F293428

General Info

Members Datasets Scaffolds Average Seq Length
191 156 189 435

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10000408|rootL2_1000040815
Length 457
Sequence MSGPLAIAAVTVTLKDLLSDGLVNHDLSVVGSFAVSASPPDRITVGSEEPNQLNLFLYQVTPNPGWRNVGLPSRDPQGGRSSNPPLALDLHYLLSAYGSRDLNAEILLGYAMQLLHENPILTREQLRTSLGSSPLFVDPDLDGAGTAGSIAGVFGSLSAVDLADQVELIKITPVYLSADELSKLWTAMQARYRPSMAYTVSVVLIQATSPAQAPLPVLRRGEDDRGPVTTAALAPALSGVRSAVSDTFPAVRLGDGLVVLGSNLTPAPGMVAVLDHTMAGQRNELPVSAGPVAGSLLVQLPTFDQGGDVMQAWSVGVWSLSLRLDAAKPQLALRSNSVPLALAPLVALQSPVPPAAPDQSAVCAVGDVVRLSCAPRLQARQLALTEVLFGSLTVPVLDIDTPADTSLPSVVSFKVPDAGTGTYLLRLRVEGIDSLPVKVDAATGRIQFDDHLKLRLP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
3 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
75 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
76 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
111 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
116 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
123 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
124 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
125 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
128 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
129 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
130 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
131 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
134 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
135 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
136 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
140 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
155 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
156 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 0.52
Isolates 1.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.04
Nodule 0
Rhizoplane 1.05
Rhizosphere 83.25
Stem 0
Stem Tuber 0
Unclassified 3.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_11995 2162886007 Bacteria 1973
2 JGI25154J39366_1001926 3300002738 Bacteria 6209
3 rootL2_10000408 3300003322 Bacteria 27969
4 Ga0055526_1000008 3300003771 Bacteria 300059
5 Ga0055537_1000110 3300003773 Bacteria 61934
6 Ga0055524_1000063 3300003775 Bacteria 134627
7 Ga0055534_1000003 3300003784 Bacteria 300063
8 Ga0055528_1000019 3300003790 Bacteria 149715
9 Ga0055530_10000182 3300003791 Bacteria 56371
10 Ga0055531_10000165 3300003794 Bacteria 74768
11 Ga0058863_11846528 3300004799 Unclassified 2356
12 Ga0065704_10072690 3300005289 Bacteria 8141
13 Ga0065712_10078235 3300005290 Bacteria 3375
14 Ga0065715_10089947 3300005293 Bacteria 8029
15 Ga0065715_10100316 3300005293 Bacteria 3317
16 Ga0065707_10007656 3300005295 Bacteria 3247
17 Ga0065707_10134660 3300005295 Bacteria 1862
18 Ga0070658_10124556 3300005327 Unclassified 2144
19 Ga0070683_100002668 3300005329 Bacteria 14257
20 Ga0070683_100202783 3300005329 Bacteria 1884
21 Ga0070690_100004449 3300005330 Bacteria 7782
22 Ga0070670_100031997 3300005331 Bacteria 4529
23 Ga0070670_100081660 3300005331 Bacteria 2777
24 Ga0070666_10009798 3300005335 Bacteria 5986
