F293549

General Info

Members Datasets Scaffolds Average Seq Length
191 147 382 321

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100014823|Ga0068869_1000148234
Length 326
Sequence MALPPVFADRLRLPVIASPLFIISNPELVIAQCKAGVVGSFPALNARPVSQLDEWLHQITEELAAWDRDHPEQKSAPFAVNQIVHKSNNRLEQDVELATKWKAPIVITSLGAREDVNAAVHTYGGVVMHDVINDRFARKAVEKGADGLIAVAALSPFAIIQELREWFDGPLALSGSIANGAAVLAAQAMGADLAYIGSAFIATQEANASQEYKDMIVKGGGDDIVYSNLFTGVHGNYLRASVSAAGLDPDNLPVADPSKMNFGSGGNQSAKAWKDIWGSGQGIGAIKAVPSAAEFIGQLAAQYEAAKASLAAKTSFTSGCGVLAAE

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
45 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
70 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
75 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
76 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
77 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
84 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
85 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
86 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
87 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
90 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
91 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
92 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
96 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
97 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
98 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
99 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
100 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
101 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
102 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
103 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
106 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
109 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
110 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
113 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
114 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
115 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
116 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
117 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
120 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
123 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
128 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
129 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
130 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
131 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
132 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
133 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
134 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
135 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
136 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
137 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
138 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
139 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
140 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
141 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
142 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
143 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
144 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
145 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
146 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
147 2928058823 Ralstonia sp. 1138 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.91
Metatranscriptomes 0.52
Isolates 1.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.32
Nodule 1.05
Rhizoplane 3.14
Rhizosphere 64.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100014823 3300005334 Bacteria 5214
2 SwRhRL2b_contig_2447314 2162886007 Bacteria 6982
3 Ga0006562J51391_1055312 3300003578 Bacteria 1700
4 Ga0055530_10016604 3300003791 Bacteria 2343
5 Ga0065704_10070447 3300005289 Bacteria 24411
6 Ga0065704_10155478 3300005289 Bacteria 1394
7 Ga0070670_100017021 3300005331 Bacteria 6240
8 Ga0070680_100249194 3300005336 Bacteria 1501
9 Ga0068868_100101463 3300005338 Bacteria 2329
10 Ga0070660_100023558 3300005339 Bacteria 4561
11 Ga0070668_100007093 3300005347 Bacteria 8302
12 Ga0070669_100000814 3300005353 Bacteria 22710
13 Ga0070671_100011293 3300005355 Bacteria 7176
