F293596

General Info

Members Datasets Scaffolds Average Seq Length
191 122 186 457

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100034391|Ga0070669_1000343912
Length 516
Sequence MNRDDLPSGLLKARAVTRRHFFRSGGMGLGAIALQSLLTRDNVLAQGANSATQRVSALAPKPPMLAPRAKRVIYLHMAGSPSQLELFEYKPELEKLHLKDCPPSFLEGKRFAFIKGTPKILAGQFRFERQGQSGQWISELLPHFAKVVDKTCVIRTVQTDQFNHAPAQLFVHTGSPRLGNASLGSWVTYGLGSVNENLPGFVVLLSGGKTPDAGKSLWGSGFLPSVYQGVQCRTNGDPVLYLGNPAGIDRELRRRTLDALAEMNNAEYARSGDNETLTRIAQYELAFRMQLSVPEVMDISKEPQHVLDLYGAKPGFVSPAESADDPRKLYKGDDPTFANNCLLARRLIENGVRFVQLYDWGWDHHGSSPGESIDETLPIKCQQIDRAVAALLRDLEQRGLLNETLVIWGGEFGRTPMMQNNVRTELKKGFIGRDHHTSAYAIWLAGGGIKGGLAYGATDEFGYYPVENPVSVRDLQATIQYILGLDPYKFSYPYQGLNNRLIGPSDEGQVLKGILS

Samples

Sample ID Description Type Environment
1 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
2 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
87 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
88 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
89 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
95 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
96 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
107 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
108 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
109 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
110 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
113 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
114 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
118 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
119 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
120 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
121 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.38
Metatranscriptomes 0
Isolates 2.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.57
Nodule 0
Rhizoplane 0
Rhizosphere 95.29
Stem 0
Stem Tuber 0
Unclassified 3.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10090523 3300005295 Bacteria 4124
2 Ga0070658_10007916 3300005327 Bacteria 8559
3 Ga0070658_10021577 3300005327 Bacteria 5161
4 Ga0070670_100110795 3300005331 Unclassified 2365
5 Ga0070666_10011178 3300005335 Bacteria 5626
6 Ga0068868_100005606 3300005338 Bacteria 8830
7 Ga0070660_100009971 3300005339 Bacteria 6698
8 Ga0070669_100034391 3300005353 Bacteria 3669
9 Ga0070669_100036642 3300005353 Bacteria 3556
10 Ga0070669_100053989 3300005353 Bacteria 2942
11 Ga0070675_100010953 3300005354 Bacteria 7097
12 Ga0070671_100008083 3300005355 Bacteria 8422
13 Ga0070671_100014493 3300005355 Bacteria 6372
14 Ga0070673_100020031 3300005364 Bacteria 4816
15 Ga0070688_100032034 3300005365 Bacteria 3166
16 Ga0070667_100004033 3300005367 Bacteria 12426
17 Ga0070705_100088786 3300005440 Bacteria 1920
18 Ga0070681_10017633 3300005458 Bacteria 7134
19 Ga0070681_10153308 3300005458 Bacteria 2230
20 Ga0070685_10006316 3300005466 Bacteria 6041
21 Ga0070707_100001031 3300005468 Bacteria 27596
22 Ga0070699_100135494 3300005518 Bacteria 2172
23 Ga0070679_100148623 3300005530 Bacteria 2320