25 Ga0070680_100006040 3300005336 Bacteria 9180
26 Ga0070682_100000104 3300005337 Bacteria 76111
27 Ga0070682_100005353 3300005337 Bacteria 7141
28 Ga0068868_100037798 3300005338 Bacteria 3744
29 Ga0070689_100069719 3300005340 Unclassified 2743
30 Ga0070675_100002387 3300005354 Bacteria 13985
31 Ga0070674_100067860 3300005356 Bacteria 2510
32 Ga0070673_100001353 3300005364 Bacteria 14315
33 Ga0070673_100054523 3300005364 Bacteria 3145
34 Ga0070673_100085937 3300005364 Bacteria 2562
35 Ga0070688_100019449 3300005365 Bacteria 3934
36 Ga0070667_100000234 3300005367 Bacteria 63276
37 Ga0070705_100080802 3300005440 Unclassified 1995
38 Ga0070694_100042286 3300005444 Bacteria 3044
39 Ga0070694_100107074 3300005444 Bacteria 1986
40 Ga0070678_100002154 3300005456 Bacteria 10681
41 Ga0070681_10017185 3300005458 Bacteria 7233
42 Ga0068867_100011443 3300005459 Bacteria 6260
43 Ga0070685_10049626 3300005466 Bacteria 2421
44 Ga0070698_100156566 3300005471 Bacteria 2224
45 Ga0068853_100000427 3300005539 Bacteria 28683
46 Ga0068853_100034110 3300005539 Bacteria 4318
47 Ga0068853_100107112 3300005539 Bacteria 2478
48 Ga0070672_100083417 3300005543 Bacteria 2565
49 Ga0070686_100197654 3300005544 Bacteria 1439
50 Ga0070695_100000107 3300005545 Bacteria 36673
51 Ga0070695_100031053 3300005545 Bacteria 3329
52 Ga0070665_100006034 3300005548 Bacteria 12380
53 Ga0068855_100016817 3300005563 Bacteria 8796
54 Ga0068855_100046524 3300005563 Bacteria 5129
55 Ga0068857_100087838 3300005577 Unclassified 2781
56 Ga0070702_100038076 3300005615 Bacteria 2675
57 Ga0070702_100065159 3300005615 Bacteria 2133
58 Ga0068852_100016792 3300005616 Bacteria 5722
59 Ga0068859_100012091 3300005617 Bacteria 8675
60 Ga0068864_100000407 3300005618 Bacteria 37294
61 Ga0068864_100021997 3300005618 Bacteria 5345
62 Ga0068851_10036685 3300005834 Bacteria 2455
63 Ga0068863_100001881 3300005841 Bacteria 20836
64 Ga0068858_100000683 3300005842 Bacteria 35395
65 Ga0097621_100025167 3300006237 Bacteria 4655
66 Ga0097621_100068058 3300006237 Bacteria 2936
67 Ga0068871_100010836 3300006358 Bacteria 6672
68 Ga0075433_10100574 3300006852 Bacteria 2560
69 Ga0097620_100012091 3300006931 Bacteria 8675
70 Ga0105240_10004286 3300009093 Bacteria 21797
71 Ga0114129_10143430 3300009147 Bacteria 3272
72 Ga0105248_10002023 3300009177 Bacteria 22481
73 Ga0105248_10049017 3300009177 Bacteria 4738
74 Ga0105248_10125481 3300009177 Bacteria 2896
75 Ga0105237_10115077 3300009545 Bacteria 2683
76 Ga0105249_10078742 3300009553 Unclassified 3058
77 Ga0105249_10134653 3300009553 Bacteria 2363
78 Ga0105249_10283650 3300009553 Bacteria 1655
79 Ga0105239_10005781 3300010375 Bacteria 14427
80 Ga0105239_10018055 3300010375 Bacteria 7803
81 Ga0105239_10029804 3300010375 Bacteria 6000
82 Ga0105239_10190829 3300010375 Bacteria 2293
83 Ga0157369_10142095 3300013105 Bacteria 2540
84 Ga0157374_10060352 3300013296 Bacteria 3549
85 Ga0157378_10003414 3300013297 Bacteria 14105
86 Ga0157378_10063959 3300013297 Bacteria 3289
87 Ga0163162_10000751 3300013306 Bacteria 30197
88 Ga0157375_10000314 3300013308 Bacteria 43446