14 Ga0070671_100134981 3300005355 Bacteria 2080
15 Ga0070659_100000839 3300005366 Bacteria 22393
16 Ga0070659_100027448 3300005366 Bacteria 4387
17 Ga0070659_100057857 3300005366 Bacteria 3058
18 Ga0070667_100001006 3300005367 Bacteria 25830
19 Ga0070667_100028700 3300005367 Bacteria 4633
20 Ga0070714_100628099 3300005435 Bacteria 1033
21 Ga0070663_100062694 3300005455 Bacteria 2681
22 Ga0070698_100000259 3300005471 Bacteria 53181
23 Ga0070679_100160507 3300005530 Bacteria 2223
24 Ga0070679_100200987 3300005530 Bacteria 1959
25 Ga0070665_100000530 3300005548 Bacteria 53943
26 Ga0068863_100047552 3300005841 Bacteria 4069
27 Ga0068858_100220383 3300005842 Bacteria 1796
28 Ga0068860_100004428 3300005843 Bacteria 14340
29 Ga0068860_100011187 3300005843 Bacteria 8844
30 Ga0068860_100020466 3300005843 Bacteria 6408
31 Ga0068860_100020716 3300005843 Bacteria 6370
32 Ga0068862_100004967 3300005844 Bacteria 11199
33 Ga0068862_100084080 3300005844 Bacteria 2764
34 Ga0075365_10005509 3300006038 Bacteria 6835
35 Ga0075364_10001674 3300006051 Bacteria 12168
36 Ga0075364_10002886 3300006051 Bacteria 9690
37 Ga0075364_10060023 3300006051 Bacteria 2494
38 Ga0075362_10001327 3300006177 Bacteria 7824
39 Ga0075367_10001461 3300006178 Bacteria 10189
40 Ga0075369_10016671 3300006186 Bacteria 2968
41 Ga0075366_10021907 3300006195 Bacteria 3715
42 Ga0075370_10012373 3300006353 Bacteria 4508
43 Ga0079104_1007540 3300006946 Bacteria 3922
44 Ga0079104_1016868 3300006946 Bacteria 2118
45 Ga0105251_10002601 3300009011 Bacteria 13964
46 Ga0105243_10053603 3300009148 Bacteria 3200
47 Ga0105237_10010978 3300009545 Bacteria 9612
48 Ga0105237_10091276 3300009545 Bacteria 3035
49 Ga0105249_10000056 3300009553 Bacteria 160443
50 Ga0157373_10023007 3300013100 Bacteria 4519
51 Ga0157371_10155944 3300013102 Bacteria 1629
52 Ga0157370_10171600 3300013104 Bacteria 2016
53 Ga0157372_10358328 3300013307 Bacteria 1699
54 Ga0163163_10462372 3300014325 Bacteria 1329
55 Ga0157380_10010602 3300014326 Bacteria 6631
56 Ga0182008_10015551 3300014497 Bacteria 3968
57 Ga0157379_10051776 3300014968 Bacteria 3667
58 Ga0182006_1008186 3300015261 Bacteria 4742
59 Ga0209050_1000217 3300025298 Bacteria 128833
60 Ga0207713_1002321 3300025735 Bacteria 13975
61 Ga0207645_10044403 3300025907 Bacteria 2844
62 Ga0207705_10122749 3300025909 Bacteria 1929
63 Ga0207660_10241474 3300025917 Bacteria 1423
64 Ga0207657_10004307 3300025919 Bacteria 15083
65 Ga0207681_10000394 3300025923 Bacteria 30575
66 Ga0207681_10009883 3300025923 Bacteria 5838
67 Ga0207659_10009421 3300025926 Bacteria 6101
68 Ga0207659_10035161 3300025926 Bacteria 3461
69 Ga0207644_10003798 3300025931 Bacteria 9786
70 Ga0207690_10001459 3300025932 Bacteria 14792
71 Ga0207690_10034878 3300025932 Bacteria 3245
72 Ga0207706_10007147 3300025933 Bacteria 10327
73 Ga0207709_10043798 3300025935 Bacteria 2700
74 Ga0207665_10304656 3300025939 Bacteria 1192
75 Ga0207711_10040064 3300025941 Bacteria 3985
76 Ga0207679_10014432 3300025945 Bacteria 5196
77 Ga0207712_10000015 3300025961 Bacteria 346689
78 Ga0207668_10137297 3300025972 Bacteria 1875
79 Ga0207658_10088119 3300025986 Bacteria 2398
80 Ga0207641_10004476 3300026088 Bacteria 12094
81 Ga0207641_10094503 3300026088 Bacteria 2622
82 Ga0207674_10055171 3300026116 Bacteria 4041
83 Ga0209813_10000132 3300027866 Bacteria 26788
84 Ga0268266_10001263 3300028379 Bacteria 30915
85 Ga0268266_10049665 3300028379 Bacteria 3598
86 Ga0268265_10000021 3300028380 Bacteria 272292
87 Ga0268265_10098049 3300028380 Bacteria 2360
88 Ga0268264_10000820 3300028381 Bacteria 33465
89 Ga0268264_10015700 3300028381 Bacteria 6202
90 Ga0268264_10039388 3300028381 Bacteria 3905
91 Ga0307513_10142106 3300031456 Bacteria 2325
92 Ga0307509_10167218 3300031507 Bacteria 2085
93 Ga0307412_10000247 3300031911 Bacteria 35011
94 Ga0307414_10000443 3300032004 Bacteria 21946
95 Ga0307411_10054447 3300032005 Bacteria 2627
96 Ga0307510_10116784 3300033180 Bacteria 2388
97 Ga0373943_0006277 3300035170 Bacteria 5338
98 Ga0373946_0017448 3300035171 Bacteria 2747
99 Ga0373935_0079089 3300035692 Bacteria 2134
100 Ga0373925_0139300 3300037068 Bacteria 1898
101 Ga0395899_0001024 3300037312 Bacteria 25503
102 Ga0395900_0009971 3300037418 Bacteria 9724
103 Ga0395900_0179168 3300037418 Bacteria 2154
