300005842 Bacteria 4322
31 Ga0068860_100010889 3300005843 Bacteria 8969
32 Ga0075365_10001676 3300006038 Bacteria 10235
33 Ga0075363_100001126 3300006048 Bacteria 9732
34 Ga0075364_10000839 3300006051 Bacteria 16170
35 Ga0075432_10003597 3300006058 Bacteria 5266
36 Ga0075362_10000627 3300006177 Bacteria 10323
37 Ga0075362_10002921 3300006177 Bacteria 5858
38 Ga0075362_10011541 3300006177 Bacteria 3484
39 Ga0075367_10007745 3300006178 Bacteria 5523
40 Ga0075366_10001194 3300006195 Bacteria 12874
41 Ga0075366_10120717 3300006195 Bacteria 1579
42 Ga0075370_10007945 3300006353 Bacteria 5434
43 Ga0068865_100001308 3300006881 Bacteria 14489
44 Ga0099823_1004379 3300006944 Bacteria 13785
45 Ga0099826_10045471 3300006948 Bacteria 3001
46 Ga0105240_10005216 3300009093 Bacteria 19440
47 Ga0105243_10005736 3300009148 Bacteria 9640
48 Ga0105243_10008496 3300009148 Bacteria 7881
49 Ga0105242_10085246 3300009176 Bacteria 2649
50 Ga0105248_10066755 3300009177 Bacteria 4039
51 Ga0105237_10003588 3300009545 Bacteria 18362
52 Ga0105249_10006973 3300009553 Bacteria 9855
53 Ga0105239_10003774 3300010375 Bacteria 18433
54 Ga0157319_1000012 3300012497 Bacteria 165761
55 Ga0157373_10145668 3300013100 Bacteria 1666
56 Ga0163162_10008407 3300013306 Bacteria 10067
57 Ga0157375_10035015 3300013308 Bacteria 4788
58 Ga0157375_10036409 3300013308 Bacteria 4707
59 Ga0157380_10045364 3300014326 Bacteria 3449
60 Ga0157380_10049829 3300014326 Bacteria 3305
61 Ga0182008_10000823 3300014497 Bacteria 21636
62 Ga0182008_10001658 3300014497 Bacteria 14678
63 Ga0157379_10054553 3300014968 Bacteria 3571
64 Ga0157376_10204455 3300014969 Bacteria 1819
65 Ga0182007_10005197 3300015262 Bacteria 5751
66 Ga0163161_10078158 3300017792 Bacteria 2432
67 Ga0207425_1001056 3300025245 Bacteria 12739
68 Ga0209129_1001710 3300025258 Bacteria 11844
69 Ga0209129_1004025 3300025258 Bacteria 6016
70 Ga0209565_1001808 3300025263 Bacteria 8611
71 Ga0209673_1002056 3300025273 Bacteria 15226
72 Ga0209673_1003900 3300025273 Bacteria 8391
73 Ga0209673_1004729 3300025273 Bacteria 7164
74 Ga0209673_1019807 3300025273 Bacteria 2404
75 Ga0209675_1003450 3300025291 Bacteria 7513
76 Ga0209676_1000004 3300025292 Bacteria 1138360
77 Ga0209676_1000293 3300025292 Bacteria 101210
78 Ga0209025_1000238 3300025294 Bacteria 128478
79 Ga0209025_1006913 3300025294 Bacteria 8642
80 Ga0209564_1007624 3300025295 Bacteria 5539
81 Ga0209758_1000122 3300025297 Bacteria 190970
82 Ga0209758_1005501 3300025297 Bacteria 9704
83 Ga0209050_1000002 3300025298 Bacteria 1792849
84 Ga0209050_1000283 3300025298 Bacteria 107761
85 Ga0209050_1006277 3300025298 Bacteria 7110
86 Ga0209256_1000794 3300025299 Bacteria 40601
87 Ga0209051_1000002 3300025303 Bacteria 1631846
88 Ga0209051_1000130 3300025303 Bacteria 141656
89 Ga0209051_1000271 3300025303 Bacteria 86541
90 Ga0209051_1001186 3300025303 Bacteria 23570
91 Ga0209257_1000002 3300025304 Bacteria 1767052
92 Ga0209257_1000584 3300025304 Bacteria 61023
93 Ga0207642_10005855 3300025899 Bacteria 4045
94 Ga0207671_10012313 3300025914 Bacteria 6885
95 Ga0207657_10008386 3300025919 Bacteria 10496
96 Ga0207709_10000435 3300025935 Bacteria 39552
97 Ga0207709_10028386 3300025935 Bacteria 3234
98 Ga0207712_10092054 3300025961 Bacteria 2234
99 Ga0207703_10068224 3300026035 Bacteria 2930
100 Ga0207708_10006113 3300026075 Bacteria 8928
101 Ga0207648_10001566 3300026089 Bacteria 25104
102 Ga0207674_10009582 3300026116 Bacteria 11048
103 Ga0207675_100000193 3300026118 Bacteria 55695