89 Ga0157375_10033872 3300013308 Bacteria 4859
90 Ga0163163_10000782 3300014325 Bacteria 26991
91 Ga0157380_10151234 3300014326 Bacteria 2007
92 Ga0157379_10002459 3300014968 Bacteria 15514
93 Ga0157376_10040590 3300014969 Bacteria 3804
94 Ga0183360_10001 3300015689 Bacteria 3943671
95 Ga0163161_10017302 3300017792 Bacteria 5043
96 Ga0207425_1000534 3300025245 Bacteria 22988
97 Ga0209646_1000054 3300025246 Bacteria 279447
98 Ga0209565_1000001 3300025263 Bacteria 2950419
99 Ga0209673_1000001 3300025273 Bacteria 3176258
100 Ga0209675_1000001 3300025291 Bacteria 2950293
101 Ga0209564_1000001 3300025295 Bacteria 3176258
102 Ga0209758_1000590 3300025297 Bacteria 56572
103 Ga0209758_1009066 3300025297 Bacteria 6276
104 Ga0209050_1000010 3300025298 Bacteria 980454
105 Ga0209050_1027088 3300025298 Bacteria 1899
106 Ga0209256_1000002 3300025299 Bacteria 1906740
107 Ga0209051_1004862 3300025303 Bacteria 8069
108 Ga0209257_1000027 3300025304 Bacteria 703541
109 Ga0207682_10075351 3300025893 Bacteria 1436
110 Ga0207645_10027150 3300025907 Bacteria 3699
111 Ga0207695_10004956 3300025913 Bacteria 17927
112 Ga0207660_10153583 3300025917 Unclassified 1771
113 Ga0207650_10021712 3300025925 Bacteria 4539
114 Ga0207650_10093221 3300025925 Bacteria 2305
115 Ga0207659_10001368 3300025926 Bacteria 14554
116 Ga0207706_10054202 3300025933 Bacteria 3539
117 Ga0207670_10051754 3300025936 Unclassified 2759
118 Ga0207711_10026167 3300025941 Bacteria 4894
119 Ga0207661_10163340 3300025944 Unclassified 1933
120 Ga0207667_10029903 3300025949 Bacteria 5901
121 Ga0207667_10044655 3300025949 Bacteria 4695
122 Ga0207651_10000631 3300025960 Bacteria 14889
123 Ga0207658_10010061 3300025986 Bacteria 6425
124 Ga0207677_10012542 3300026023 Bacteria 4877
125 Ga0207703_10009301 3300026035 Bacteria 7723
126 Ga0207703_10120298 3300026035 Bacteria 2253
127 Ga0207639_10000936 3300026041 Bacteria 19751
128 Ga0207639_10234700 3300026041 Bacteria 1592
129 Ga0207641_10009685 3300026088 Bacteria 7938
130 Ga0207641_10022252 3300026088 Bacteria 5217
131 Ga0207648_10013343 3300026089 Bacteria 7650
132 Ga0207676_10000359 3300026095 Bacteria 38930
133 Ga0207676_10017441 3300026095 Bacteria 5203
134 Ga0207674_10006167 3300026116 Bacteria 14153
135 Ga0207674_10011453 3300026116 Bacteria 9965
136 Ga0207683_10015186 3300026121 Bacteria 6553
137 Ga0207698_10013928 3300026142 Bacteria 5326
138 Ga0207428_10054998 3300027907 Bacteria 3167
139 Ga0268266_10006812 3300028379 Bacteria 10408
140 Ga0268264_10025058 3300028381 Bacteria 4875
141 Ga0307514_10000557 3300031649 Bacteria 71545
142 Ga0307516_10009998 3300031730 Bacteria 10504
143 Ga0307413_10204722 3300031824 Bacteria 1428
144 Ga0373956_0064347 3300035119 Bacteria 1665
145 Ga0395905_0006529 3300037471 Bacteria 11726
146 Ga0439431_0003293 3300041997 Bacteria 3553
147 Ga0451577_0002807 3300042876 Bacteria 20101
148 Ga0453684_0000468 3300044712 Bacteria 160571
149 Ga0466957_0040173 3300044842 Bacteria 2825
150 Ga0451576_0000177 3300045051 Bacteria 160589
151 Ga0495629_0036010 3300046459 Bacteria 3496