104 Ga0395900_0502572 3300037418 Bacteria 1162
105 Ga0395905_0170150 3300037471 Bacteria 2046
106 Ga0395905_0263906 3300037471 Bacteria 1607
107 Ga0395901_0000268 3300038443 Bacteria 64837
108 Ga0395901_0423122 3300038443 Bacteria 1365
109 Ga0237819_00752 3300038705 Bacteria 10410
110 Ga0400483_040792 3300039062 Bacteria 1451
111 Ga0436363_0656327 3300039450 Bacteria 1305
112 Ga0466972_0000891 3300044658 Bacteria 14345
113 Ga0466965_0023823 3300044683 Bacteria 2957
114 Ga0466961_0000194 3300044693 Bacteria 40839
115 Ga0466964_0025438 3300044706 Bacteria 2311
116 Ga0466968_0011131 3300044735 Bacteria 3502
117 Ga0466957_0018736 3300044842 Bacteria 4066
118 Ga0466959_0000928 3300045049 Bacteria 17381
119 Ga0451576_0000007 3300045051 Bacteria 782228
120 Ga0451576_0013808 3300045051 Bacteria 9023
121 Ga0451576_0600088 3300045051 Bacteria 1157
122 Ga0466967_0136460 3300045976 Bacteria 2281
123 Ga0495610_0005837 3300046512 Bacteria 8651
124 Ga0495632_0012167 3300046519 Bacteria 4975
125 Ga0495643_0016921 3300046522 Bacteria 4275
126 Ga0495597_0031502 3300046542 Bacteria 2412
127 Ga0495625_0030329 3300046660 Bacteria 4037
128 Ga0495661_0028390 3300046665 Bacteria 3582
129 Ga0495687_028193 3300047443 Bacteria 2615
130 Ga0495615_0000113 3300048090 Bacteria 20683
131 Ga0495626_0003383 3300048091 Bacteria 10265
132 Ga0496109_0531431 3300048912 Bacteria 1110
133 Ga0496110_0026417 3300048913 Bacteria 4969
134 Ga0496111_0081702 3300048914 Bacteria 2359
135 Ga0496112_0028960 3300048915 Bacteria 5352
136 Ga0496112_0048816 3300048915 Bacteria 4147
137 Ga0496113_0095192 3300048916 Bacteria 2301
138 Ga0496116_0000039 3300048919 Bacteria 349134
139 Ga0496117_0026218 3300048920 Bacteria 4565
140 Ga0496117_0103762 3300048920 Bacteria 1791
141 Ga0496121_0002650 3300048924 Bacteria 26852
142 Ga0496122_0000841 3300048925 Bacteria 58100
143 Ga0496122_0008945 3300048925 Bacteria 10652
144 Ga0496122_0082994 3300048925 Bacteria 2224
145 Ga0496123_0001492 3300048926 Bacteria 32495
146 Ga0496123_0002576 3300048926 Bacteria 22062
147 Ga0496123_0054383 3300048926 Bacteria 2636
148 Ga0496124_0006389 3300048927 Bacteria 12849
149 Ga0496124_0023750 3300048927 Bacteria 5589
150 Ga0496125_0005536 3300048928 Bacteria 13973
151 Ga0496125_0024035 3300048928 Bacteria 5612
152 Ga0496126_0000041 3300048929 Bacteria 340389
153 Ga0496126_0466750 3300048929 Bacteria 1014
154 Ga0501032_0000348 3300049569 Bacteria 38624
155 Ga0501043_0009313 3300049579 Bacteria 7716
156 Ga0501067_0000017 3300049583 Bacteria 102087
157 Ga0501068_0001593 3300049584 Bacteria 12077
158 Ga0501073_0000021 3300049589 Bacteria 135534
159 Ga0501077_0000036 3300049593 Bacteria 68459
160 Ga0501225_0000185 3300049705 Bacteria 19439
161 Ga0501080_0000369 3300049742 Bacteria 34812
162 Ga0501035_0382402 3300049822 Bacteria 1174
163 Ga0501044_0002311 3300049823 Bacteria 21722
164 Ga0501226_000043 3300049853 Bacteria 58106
165 nmdc:mga03683_61_c1 3300050489 Bacteria 41527
166 nmdc:mga03n38_9620_c1 3300050490 Bacteria 3524
167 nmdc:mga00v17_2648_c1 3300050491 Bacteria 6665
168 nmdc:mga00v17_27175_c1 3300050491 Bacteria 3339
169 nmdc:mga00v17_862_c2 3300050491 Bacteria 15867
170 nmdc:mga0yw44_42522_c1 3300050492 Bacteria 2710
171 nmdc:mga0k408_10661_c1 3300050493 Bacteria 4977
172 nmdc:mga0k408_32435_c2 3300050493 Bacteria 2531
173 nmdc:mga06z11_119411_c1 3300050494 Bacteria 1469
174 nmdc:mga06z11_467_c1 3300050494 Bacteria 15048
175 nmdc:mga04h51_343_c1 3300050495 Bacteria 11595
176 nmdc:mga07m45_38_c1 3300050496 Bacteria 65235
177 nmdc:mga07m45_853_c1 3300050496 Bacteria 13250
178 nmdc:mga07m45_97065_c1 3300050496 Bacteria 1691
179 nmdc:mga0sz30_2862_c1 3300050516 Bacteria 6168
180 nmdc:mga0sz30_80150_c1 3300050516 Bacteria 1412
181 Ga0500643_014894 3300053087 Bacteria 2684
182 Ga0500607_000324 3300053121 Bacteria 45136
183 Ga0500559_0002165 3300053136 Bacteria 10411
184 Ga0500590_027466 3300053148 Bacteria 2952
185 Ga0500616_0001282 3300053153 Bacteria 25024
186 Ga0500637_0002476 3300053178 Bacteria 8223
187 Ga0500645_019075 3300053730 Bacteria 2136
188 Ga0466962_0020592 3300061719 Bacteria 3168
189 2819550590 2818991438 Bacteria 5793701
190 2900581494 2900577576 Bacteria 5438534
191 2928060045 2928058823 Bacteria 5520022
192 Ga0068869_100014823
193 SwRhRL2b_contig_2447314
194 Ga0006562J51391_1055312