104 Ga0207675_100079262 3300026118 Bacteria 3077
105 Ga0209389_1037590 3300027296 Bacteria 3843
106 Ga0268266_10122631 3300028379 Bacteria 2314
107 Ga0268264_10012199 3300028381 Bacteria 7072
108 Ga0307517_10060305 3300028786 Bacteria 3614
109 Ga0307517_10143671 3300028786 Bacteria 1664
110 Ga0307515_10007820 3300028794 Bacteria 21030
111 Ga0307515_10021706 3300028794 Bacteria 11364
112 Ga0307515_10044073 3300028794 Bacteria 6908
113 Ga0307513_10039768 3300031456 Bacteria 5209
114 Ga0307513_10047914 3300031456 Bacteria 4644
115 Ga0307408_100020871 3300031548 Bacteria 4425
116 Ga0307408_100040878 3300031548 Bacteria 3285
117 Ga0307408_100176808 3300031548 Bacteria 1708
118 Ga0307514_10004338 3300031649 Bacteria 13072
119 Ga0307514_10061085 3300031649 Bacteria 2872
120 Ga0307516_10000442 3300031730 Bacteria 54561
121 Ga0307516_10121758 3300031730 Bacteria 2398
122 Ga0307405_10017371 3300031731 Bacteria 3946
123 Ga0307406_10000418 3300031901 Bacteria 24737
124 Ga0307416_100132939 3300032002 Bacteria 2244
125 Ga0307414_10093747 3300032004 Bacteria 2239
126 Ga0307510_10003899 3300033180 Bacteria 17489
127 Ga0307510_10038448 3300033180 Bacteria 5290
128 Ga0373932_0012666 3300035112 Bacteria 2081
129 Ga0373925_0091007 3300037068 Bacteria 2333
130 Ga0395899_0082341 3300037312 Bacteria 2341
131 Ga0395898_0013832 3300037466 Bacteria 8294
132 Ga0395898_0025833 3300037466 Bacteria 5913
133 Ga0395905_0227254 3300037471 Bacteria 1745
134 Ga0395901_0019266 3300038443 Bacteria 6976
135 Ga0395901_0038586 3300038443 Bacteria 4941
136 Ga0439442_000977 3300042002 Bacteria 5773
137 Ga0439462_0009912 3300042015 Bacteria 2411
138 Ga0439434_0011031 3300042435 Bacteria 2670
139 Ga0466963_0031555 3300044694 Bacteria 3426
140 Ga0466967_0241548 3300045976 Bacteria 1723
141 Ga0495627_005676 3300046453 Bacteria 4985
142 Ga0495592_0000328 3300046454 Bacteria 39423
143 Ga0495650_0003403 3300046471 Bacteria 11639
144 Ga0495606_0104591 3300046507 Bacteria 1718
145 Ga0495610_0035608 3300046512 Bacteria 2553
146 Ga0495616_0001270 3300046513 Bacteria 17729
147 Ga0495620_0015315 3300046515 Bacteria 3875
148 Ga0495630_0042615 3300046517 Bacteria 3390
149 Ga0495643_0016100 3300046522 Bacteria 4400
150 Ga0495609_0029037 3300046538 Bacteria 2521
151 Ga0495597_0018883 3300046542 Bacteria 3231
152 Ga0495656_0005710 3300046615 Bacteria 4314
153 Ga0495625_0012236 3300046660 Bacteria 6959
154 Ga0495624_0078329 3300046690 Bacteria 2050
155 Ga0495687_000716 3300047443 Bacteria 36771
156 Ga0495593_0031139 3300047673 Bacteria 2916
157 Ga0496125_0020073 3300048928 Bacteria 6283
158 Ga0496125_0070378 3300048928 Bacteria 2739
159 nmdc:mga03683_5055_c1 3300050489 Bacteria 4422
160 nmdc:mga03n38_18758_c1 3300050490 Bacteria 2736
161 nmdc:mga00v17_5287_c1 3300050491 Bacteria 6802
162 nmdc:mga0yw44_4620_c1 3300050492 Bacteria 6353
163 nmdc:mga0k408_14771_c1 3300050493 Bacteria 4308
164 nmdc:mga0k408_25051_c1 3300050493 Bacteria 3377
165 nmdc:mga0k408_3559_c1 3300050493 Bacteria 8235
166 Ga0500610_0002726 3300053079 Bacteria 6590
167 Ga0500610_0010766 3300053079 Bacteria 4130
168 Ga0500635_0000041 3300053080 Bacteria 90865
169 Ga0500635_0010838 3300053080 Bacteria 2574
170 Ga0500593_000480 3300053117 Bacteria 15754
171 Ga0500607_000393 3300053121 Bacteria 41936
172 Ga0500658_0027891 3300053134 Bacteria 2187
173 Ga0500616_0042190 3300053153 Bacteria 2444
174 Ga0500627_0004273 3300053158 Bacteria 4555
175 Ga0500634_0019183 3300053161 Bacteria 3681