152 Ga0495639_0017745 3300046475 Unclassified 3092
153 Ga0495585_0000727 3300046492 Bacteria 29387
154 Ga0495607_0002640 3300046501 Bacteria 14394
155 Ga0495631_0002770 3300046518 Bacteria 9724
156 Ga0495633_0000755 3300046558 Bacteria 29189
157 Ga0495668_0008411 3300046616 Bacteria 6449
158 Ga0495661_0000820 3300046665 Bacteria 29146
159 Ga0495669_0030782 3300046684 Unclassified 2355
160 Ga0495670_0000241 3300046691 Bacteria 25246
161 Ga0495671_0000124 3300046692 Bacteria 70221
162 Ga0495581_0007088 3300047315 Bacteria 6490
163 Ga0495674_0004092 3300047319 Bacteria 14101
164 Ga0495677_0003301 3300047445 Bacteria 6284
165 Ga0495681_0009751 3300047470 Bacteria 5882
166 Ga0495684_0088564 3300047471 Unclassified 2346
167 Ga0495686_0005952 3300047472 Bacteria 9494
168 Ga0496110_0040705 3300048913 Unclassified 4051
169 Ga0496112_0028768 3300048915 Bacteria 5368
170 Ga0496121_0000942 3300048924 Bacteria 52638
171 Ga0501031_0000443 3300049568 Bacteria 23880
172 Ga0501032_0010096 3300049569 Bacteria 6816
173 Ga0501036_0016983 3300049572 Bacteria 6081
174 Ga0501037_0004342 3300049573 Bacteria 10291
175 Ga0501038_0001569 3300049574 Bacteria 21155
176 Ga0501039_0000557 3300049575 Bacteria 26996
177 Ga0501042_0004679 3300049578 Bacteria 8730
178 Ga0501043_0023986 3300049579 Bacteria 4786
179 Ga0501046_0000618 3300049580 Bacteria 34970
180 Ga0501035_0022454 3300049822 Bacteria 5795
181 nmdc:mga05p37_117239_c1 3300050507 Bacteria 3272
182 nmdc:mga08y16_1465_c1 3300050511 Bacteria 23670
183 nmdc:mga0n895_27458_c1 3300050512 Bacteria 5407
184 nmdc:mga0n895_342639_c1 3300050512 Unclassified 1514
185 nmdc:mga0a205_46793_c1 3300050515 Bacteria 4172
186 Ga0500651_0000114 3300053093 Bacteria 49491
187 Ga0500651_0013688 3300053093 Bacteria 4950
188 Ga0500559_0000091 3300053136 Bacteria 72157
189 Ga0500573_0005246 3300053140 Bacteria 6927

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_342639_c1 nmdc:mga0n895_342639_c1_59_1162 344
2 3300005615 Ga0070702_100065159 Ga0070702_1000651592 383
3 3300005444 Ga0070694_100107074 Ga0070694_1001070742 393
4 3300005545 Ga0070695_100000107 Ga0070695_1000001072 393
5 3300005340 Ga0070689_100069719 Ga0070689_1000697192 396
6 3300005440 Ga0070705_100080802 Ga0070705_1000808022 396
7 3300025936 Ga0207670_10051754 Ga0207670_100517542 396
8 3300031824 Ga0307413_10204722 Ga0307413_102047222 397
9 3300025297 Ga0209758_1009066 Ga0209758_10090665 401
10 3300025298 Ga0209050_1027088 Ga0209050_10270882 402
11 3300049578 Ga0501042_0004679 Ga0501042_0004679_1675_2973 402
12 3300025245 Ga0207425_1000534 Ga0207425_100053411 404
13 3300025297 Ga0209758_1000590 Ga0209758_100059019 404
14 3300053136 Ga0500559_0000091 Ga0500559_0000091_9032_10363 404
15 3300047445 Ga0495677_0003301 Ga0495677_0003301_1452_2714 405
16 3300053140 Ga0500573_0005246 Ga0500573_0005246_1772_3073 405
17 3300049568 Ga0501031_0000443 Ga0501031_0000443_11910_13220 406
18 3300049569 Ga0501032_0010096 Ga0501032_0010096_3177_4487 406
19 3300049572 Ga0501036_0016983 Ga0501036_0016983_4213_5523 406
20 3300049573 Ga0501037_0004342 Ga0501037_0004342_5412_6722 406