195 Ga0055530_10016604
196 Ga0065704_10070447
197 Ga0065704_10155478
198 Ga0070670_100017021
199 Ga0070680_100249194
200 Ga0068868_100101463
201 Ga0070660_100023558
202 Ga0070668_100007093
203 Ga0070669_100000814
204 Ga0070671_100011293
205 Ga0070671_100134981
206 Ga0070659_100000839
207 Ga0070659_100027448
208 Ga0070659_100057857
209 Ga0070667_100001006
210 Ga0070667_100028700
211 Ga0070714_100628099
212 Ga0070663_100062694
213 Ga0070698_100000259
214 Ga0070679_100160507
215 Ga0070679_100200987
216 Ga0070665_100000530
217 Ga0068863_100047552
218 Ga0068858_100220383
219 Ga0068860_100004428
220 Ga0068860_100011187
221 Ga0068860_100020466
222 Ga0068860_100020716
223 Ga0068862_100004967
224 Ga0068862_100084080
225 Ga0075365_10005509
226 Ga0075364_10001674
227 Ga0075364_10002886
228 Ga0075364_10060023
229 Ga0075362_10001327
230 Ga0075367_10001461
231 Ga0075369_10016671
232 Ga0075366_10021907
233 Ga0075370_10012373
234 Ga0079104_1007540
235 Ga0079104_1016868
236 Ga0105251_10002601
237 Ga0105243_10053603
238 Ga0105237_10010978
239 Ga0105237_10091276
240 Ga0105249_10000056
241 Ga0157373_10023007
242 Ga0157371_10155944
243 Ga0157370_10171600
244 Ga0157372_10358328
245 Ga0163163_10462372
246 Ga0157380_10010602
247 Ga0182008_10015551
248 Ga0157379_10051776
249 Ga0182006_1008186
250 Ga0209050_1000217
251 Ga0207713_1002321
252 Ga0207645_10044403
253 Ga0207705_10122749
254 Ga0207660_10241474
255 Ga0207657_10004307
256 Ga0207681_10000394
257 Ga0207681_10009883
258 Ga0207659_10009421
259 Ga0207659_10035161
260 Ga0207644_10003798
261 Ga0207690_10001459
262 Ga0207690_10034878
263 Ga0207706_10007147
264 Ga0207709_10043798
265 Ga0207665_10304656
266 Ga0207711_10040064
267 Ga0207679_10014432
268 Ga0207712_10000015
269 Ga0207668_10137297
270 Ga0207658_10088119
271 Ga0207641_10004476
272 Ga0207641_10094503
273 Ga0207674_10055171
274 Ga0209813_10000132
275 Ga0268266_10001263
276 Ga0268266_10049665
277 Ga0268265_10000021
278 Ga0268265_10098049
279 Ga0268264_10000820
280 Ga0268264_10015700
281 Ga0268264_10039388
282 Ga0307513_10142106
283 Ga0307509_10167218
284 Ga0307412_10000247
285 Ga0307414_10000443
286 Ga0307411_10054447
287 Ga0307510_10116784
288 Ga0373943_0006277
289 Ga0373946_0017448
290 Ga0373935_0079089
291 Ga0373925_0139300
292 Ga0395899_0001024
293 Ga0395900_0009971
294 Ga0395900_0179168
295 Ga0395900_0502572
296 Ga0395905_0170150
297 Ga0395905_0263906
298 Ga0395901_0000268
299 Ga0395901_0423122
300 Ga0237819_00752
301 Ga0400483_040792
302 Ga0436363_0656327
303 Ga0466972_0000891
304 Ga0466965_0023823
305 Ga0466961_0000194
306 Ga0466964_0025438
307 Ga0466968_0011131
308 Ga0466957_0018736
309 Ga0466959_0000928
310 Ga0451576_0000007
311 Ga0451576_0013808
312 Ga0451576_0600088
313 Ga0466967_0136460
314 Ga0495610_0005837
315 Ga0495632_0012167
316 Ga0495643_0016921
317 Ga0495597_0031502
318 Ga0495625_0030329
319 Ga0495661_0028390
320 Ga0495687_028193
321 Ga0495615_0000113
322 Ga0495626_0003383
323 Ga0496109_0531431
324 Ga0496110_0026417
325 Ga0496111_0081702
326 Ga0496112_0028960
327 Ga0496112_0048816
328 Ga0496113_0095192
329 Ga0496116_0000039
330 Ga0496117_0026218
331 Ga0496117_0103762
332 Ga0496121_0002650
333 Ga0496122_0000841
334 Ga0496122_0008945
335 Ga0496122_0082994
336 Ga0496123_0001492
337 Ga0496123_0002576
338 Ga0496123_0054383
339 Ga0496124_0006389
340 Ga0496124_0023750
341 Ga0496125_0005536
342 Ga0496125_0024035
343 Ga0496126_0000041
344 Ga0496126_0466750
345 Ga0501032_0000348
346 Ga0501043_0009313
347 Ga0501067_0000017
348 Ga0501068_0001593
349 Ga0501073_0000021
350 Ga0501077_0000036
351 Ga0501225_0000185
352 Ga0501080_0000369
353 Ga0501035_0382402
354 Ga0501044_0002311
355 Ga0501226_000043
356 nmdc:mga03683_61_c1
357 nmdc:mga03n38_9620_c1
358 nmdc:mga00v17_2648_c1
359 nmdc:mga00v17_27175_c1
360 nmdc:mga00v17_862_c2
361 nmdc:mga0yw44_42522_c1
362 nmdc:mga0k408_10661_c1
363 nmdc:mga0k408_32435_c2
364 nmdc:mga06z11_119411_c1
365 nmdc:mga06z11_467_c1
366 nmdc:mga04h51_343_c1
367 nmdc:mga07m45_38_c1
368 nmdc:mga07m45_853_c1
369 nmdc:mga07m45_97065_c1
370 nmdc:mga0sz30_2862_c1
371 nmdc:mga0sz30_80150_c1
372 Ga0500643_014894
373 Ga0500607_000324
374 Ga0500559_0002165
375 Ga0500590_027466
376 Ga0500616_0001282
377 Ga0500637_0002476
378 Ga0500645_019075
379 Ga0466962_0020592
380 2819550590
381 2900581494
382 2928060045