24 Ga0068853_100012657 3300005539 Bacteria 6869
25 Ga0068853_100016516 3300005539 Bacteria 6077
26 Ga0070696_100023510 3300005546 Bacteria 4190
27 Ga0070665_100003635 3300005548 Bacteria 16339
28 Ga0070665_100080204 3300005548 Unclassified 3269
29 Ga0068855_100003685 3300005563 Bacteria 18743
30 Ga0068855_100031027 3300005563 Bacteria 6387
31 Ga0068855_100074175 3300005563 Bacteria 3952
32 Ga0068855_100123825 3300005563 Bacteria 2957
33 Ga0068855_100131512 3300005563 Bacteria 2858
34 Ga0068855_100222037 3300005563 Bacteria 2118
35 Ga0068857_100019351 3300005577 Bacteria 5977
36 Ga0068857_100028861 3300005577 Bacteria 4896
37 Ga0068856_100010815 3300005614 Bacteria 8862
38 Ga0068856_100012474 3300005614 Bacteria 8228
39 Ga0070702_100097224 3300005615 Bacteria 1799
40 Ga0068864_100057561 3300005618 Bacteria 3358
41 Ga0068861_100034028 3300005719 Bacteria 3765
42 Ga0068861_100161647 3300005719 Bacteria 1848
43 Ga0068858_100010258 3300005842 Bacteria 8886
44 Ga0068858_100042508 3300005842 Bacteria 4214
45 Ga0068862_100002180 3300005844 Bacteria 17576
46 Ga0068862_100032836 3300005844 Bacteria 4383
47 Ga0081455_10010235 3300005937 Bacteria 9538
48 Ga0081455_10029606 3300005937 Bacteria 4990
49 Ga0068871_100122834 3300006358 Bacteria 2195
50 Ga0068871_100138963 3300006358 Bacteria 2064
51 Ga0075428_100004358 3300006844 Bacteria 15615
52 Ga0075428_100034070 3300006844 Bacteria 5618
53 Ga0075428_100053322 3300006844 Bacteria 4431
54 Ga0075428_100060074 3300006844 Bacteria 4163
55 Ga0075430_100049230 3300006846 Bacteria 3557
56 Ga0075431_100040870 3300006847 Bacteria 4781
57 Ga0075433_10008279 3300006852 Bacteria 8288
58 Ga0075433_10019785 3300006852 Bacteria 5618
59 Ga0075429_100157439 3300006880 Bacteria 1989
60 Ga0105240_10020988 3300009093 Bacteria 8694
61 Ga0105240_10058550 3300009093 Bacteria 4810
62 Ga0111539_10004601 3300009094 Bacteria 18029
63 Ga0111539_10040646 3300009094 Bacteria 5596
64 Ga0105245_10011006 3300009098 Bacteria 7874
65 Ga0114129_10002348 3300009147 Bacteria 26266
66 Ga0114129_10003113 3300009147 Bacteria 23270
67 Ga0114129_10034145 3300009147 Bacteria 7184
68 Ga0114129_10056945 3300009147 Bacteria 5472
69 Ga0114129_10281278 3300009147 Bacteria 2223
70 Ga0114129_10481134 3300009147 Bacteria 1624
71 Ga0105243_10034602 3300009148 Bacteria 3912
72 Ga0105241_10010055 3300009174 Bacteria 6945
73 Ga0105241_10053050 3300009174 Bacteria 3099
74 Ga0105237_10005776 3300009545 Bacteria 13899
75 Ga0105237_10025718 3300009545 Bacteria 6018
76 Ga0105237_10031510 3300009545 Bacteria 5375
77 Ga0105237_10101368 3300009545 Unclassified 2871
78 Ga0105238_10000455 3300009551 Bacteria 42985
79 Ga0105238_10012313 3300009551 Bacteria 8626
80 Ga0105238_10154348 3300009551 Bacteria 2271
81 Ga0105238_10174037 3300009551 Bacteria 2129
82 Ga0105239_10003792 3300010375 Bacteria 18399
83 Ga0105239_10017083 3300010375 Bacteria 8021
84 Ga0105239_10114146 3300010375 Bacteria 2996
85 Ga0105239_10135199 3300010375 Bacteria 2745
86 Ga0105239_10198200 3300010375 Bacteria 2249