21 3300049575 Ga0501039_0000557 Ga0501039_0000557_19159_20469 406
22 3300049579 Ga0501043_0023986 Ga0501043_0023986_193_1503 406
23 3300049580 Ga0501046_0000618 Ga0501046_0000618_5670_6980 406
24 3300049822 Ga0501035_0022454 Ga0501035_0022454_29_1339 406
25 3300041997 Ga0439431_0003293 Ga0439431_0003293_771_2102 408
26 3300046459 Ga0495629_0036010 Ga0495629_0036010_1935_3245 408
27 3300046475 Ga0495639_0017745 Ga0495639_0017745_1298_2608 408
28 3300047315 Ga0495581_0007088 Ga0495581_0007088_135_1445 408
29 3300047471 Ga0495684_0088564 Ga0495684_0088564_202_1512 408
30 3300004799 Ga0058863_11846528 Ga0058863_118465282 410
31 3300005327 Ga0070658_10124556 Ga0070658_101245562 410
32 3300005329 Ga0070683_100002668 Ga0070683_1000026685 410
33 3300005329 Ga0070683_100202783 Ga0070683_1002027832 410
34 3300005331 Ga0070670_100031997 Ga0070670_1000319973 410
35 3300005336 Ga0070680_100006040 Ga0070680_1000060402 410
36 3300005458 Ga0070681_10017185 Ga0070681_100171857 410
37 3300005539 Ga0068853_100107112 Ga0068853_1001071122 410
38 3300005563 Ga0068855_100046524 Ga0068855_1000465244 410
39 3300005577 Ga0068857_100087838 Ga0068857_1000878382 410
40 3300009545 Ga0105237_10115077 Ga0105237_101150772 410
41 3300010375 Ga0105239_10005781 Ga0105239_1000578114 410
42 3300013105 Ga0157369_10142095 Ga0157369_101420952 410
43 3300025917 Ga0207660_10153583 Ga0207660_101535832 410
44 3300025925 Ga0207650_10021712 Ga0207650_100217122 410
45 3300025944 Ga0207661_10163340 Ga0207661_101633402 410
46 3300025949 Ga0207667_10044655 Ga0207667_100446552 410
47 3300026041 Ga0207639_10234700 Ga0207639_102347001 410
48 3300026116 Ga0207674_10006167 Ga0207674_1000616715 410
49 3300009093 Ga0105240_10004286 Ga0105240_1000428619 411
50 3300025913 Ga0207695_10004956 Ga0207695_1000495612 411
51 3300005471 Ga0070698_100156566 Ga0070698_1001565662 412
52 3300013297 Ga0157378_10003414 Ga0157378_100034148 412
53 iso_pu_bacteria 2643221644 2644243702 412
54 3300046501 Ga0495607_0002640 Ga0495607_0002640_8648_9979 413
55 3300046684 Ga0495669_0030782 Ga0495669_0030782_251_1570 413
56 3300046692 Ga0495671_0000124 Ga0495671_0000124_49156_50487 413
57 3300002738 JGI25154J39366_1001926 JGI25154J39366_10019262 414
58 3300025246 Ga0209646_1000054 Ga0209646_100005470 414
59 3300046492 Ga0495585_0000727 Ga0495585_0000727_4451_5740 414
60 3300046518 Ga0495631_0002770 Ga0495631_0002770_4175_5464 414
61 3300046558 Ga0495633_0000755 Ga0495633_0000755_23635_24924 414
62 3300046616 Ga0495668_0008411 Ga0495668_0008411_4930_6219 414
63 3300046665 Ga0495661_0000820 Ga0495661_0000820_23651_24940 414
64 3300046691 Ga0495670_0000241 Ga0495670_0000241_23663_24952 414
65 3300047470 Ga0495681_0009751 Ga0495681_0009751_127_1416 414
66 3300044712 Ga0453684_0000468 Ga0453684_0000468_70518_71804 415
67 3300044842 Ga0466957_0040173 Ga0466957_0040173_940_2262 415
68 3300045051 Ga0451576_0000177 Ga0451576_0000177_88786_90072 415
69 3300047319 Ga0495674_0004092 Ga0495674_0004092_92_1426 415
70 3300049574 Ga0501038_0001569 Ga0501038_0001569_14626_15915 415