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031730 Ga0307516_10000442 Ga0307516_1000044214 387
2 3300003215 JGI25153J46596_10003030 JGI25153J46596_100030307 397
3 3300025297 Ga0209758_1000122 Ga0209758_100012245 397
4 3300014969 Ga0157376_10204455 Ga0157376_102044552 398
5 3300053080 Ga0500635_0010838 Ga0500635_0010838_974_2257 402
6 3300003791 Ga0055530_10008651 Ga0055530_100086512 408
7 3300025298 Ga0209050_1000283 Ga0209050_100028382 408
8 3300003323 rootH1_10004398 rootH1_100043982 410
9 3300006195 Ga0075366_10120717 Ga0075366_101207172 410
10 3300025303 Ga0209051_1001186 Ga0209051_10011866 410
11 3300050493 nmdc:mga0k408_25051_c1 nmdc:mga0k408_25051_c1_943_2175 410
12 3300053080 Ga0500635_0000041 Ga0500635_0000041_69100_70344 410
13 3300005548 Ga0070665_100054976 Ga0070665_1000549762 411
14 3300009093 Ga0105240_10005216 Ga0105240_100052167 411
15 3300009545 Ga0105237_10003588 Ga0105237_100035886 411
16 3300010375 Ga0105239_10003774 Ga0105239_100037746 411
17 3300025914 Ga0207671_10012313 Ga0207671_100123137 411
18 3300028379 Ga0268266_10122631 Ga0268266_101226312 411
19 3300033180 Ga0307510_10038448 Ga0307510_100384487 411
20 iso_pu_bacteria 2643221646 2644256210 414
21 3300035112 Ga0373932_0012666 Ga0373932_0012666_657_1904 415
22 3300037068 Ga0373925_0091007 Ga0373925_0091007_371_1618 415
23 3300028786 Ga0307517_10143671 Ga0307517_101436712 417
24 3300046517 Ga0495630_0042615 Ga0495630_0042615_1202_2473 419
25 3300046690 Ga0495624_0078329 Ga0495624_0078329_572_1843 419
26 3300047673 Ga0495593_0031139 Ga0495593_0031139_1045_2316 419
27 3300005719 Ga0068861_100044095 Ga0068861_1000440952 424
28 3300009176 Ga0105242_10085246 Ga0105242_100852463 424
29 3300026118 Ga0207675_100079262 Ga0207675_1000792622 424
30 3300005262 Ga0065165_1006860 Ga0065165_10068604 429
31 3300025273 Ga0209673_1002056 Ga0209673_10020568 429
32 3300031649 Ga0307514_10061085 Ga0307514_100610852 432
33 3300037471 Ga0395905_0227254 Ga0395905_0227254_334_1650 432
34 3300042015 Ga0439462_0009912 Ga0439462_0009912_368_1888 433
35 3300042002 Ga0439442_000977 Ga0439442_000977_2585_4105 447
36 3300003323 rootH1_10116076 rootH1_101160765 450
37 3300031456 Ga0307513_10039768 Ga0307513_100397682 451
38 3300028794 Ga0307515_10007820 Ga0307515_100078206 452
39 3300048928 Ga0496125_0070378 Ga0496125_0070378_533_2056 455
40 3300006177 Ga0075362_10000627 Ga0075362_100006272 457
41 3300028794 Ga0307515_10021706 Ga0307515_100217069 458
42 3300033180 Ga0307510_10003899 Ga0307510_100038992 458
43 3300026116 Ga0207674_10009582 Ga0207674_100095827 459
44 3300046453 Ga0495627_005676 Ga0495627_005676_1431_2939 459
45 3300053161 Ga0500634_0019183 Ga0500634_0019183_750_2258 459
46 3300009177 Ga0105248_10066755 Ga0105248_100667552 460
47 3300044694 Ga0466963_0031555 Ga0466963_0031555_1032_2531 461
48 3300046471 Ga0495650_0003403 Ga0495650_0003403_6754_8262 461
49 3300005367 Ga0070667_100177964 Ga0070667_1001779642 464