87 Ga0157370_10197134 3300013104 Bacteria 1869
88 Ga0157369_10134354 3300013105 Bacteria 2620
89 Ga0157374_10007637 3300013296 Bacteria 9229
90 Ga0157378_10014867 3300013297 Bacteria 6811
91 Ga0163162_10003854 3300013306 Bacteria 14395
92 Ga0157375_10011341 3300013308 Bacteria 7870
93 Ga0157375_10030806 3300013308 Bacteria 5063
94 Ga0163163_10041543 3300014325 Bacteria 4498
95 Ga0157380_10073052 3300014326 Bacteria 2780
96 Ga0207705_10024474 3300025909 Bacteria 4308
97 Ga0207654_10027483 3300025911 Bacteria 3092
98 Ga0207707_10026048 3300025912 Bacteria 5114
99 Ga0207707_10099350 3300025912 Bacteria 2543
100 Ga0207695_10018629 3300025913 Bacteria 8022
101 Ga0207695_10046601 3300025913 Bacteria 4595
102 Ga0207671_10022709 3300025914 Bacteria 4739
103 Ga0207671_10051510 3300025914 Bacteria 3051
104 Ga0207671_10058444 3300025914 Unclassified 2859
105 Ga0207657_10002108 3300025919 Bacteria 21511
106 Ga0207646_10001528 3300025922 Bacteria 28314
107 Ga0207681_10012313 3300025923 Bacteria 5276
108 Ga0207681_10132091 3300025923 Bacteria 1847
109 Ga0207694_10020577 3300025924 Bacteria 4995
110 Ga0207694_10063157 3300025924 Bacteria 2885
111 Ga0207650_10029981 3300025925 Bacteria 3915
112 Ga0207644_10039313 3300025931 Bacteria 3339
113 Ga0207691_10009248 3300025940 Bacteria 9455
114 Ga0207711_10010648 3300025941 Bacteria 7647
115 Ga0207667_10004290 3300025949 Bacteria 17469
116 Ga0207667_10020535 3300025949 Bacteria 7341
117 Ga0207667_10023689 3300025949 Bacteria 6758
118 Ga0207667_10085737 3300025949 Bacteria 3260
119 Ga0207651_10020116 3300025960 Bacteria 4020
120 Ga0207712_10104368 3300025961 Bacteria 2113
121 Ga0207658_10026622 3300025986 Bacteria 4056
122 Ga0207703_10007527 3300026035 Bacteria 8642
123 Ga0207639_10002811 3300026041 Bacteria 11679
124 Ga0207639_10099738 3300026041 Bacteria 2344
125 Ga0207708_10143595 3300026075 Bacteria 1874
126 Ga0207702_10115440 3300026078 Bacteria 2394
127 Ga0207702_10250655 3300026078 Bacteria 1663
128 Ga0207641_10004998 3300026088 Bacteria 11371
129 Ga0207676_10082659 3300026095 Bacteria 2613
130 Ga0207674_10007094 3300026116 Bacteria 13093
131 Ga0207674_10016523 3300026116 Bacteria 8075
132 Ga0207674_10142902 3300026116 Unclassified 2352
133 Ga0207675_100010143 3300026118 Bacteria 8829
134 Ga0207428_10012386 3300027907 Bacteria 7493
135 Ga0268266_10108976 3300028379 Bacteria 2451
136 Ga0268265_10007559 3300028380 Bacteria 7335
137 Ga0268265_10012860 3300028380 Bacteria 5681
138 Ga0268264_10311533 3300028381 Bacteria 1485
139 Ga0265338_10019993 3300028800 Bacteria 7068
140 Ga0265332_10015897 3300031238 Bacteria 3321
141 Ga0265332_10055864 3300031238 Bacteria 1692
142 Ga0265325_10000503 3300031241 Bacteria 28242
143 Ga0265339_10000890 3300031249 Bacteria 22943
144 Ga0265331_10004006 3300031250 Bacteria 9301
145 Ga0265331_10026158 3300031250 Bacteria 2937
146 Ga0265314_10001541 3300031711 Bacteria 25411
147 Ga0265314_10047070 3300031711 Bacteria 3038
148 Ga0265342_10078121 3300031712 Bacteria 1916
149 Ga0395905_0213658 3300037471 Bacteria 1807