71 3300005290 Ga0065712_10078235 Ga0065712_100782352 416
72 3300005293 Ga0065715_10089947 Ga0065715_100899475 416
73 3300005364 Ga0070673_100054523 Ga0070673_1000545232 416
74 3300005466 Ga0070685_10049626 Ga0070685_100496262 416
75 3300005539 Ga0068853_100000427 Ga0068853_10000042711 416
76 3300005548 Ga0070665_100006034 Ga0070665_1000060349 416
77 3300005563 Ga0068855_100016817 Ga0068855_1000168172 416
78 3300005618 Ga0068864_100021997 Ga0068864_1000219975 416
79 3300006852 Ga0075433_10100574 Ga0075433_101005742 416
80 3300009177 Ga0105248_10049017 Ga0105248_100490172 416
81 3300009553 Ga0105249_10078742 Ga0105249_100787422 416
82 3300009553 Ga0105249_10134653 Ga0105249_101346532 416
83 3300010375 Ga0105239_10018055 Ga0105239_100180553 416
84 3300010375 Ga0105239_10029804 Ga0105239_100298044 416
85 3300025925 Ga0207650_10093221 Ga0207650_100932212 416
86 3300025949 Ga0207667_10029903 Ga0207667_100299032 416
87 3300026041 Ga0207639_10000936 Ga0207639_1000093614 416
88 3300026088 Ga0207641_10022252 Ga0207641_100222522 416
89 3300026095 Ga0207676_10017441 Ga0207676_100174415 416
90 3300026116 Ga0207674_10011453 Ga0207674_100114539 416
91 3300028379 Ga0268266_10006812 Ga0268266_100068129 416
92 3300031730 Ga0307516_10009998 Ga0307516_1000999810 416
93 3300048913 Ga0496110_0040705 Ga0496110_0040705_2080_3438 416
94 3300048915 Ga0496112_0028768 Ga0496112_0028768_2935_4293 416
95 3300050512 nmdc:mga0n895_27458_c1 nmdc:mga0n895_27458_c1_1938_3230 416
96 3300053093 Ga0500651_0013688 Ga0500651_0013688_754_2085 416
97 iso_pu_bacteria 2941489479 2941489947 416
98 3300050507 nmdc:mga05p37_117239_c1 nmdc:mga05p37_117239_c1_700_2001 418
99 3300042876 Ga0451577_0002807 Ga0451577_0002807_7393_8676 419
100 3300003771 Ga0055526_1000008 Ga0055526_100000851 420
101 3300003773 Ga0055537_1000110 Ga0055537_100011028 420
102 3300003775 Ga0055524_1000063 Ga0055524_100006347 420
103 3300003784 Ga0055534_1000003 Ga0055534_1000003202 420
104 3300003790 Ga0055528_1000019 Ga0055528_100001947 420
105 3300015689 Ga0183360_10001 Ga0183360_100012617 420
106 3300025263 Ga0209565_1000001 Ga0209565_10000011250 420
107 3300025273 Ga0209673_1000001 Ga0209673_10000011250 420
108 3300025291 Ga0209675_1000001 Ga0209675_10000011283 420
109 3300025295 Ga0209564_1000001 Ga0209564_10000011445 420
110 3300025299 Ga0209256_1000002 Ga0209256_1000002108 420
111 3300048924 Ga0496121_0000942 Ga0496121_0000942_22912_24204 420
112 3300013296 Ga0157374_10060352 Ga0157374_100603522 421
113 3300047472 Ga0495686_0005952 Ga0495686_0005952_5706_7022 422
114 3300003791 Ga0055530_10000182 Ga0055530_1000018230 423
115 3300003794 Ga0055531_10000165 Ga0055531_1000016512 423
116 3300025298 Ga0209050_1000010 Ga0209050_1000010671 423
117 3300025304 Ga0209257_1000027 Ga0209257_1000027313 423
118 3300031649 Ga0307514_10000557 Ga0307514_1000055750 423
119 3300035119 Ga0373956_0064347 Ga0373956_0064347_251_1564 423
120 3300037471 Ga0395905_0006529 Ga0395905_0006529_8835_10151 423
121 2162886007 SwRhRL2b_contig_11995 SwRhRL2b_0759.00005350 424
122 3300003322 rootL2_10000408 rootL2_1000040815 424