50 3300005441 Ga0070700_100004134 Ga0070700_1000041348 464
51 3300005459 Ga0068867_100008938 Ga0068867_1000089388 464
52 3300005543 Ga0070672_100010178 Ga0070672_1000101782 464
53 3300005718 Ga0068866_10007032 Ga0068866_100070322 464
54 3300005842 Ga0068858_100040481 Ga0068858_1000404812 464
55 3300005843 Ga0068860_100010889 Ga0068860_1000108892 464
56 3300006881 Ga0068865_100001308 Ga0068865_10000130813 464
57 3300009553 Ga0105249_10006973 Ga0105249_100069732 464
58 3300013306 Ga0163162_10008407 Ga0163162_100084072 464
59 3300013308 Ga0157375_10035015 Ga0157375_100350152 464
60 3300014326 Ga0157380_10049829 Ga0157380_100498292 464
61 3300014968 Ga0157379_10054553 Ga0157379_100545532 464
62 3300017792 Ga0163161_10078158 Ga0163161_100781582 464
63 3300025899 Ga0207642_10005855 Ga0207642_100058553 464
64 3300025961 Ga0207712_10092054 Ga0207712_100920541 464
65 3300026035 Ga0207703_10068224 Ga0207703_100682242 464
66 3300026075 Ga0207708_10006113 Ga0207708_100061137 464
67 3300026089 Ga0207648_10001566 Ga0207648_1000156623 464
68 3300026118 Ga0207675_100000193 Ga0207675_10000019322 464
69 3300028381 Ga0268264_10012199 Ga0268264_100121992 464
70 3300031730 Ga0307516_10121758 Ga0307516_101217582 464
71 3300053121 Ga0500607_000393 Ga0500607_000393_19559_21067 464
72 3300038443 Ga0395901_0038586 Ga0395901_0038586_3391_4878 465
73 3300009148 Ga0105243_10008496 Ga0105243_100084967 466
74 3300025935 Ga0207709_10000435 Ga0207709_1000043513 466
75 3300046515 Ga0495620_0015315 Ga0495620_0015315_1879_3387 466
76 3300053158 Ga0500627_0004273 Ga0500627_0004273_2112_3620 466
77 3300014497 Ga0182008_10000823 Ga0182008_100008234 467
78 3300053079 Ga0500610_0010766 Ga0500610_0010766_1558_3066 467
79 3300053079 Ga0500610_0002726 Ga0500610_0002726_1211_2719 468
80 3300053117 Ga0500593_000480 Ga0500593_000480_7513_9021 468
81 3300014326 Ga0157380_10045364 Ga0157380_100453642 469
82 3300046615 Ga0495656_0005710 Ga0495656_0005710_1454_2965 469
83 3300046454 Ga0495592_0000328 Ga0495592_0000328_36079_37587 470
84 3300025273 Ga0209673_1019807 Ga0209673_10198072 471
85 3300053134 Ga0500658_0027891 Ga0500658_0027891_265_1800 472
86 3300037312 Ga0395899_0082341 Ga0395899_0082341_700_2184 474
87 3300032004 Ga0307414_10093747 Ga0307414_100937472 475
88 3300045976 Ga0466967_0241548 Ga0466967_0241548_35_1528 475
89 3300003781 Ga0055536_1003465 Ga0055536_10034656 477
90 3300003792 Ga0055540_1002501 Ga0055540_10025015 477
91 3300005563 Ga0068855_100113388 Ga0068855_1001133882 477
92 3300025292 Ga0209676_1000293 Ga0209676_10002939 477
93 3300025303 Ga0209051_1000130 Ga0209051_1000130109 477
94 3300012497 Ga0157319_1000012 Ga0157319_100001268 479
95 3300025304 Ga0209257_1000584 Ga0209257_100058438 479
96 3300050493 nmdc:mga0k408_14771_c1 nmdc:mga0k408_14771_c1_537_2072 479
97 iso_pu_bacteria 2643221544 2643745283 479
98 3300006177 Ga0075362_10002921 Ga0075362_100029212 480
99 3300028786 Ga0307517_10060305 Ga0307517_100603052 480