150 Ga0451577_0002463 3300042876 Bacteria 22008
151 Ga0495643_0000290 3300046522 Bacteria 71544
152 Ga0495658_0040163 3300046683 Bacteria 2600
153 Ga0496126_0146469 3300048929 Bacteria 2028
154 Ga0501034_0012729 3300049571 Bacteria 8677
155 Ga0501034_0114624 3300049571 Bacteria 2684
156 Ga0501036_0057455 3300049572 Bacteria 3296
157 Ga0501036_0180878 3300049572 Bacteria 1775
158 Ga0501037_0067332 3300049573 Bacteria 2608
159 Ga0501040_0157648 3300049576 Bacteria 1603
160 Ga0501041_0059556 3300049577 Bacteria 2337
161 Ga0501043_0111412 3300049579 Bacteria 2149
162 Ga0501046_0043601 3300049580 Bacteria 3571
163 Ga0501047_0003958 3300049581 Bacteria 13928
164 Ga0501048_0096647 3300049582 Bacteria 2083
165 Ga0501072_0052614 3300049588 Bacteria 3206
166 Ga0501075_0029789 3300049591 Bacteria 4038
167 Ga0501076_0036183 3300049592 Bacteria 3867
168 Ga0501079_0084098 3300049741 Bacteria 2462
169 Ga0501081_0133667 3300049743 Bacteria 1774
170 Ga0501044_0149457 3300049823 Bacteria 2319
171 Ga0501045_0049300 3300049824 Bacteria 3070
172 nmdc:mga0k408_47843_c1 3300050493 Bacteria 2472
173 nmdc:mga05p37_14243_c1 3300050507 Bacteria 9550
174 nmdc:mga05p37_2363_c1 3300050507 Bacteria 21951
175 nmdc:mga05p37_288221_c1 3300050507 Bacteria 1955
176 nmdc:mga05p37_60395_c1 3300050507 Bacteria 4668
177 nmdc:mga05p37_78175_c1 3300050507 Bacteria 4074
178 nmdc:mga06r32_38773_c1 3300050510 Bacteria 4517
179 nmdc:mga08y16_9027_c1 3300050511 Bacteria 10469
180 nmdc:mga0a205_3110_c1 3300050515 Bacteria 14723
181 nmdc:mga0a205_68835_c1 3300050515 Bacteria 3418
182 Ga0495601_0007175 3300053077 Bacteria 6537
183 Ga0500559_0023113 3300053136 Bacteria 2638
184 Ga0500616_0005371 3300053153 Bacteria 8719
185 Ga0501084_0039079 3300054114 Bacteria 3969
186 Ga0501082_0298430 3300060353 Bacteria 1403

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049579 Ga0501043_0111412 Ga0501043_0111412_31_1200 381
2 3300006852 Ga0075433_10008279 Ga0075433_100082796 382
3 3300050515 nmdc:mga0a205_3110_c1 nmdc:mga0a205_3110_c1_9410_10699 382
4 3300049576 Ga0501040_0157648 Ga0501040_0157648_43_1248 393
5 3300060353 Ga0501082_0298430 Ga0501082_0298430_20_1342 396
6 3300037471 Ga0395905_0213658 Ga0395905_0213658_17_1381 409
7 3300005339 Ga0070660_100009971 Ga0070660_1000099712 412
8 3300005563 Ga0068855_100222037 Ga0068855_1002220371 412
9 3300009093 Ga0105240_10058550 Ga0105240_100585502 412
10 3300010375 Ga0105239_10135199 Ga0105239_101351992 412
11 3300013104 Ga0157370_10197134 Ga0157370_101971341 412
12 3300013105 Ga0157369_10134354 Ga0157369_101343542 412
13 3300025913 Ga0207695_10046601 Ga0207695_100466012 412
14 3300026078 Ga0207702_10250655 Ga0207702_102506552 412
15 3300009147 Ga0114129_10056945 Ga0114129_100569452 416
16 3300049573 Ga0501037_0067332 Ga0501037_0067332_87_1454 417
17 3300049581 Ga0501047_0003958 Ga0501047_0003958_3816_5183 417
18 3300049823 Ga0501044_0149457 Ga0501044_0149457_448_1815 417
19 3300005937 Ga0081455_10010235 Ga0081455_100102354 418
20 3300009174 Ga0105241_10053050 Ga0105241_100530501 423