123 3300005289 Ga0065704_10072690 Ga0065704_100726907 424
124 3300005293 Ga0065715_10100316 Ga0065715_101003162 424
125 3300005295 Ga0065707_10007656 Ga0065707_100076562 424
126 3300005295 Ga0065707_10134660 Ga0065707_101346601 424
127 3300005330 Ga0070690_100004449 Ga0070690_1000044497 424
128 3300005331 Ga0070670_100081660 Ga0070670_1000816602 424
129 3300005335 Ga0070666_10009798 Ga0070666_100097984 424
130 3300005337 Ga0070682_100000104 Ga0070682_10000010446 424
131 3300005337 Ga0070682_100005353 Ga0070682_1000053533 424
132 3300005338 Ga0068868_100037798 Ga0068868_1000377982 424
133 3300005354 Ga0070675_100002387 Ga0070675_1000023876 424
134 3300005356 Ga0070674_100067860 Ga0070674_1000678602 424
135 3300005364 Ga0070673_100001353 Ga0070673_1000013538 424
136 3300005364 Ga0070673_100085937 Ga0070673_1000859371 424
137 3300005365 Ga0070688_100019449 Ga0070688_1000194493 424
138 3300005367 Ga0070667_100000234 Ga0070667_10000023427 424
139 3300005444 Ga0070694_100042286 Ga0070694_1000422862 424
140 3300005456 Ga0070678_100002154 Ga0070678_1000021548 424
141 3300005459 Ga0068867_100011443 Ga0068867_1000114435 424
142 3300005539 Ga0068853_100034110 Ga0068853_1000341102 424
143 3300005543 Ga0070672_100083417 Ga0070672_1000834172 424
144 3300005544 Ga0070686_100197654 Ga0070686_1001976541 424
145 3300005545 Ga0070695_100031053 Ga0070695_1000310532 424
146 3300005615 Ga0070702_100038076 Ga0070702_1000380763 424
147 3300005616 Ga0068852_100016792 Ga0068852_1000167923 424
148 3300005617 Ga0068859_100012091 Ga0068859_1000120917 424
149 3300005618 Ga0068864_100000407 Ga0068864_10000040722 424
150 3300005834 Ga0068851_10036685 Ga0068851_100366852 424
151 3300005841 Ga0068863_100001881 Ga0068863_10000188114 424
152 3300005842 Ga0068858_100000683 Ga0068858_10000068321 424
153 3300006237 Ga0097621_100025167 Ga0097621_1000251674 424
154 3300006237 Ga0097621_100068058 Ga0097621_1000680583 424
155 3300006358 Ga0068871_100010836 Ga0068871_1000108364 424
156 3300006931 Ga0097620_100012091 Ga0097620_1000120917 424
157 3300009147 Ga0114129_10143430 Ga0114129_101434302 424
158 3300009177 Ga0105248_10002023 Ga0105248_1000202313 424
159 3300009177 Ga0105248_10125481 Ga0105248_101254812 424
160 3300009553 Ga0105249_10283650 Ga0105249_102836502 424
161 3300010375 Ga0105239_10190829 Ga0105239_101908292 424
162 3300013297 Ga0157378_10063959 Ga0157378_100639594 424
163 3300013306 Ga0163162_10000751 Ga0163162_100007515 424
164 3300013308 Ga0157375_10000314 Ga0157375_100003148 424
165 3300013308 Ga0157375_10033872 Ga0157375_100338724 424
166 3300014325 Ga0163163_10000782 Ga0163163_100007823 424
167 3300014326 Ga0157380_10151234 Ga0157380_101512342 424
168 3300014968 Ga0157379_10002459 Ga0157379_100024596 424
169 3300014969 Ga0157376_10040590 Ga0157376_100405903 424
170 3300017792 Ga0163161_10017302 Ga0163161_100173024 424
171 3300025303 Ga0209051_1004862 Ga0209051_10048624 424
172 3300025893 Ga0207682_10075351 Ga0207682_100753511 424
173 3300025907 Ga0207645_10027150 Ga0207645_100271501 424
174 3300025926 Ga0207659_10001368 Ga0207659_100013684 424