100 3300005339 Ga0070660_100019100 Ga0070660_1000191004 481
101 3300025299 Ga0209256_1000794 Ga0209256_10007944 481
102 3300025919 Ga0207657_10008386 Ga0207657_100083864 481
103 3300031649 Ga0307514_10004338 Ga0307514_100043386 481
104 3300037466 Ga0395898_0013832 Ga0395898_0013832_4020_5504 481
105 3300038443 Ga0395901_0019266 Ga0395901_0019266_1728_3212 481
106 3300046512 Ga0495610_0035608 Ga0495610_0035608_634_2154 481
107 3300046522 Ga0495643_0016100 Ga0495643_0016100_2099_3619 481
108 3300046660 Ga0495625_0012236 Ga0495625_0012236_3010_4530 481
109 3300006944 Ga0099823_1004379 Ga0099823_10043799 482
110 3300027296 Ga0209389_1037590 Ga0209389_10375902 482
111 3300042435 Ga0439434_0011031 Ga0439434_0011031_549_2018 482
112 3300003187 JGI25151J46595_10004730 JGI25151J46595_100047303 483
113 3300003215 JGI25153J46596_10002405 JGI25153J46596_100024057 483
114 3300003322 rootL2_10028537 rootL2_1002853713 483
115 3300003773 Ga0055537_1002041 Ga0055537_10020413 483
116 3300003781 Ga0055536_1002627 Ga0055536_10026276 483
117 3300003790 Ga0055528_1004088 Ga0055528_10040883 483
118 3300003791 Ga0055530_10001049 Ga0055530_1000104916 483
119 3300003792 Ga0055540_1001417 Ga0055540_10014175 483
120 3300003794 Ga0055531_10001380 Ga0055531_100013806 483
121 3300005366 Ga0070659_100004316 Ga0070659_1000043167 483
122 3300025245 Ga0207425_1001056 Ga0207425_10010564 483
123 3300025258 Ga0209129_1001710 Ga0209129_10017106 483
124 3300025263 Ga0209565_1001808 Ga0209565_10018085 483
125 3300025273 Ga0209673_1003900 Ga0209673_10039002 483
126 3300025273 Ga0209673_1004729 Ga0209673_10047294 483
127 3300025292 Ga0209676_1000004 Ga0209676_1000004417 483
128 3300025294 Ga0209025_1006913 Ga0209025_10069134 483
129 3300025295 Ga0209564_1007624 Ga0209564_10076244 483
130 3300025297 Ga0209758_1005501 Ga0209758_10055015 483
131 3300025298 Ga0209050_1000002 Ga0209050_1000002927 483
132 3300025298 Ga0209050_1006277 Ga0209050_10062776 483
133 3300025303 Ga0209051_1000002 Ga0209051_1000002696 483
134 3300025304 Ga0209257_1000002 Ga0209257_1000002837 483
135 3300028794 Ga0307515_10044073 Ga0307515_100440735 483
136 3300006038 Ga0075365_10001676 Ga0075365_100016763 485
137 3300006048 Ga0075363_100001126 Ga0075363_1000011268 485
138 3300006051 Ga0075364_10000839 Ga0075364_1000083913 485
139 3300006058 Ga0075432_10003597 Ga0075432_100035972 485
140 3300006177 Ga0075362_10011541 Ga0075362_100115412 485
141 3300031548 Ga0307408_100040878 Ga0307408_1000408783 485
142 3300031548 Ga0307408_100176808 Ga0307408_1001768082 485
143 3300031901 Ga0307406_10000418 Ga0307406_100004182 485
144 3300048928 Ga0496125_0020073 Ga0496125_0020073_1983_3491 485
145 3300050489 nmdc:mga03683_5055_c1 nmdc:mga03683_5055_c1_854_2341 485
146 3300050490 nmdc:mga03n38_18758_c1 nmdc:mga03n38_18758_c1_915_2402 485
147 3300050491 nmdc:mga00v17_5287_c1 nmdc:mga00v17_5287_c1_4173_5660 485
148 3300050492 nmdc:mga0yw44_4620_c1 nmdc:mga0yw44_4620_c1_2570_4057 485