21 3300010375 Ga0105239_10017083 Ga0105239_100170835 423
22 3300009545 Ga0105237_10005776 Ga0105237_100057762 424
23 3300005440 Ga0070705_100088786 Ga0070705_1000887862 425
24 3300005546 Ga0070696_100023510 Ga0070696_1000235102 425
25 3300050493 nmdc:mga0k408_47843_c1 nmdc:mga0k408_47843_c1_862_2163 425
26 3300005563 Ga0068855_100074175 Ga0068855_1000741752 427
27 3300005577 Ga0068857_100019351 Ga0068857_1000193514 427
28 3300005614 Ga0068856_100010815 Ga0068856_1000108155 427
29 3300009174 Ga0105241_10010055 Ga0105241_100100555 427
30 3300009545 Ga0105237_10025718 Ga0105237_100257184 427
31 3300009551 Ga0105238_10174037 Ga0105238_101740372 427
32 3300010375 Ga0105239_10003792 Ga0105239_1000379212 427
33 3300010375 Ga0105239_10114146 Ga0105239_101141462 427
34 3300025912 Ga0207707_10099350 Ga0207707_100993502 427
35 3300025924 Ga0207694_10020577 Ga0207694_100205772 427
36 3300025949 Ga0207667_10085737 Ga0207667_100857372 427
37 3300026078 Ga0207702_10115440 Ga0207702_101154402 427
38 3300026116 Ga0207674_10007094 Ga0207674_100070948 427
39 3300005353 Ga0070669_100036642 Ga0070669_1000366422 429
40 3300005618 Ga0068864_100057561 Ga0068864_1000575612 429
41 3300005719 Ga0068861_100034028 Ga0068861_1000340282 429
42 3300005844 Ga0068862_100032836 Ga0068862_1000328361 429
43 3300009094 Ga0111539_10040646 Ga0111539_100406465 429
44 3300009147 Ga0114129_10002348 Ga0114129_100023488 429
45 3300009147 Ga0114129_10034145 Ga0114129_100341454 429
46 3300009148 Ga0105243_10034602 Ga0105243_100346022 429
47 3300013297 Ga0157378_10014867 Ga0157378_100148672 429
48 3300013306 Ga0163162_10003854 Ga0163162_100038542 429
49 3300013308 Ga0157375_10030806 Ga0157375_100308063 429
50 3300014325 Ga0163163_10041543 Ga0163163_100415432 429
51 3300025923 Ga0207681_10012313 Ga0207681_100123133 429
52 3300025961 Ga0207712_10104368 Ga0207712_101043681 429
53 3300026088 Ga0207641_10004998 Ga0207641_1000499810 429
54 3300026095 Ga0207676_10082659 Ga0207676_100826592 429
55 3300026118 Ga0207675_100010143 Ga0207675_1000101432 429
56 3300028380 Ga0268265_10012860 Ga0268265_100128602 429
57 3300050507 nmdc:mga05p37_14243_c1 nmdc:mga05p37_14243_c1_3263_4582 429
58 3300050507 nmdc:mga05p37_2363_c1 nmdc:mga05p37_2363_c1_17203_18522 429
59 3300050507 nmdc:mga05p37_78175_c1 nmdc:mga05p37_78175_c1_95_1414 429
60 3300005327 Ga0070658_10007916 Ga0070658_100079164 431
61 3300025919 Ga0207657_10002108 Ga0207657_100021087 431
62 3300025949 Ga0207667_10004290 Ga0207667_100042904 431
63 3300046683 Ga0495658_0040163 Ga0495658_0040163_394_1812 432
64 3300005458 Ga0070681_10153308 Ga0070681_101533082 433
65 3300005530 Ga0070679_100148623 Ga0070679_1001486231 434
66 3300005842 Ga0068858_100010258 Ga0068858_1000102585 435
67 3300006358 Ga0068871_100138963 Ga0068871_1001389632 435
68 3300026035 Ga0207703_10007527 Ga0207703_100075274 435
69 3300009147 Ga0114129_10003113 Ga0114129_1000311322 438
70 3300050507 nmdc:mga05p37_60395_c1 nmdc:mga05p37_60395_c1_2943_4289 438
71 3300050515 nmdc:mga0a205_68835_c1 nmdc:mga0a205_68835_c1_1850_3196 438