175 3300025933 Ga0207706_10054202 Ga0207706_100542023 424
176 3300025941 Ga0207711_10026167 Ga0207711_100261674 424
177 3300025960 Ga0207651_10000631 Ga0207651_100006314 424
178 3300025986 Ga0207658_10010061 Ga0207658_100100615 424
179 3300026023 Ga0207677_10012542 Ga0207677_100125424 424
180 3300026035 Ga0207703_10009301 Ga0207703_100093012 424
181 3300026035 Ga0207703_10120298 Ga0207703_101202982 424
182 3300026088 Ga0207641_10009685 Ga0207641_100096855 424
183 3300026089 Ga0207648_10013343 Ga0207648_100133432 424
184 3300026095 Ga0207676_10000359 Ga0207676_100003594 424
185 3300026121 Ga0207683_10015186 Ga0207683_100151864 424
186 3300026142 Ga0207698_10013928 Ga0207698_100139283 424
187 3300027907 Ga0207428_10054998 Ga0207428_100549982 424
188 3300028381 Ga0268264_10025058 Ga0268264_100250581 424
189 3300050511 nmdc:mga08y16_1465_c1 nmdc:mga08y16_1465_c1_21947_23263 424
190 3300050515 nmdc:mga0a205_46793_c1 nmdc:mga0a205_46793_c1_1254_2570 424
191 3300053093 Ga0500651_0000114 Ga0500651_0000114_16952_18268 424

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14065

Pvc16_N

Pvc16 N-terminal domain

9

219

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7adz-assembly1.cif.gz_0A cryo-em structure of an extracellular contractile injection system in marine bacterium algoriphagus machipongonensis, the cap portion in extended state. 0.748 7 187
2cxk-assembly1.cif.gz_A crystal structure of the tig domain of human calmodulin-binding transcription activator 1 (camta1) 0.7358 325 415
6sws-assembly2.cif.gz_C-3 the dbb dimerization domain of b-cell adaptor for pi3k (bcap) is required for down regulation of inflammatory signalling through the toll-like receptor pathway 0.7305 215 319
7b5i-assembly1.cif.gz_AA cryo-em structure of the contractile injection system cap complex from anabaena pcc7120 0.7123 7 187
7adz-assembly1.cif.gz_0A cryo-em structure of an extracellular contractile injection system in marine bacterium algoriphagus machipongonensis, the cap portion in extended state. 0.6761 7 187
ID Description Score Start End Superfamily
af_F1QIR0_198_336_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8194 218 319 2.60.40.10
af_Q86WI1_1743_1825_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7839 320 402 2.60.40.10
af_Q54VT0_165_244_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7724 215 317 2.60.40.10
af_H2KY84_408_502_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7601 212 319 2.60.40.10
af_F1QLR7_652_739_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7495 213 319 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A6P0JUC9-F1-model_v4 DUF4255 domain-containing protein 0.9116 276 424
AF-A0A7Y2SST8-F1-model_v4 DUF4255 domain-containing protein 0.8976 1 186
AF-A0A0C1QTX3-F1-model_v4 DUF4255 domain-containing protein 0.8633 1 185
AF-A0A3A0AE83-F1-model_v4 DUF4255 domain-containing protein 0.8607 2 186
AF-A0A6P0JUC9-F1-model_v4 DUF4255 domain-containing protein 0.8406 276 424

Feature Viewer

pLDDT pTM Quality
80.48 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map