149 3300050493 nmdc:mga0k408_3559_c1 nmdc:mga0k408_3559_c1_1847_3340 485
150 3300053153 Ga0500616_0042190 Ga0500616_0042190_592_2097 485
151 iso_pu_bacteria 2838054893 2838056400 485
152 iso_pu_bacteria 2929520902 2929523125 485
153 3300013308 Ga0157375_10036409 Ga0157375_100364092 486
154 3300046542 Ga0495597_0018883 Ga0495597_0018883_340_1833 486
155 3300047443 Ga0495687_000716 Ga0495687_000716_7407_8900 486
156 iso_pu_bacteria 2599185226 2599671329 486
157 iso_pu_bacteria 2599185227 2599679634 486
158 iso_pu_bacteria 2599185229 2599691650 486
159 iso_pu_bacteria 2885198086 2885203269 486
160 iso_pu_bacteria 2885211737 2885217381 486
161 iso_pu_bacteria 2886848708 2886853329 486
162 iso_pu_bacteria 2904449895 2904453421 486
163 iso_pu_bacteria 2904456579 2904459390 486
164 iso_pu_bacteria 2928070936 2928074640 486
165 3300025291 Ga0209675_1003450 Ga0209675_10034504 487
166 3300037466 Ga0395898_0025833 Ga0395898_0025833_3929_5404 487
167 3300046507 Ga0495606_0104591 Ga0495606_0104591_162_1661 487
168 iso_pu_bacteria 2945972063 2945972186 487
169 3300006948 Ga0099826_10045471 Ga0099826_100454713 488
170 3300031456 Ga0307513_10047914 Ga0307513_100479142 488
171 3300006353 Ga0075370_10007945 Ga0075370_100079453 489
172 3300015262 Ga0182007_10005197 Ga0182007_100051972 489
173 iso_pu_bacteria 2643221628 2644160776 489
174 3300003578 Ga0006562J51391_1031081 Ga0006562J51391_10310812 490
175 3300003792 Ga0055540_1000375 Ga0055540_100037537 490
176 3300006178 Ga0075367_10007745 Ga0075367_100077455 490
177 3300013100 Ga0157373_10145668 Ga0157373_101456682 490
178 3300014497 Ga0182008_10001658 Ga0182008_100016586 490
179 3300025303 Ga0209051_1000271 Ga0209051_100027154 490
180 3300046513 Ga0495616_0001270 Ga0495616_0001270_13134_14645 490
181 3300031548 Ga0307408_100020871 Ga0307408_1000208714 491
182 3300031731 Ga0307405_10017371 Ga0307405_100173714 491
183 3300032002 Ga0307416_100132939 Ga0307416_1001329392 491
184 3300046538 Ga0495609_0029037 Ga0495609_0029037_84_1580 493
185 3300003187 JGI25151J46595_10000769 JGI25151J46595_1000076915 494
186 3300006195 Ga0075366_10001194 Ga0075366_100011945 494
187 3300009148 Ga0105243_10005736 Ga0105243_100057362 494
188 3300025258 Ga0209129_1004025 Ga0209129_10040252 494
189 3300025294 Ga0209025_1000238 Ga0209025_100023874 494
190 3300025935 Ga0207709_10028386 Ga0207709_100283862 494

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16576

HlyD_D23

Barrel-sandwich domain of CusB or HlyD membrane-fusion

114

324

0.98

PF19335

HMBD

Heavy metal binding domain

50

77

0.96

PF13437

HlyD_3

HlyD family secretion protein

220

321

0.95

PF11604

CusF_Ec

Copper binding periplasmic protein CusF

442

506

0.94

PF16572

HlyD_D4

Long alpha hairpin domain of cation efflux system protein, CusB

161

214

0.93

Feature Viewer

pLDDT pTM Quality
74.78 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map