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03060

NMO

Nitronate monooxygenase

8

302

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gvj-assembly1.cif.gz_A-2 structure of fabk (m276a) mutant from thermotoga maritima 0.8617 10 312
3bw3-assembly1.cif.gz_A-2 crystal structures and site-directed mutagenesis study of nitroalkane oxidase from streptomyces ansochromogenes 0.8478 12 308
5gvj-assembly2.cif.gz_B-3 structure of fabk (m276a) mutant from thermotoga maritima 0.8449 12 312
2z6j-assembly1.cif.gz_A crystal structure of s. pneumoniae enoyl-acyl carrier protein reductase (fabk) in complex with an inhibitor 0.8324 12 312
2z6j-assembly1.cif.gz_B crystal structure of s. pneumoniae enoyl-acyl carrier protein reductase (fabk) in complex with an inhibitor 0.8278 12 312
ID Description Score Start End Superfamily
5gvjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8617 10 312 3.20.20.70
af_O07738_1_371_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.839 12 311 3.20.20.70
af_Q2FZX9_3_354_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8347 12 307 3.20.20.70
af_O06179_1_371_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8297 10 310 3.20.20.70
2gjnA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8265 10 313 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3C1VQ54-F1-model_v4 Nitronate monooxygenase 0.9864 69 177 GO:0018580
AF-A0A357L4U6-F1-model_v4 Nitronate monooxygenase 0.982 6 217 GO:0018580
AF-A0A515BK76-F1-model_v4 deleted 0.9797 9 308
AF-A0A4R1UX75-F1-model_v4 Nitronate monooxygenase 0.9795 1 316 GO:0018580
AF-A0A4Q3N6N2-F1-model_v4 deleted 0.9785 19 199

Map