72 3300005338 Ga0068868_100005606 Ga0068868_1000056062 439
73 3300005548 Ga0070665_100003635 Ga0070665_1000036358 439
74 3300009551 Ga0105238_10012313 Ga0105238_100123132 439
75 3300013296 Ga0157374_10007637 Ga0157374_100076373 439
76 3300028379 Ga0268266_10108976 Ga0268266_101089762 439
77 3300028381 Ga0268264_10311533 Ga0268264_103115331 439
78 3300042876 Ga0451577_0002463 Ga0451577_0002463_20324_21760 439
79 3300048929 Ga0496126_0146469 Ga0496126_0146469_521_1885 439
80 3300049580 Ga0501046_0043601 Ga0501046_0043601_2088_3533 439
81 3300005844 Ga0068862_100002180 Ga0068862_1000021805 440
82 3300006844 Ga0075428_100053322 Ga0075428_1000533223 440
83 3300026075 Ga0207708_10143595 Ga0207708_101435952 440
84 3300028380 Ga0268265_10007559 Ga0268265_100075593 440
85 iso_pu_bacteria 2684623219 2687236321 440
86 3300009147 Ga0114129_10281278 Ga0114129_102812782 441
87 3300009551 Ga0105238_10000455 Ga0105238_100004554 441
88 3300050507 nmdc:mga05p37_288221_c1 nmdc:mga05p37_288221_c1_131_1492 441
89 3300005355 Ga0070671_100008083 Ga0070671_1000080837 442
90 3300005367 Ga0070667_100004033 Ga0070667_1000040338 442
91 3300005615 Ga0070702_100097224 Ga0070702_1000972242 442
92 3300005842 Ga0068858_100042508 Ga0068858_1000425082 442
93 3300006358 Ga0068871_100122834 Ga0068871_1001228342 442
94 3300013308 Ga0157375_10011341 Ga0157375_100113414 442
95 3300025931 Ga0207644_10039313 Ga0207644_100393132 442
96 3300025940 Ga0207691_10009248 Ga0207691_100092488 442
97 3300025941 Ga0207711_10010648 Ga0207711_100106482 442
98 3300025986 Ga0207658_10026622 Ga0207658_100266223 442
99 3300025914 Ga0207671_10051510 Ga0207671_100515102 443
100 3300049572 Ga0501036_0180878 Ga0501036_0180878_12_1373 443
101 3300049582 Ga0501048_0096647 Ga0501048_0096647_585_1946 443
102 3300049591 Ga0501075_0029789 Ga0501075_0029789_354_1715 443
103 3300049592 Ga0501076_0036183 Ga0501076_0036183_284_1645 443
104 3300049743 Ga0501081_0133667 Ga0501081_0133667_230_1591 443
105 3300053153 Ga0500616_0005371 Ga0500616_0005371_7111_8490 443
106 3300005365 Ga0070688_100032034 Ga0070688_1000320341 444
107 3300005466 Ga0070685_10006316 Ga0070685_100063164 444
108 3300009147 Ga0114129_10481134 Ga0114129_104811341 444
109 3300049572 Ga0501036_0057455 Ga0501036_0057455_1495_2868 444
110 3300049577 Ga0501041_0059556 Ga0501041_0059556_200_1573 444
111 3300049588 Ga0501072_0052614 Ga0501072_0052614_1390_2763 444
112 3300049741 Ga0501079_0084098 Ga0501079_0084098_580_1953 444
113 3300049824 Ga0501045_0049300 Ga0501045_0049300_367_1740 444
114 3300005327 Ga0070658_10021577 Ga0070658_100215773 446
115 3300005355 Ga0070671_100014493 Ga0070671_1000144933 446
116 3300005364 Ga0070673_100020031 Ga0070673_1000200313 446
117 3300005458 Ga0070681_10017633 Ga0070681_100176337 446
118 3300005563 Ga0068855_100031027 Ga0068855_1000310275 446
119 3300005577 Ga0068857_100028861 Ga0068857_1000288612 446
120 3300005614 Ga0068856_100012474 Ga0068856_1000124744 446
121 3300006846 Ga0075430_100049230 Ga0075430_1000492302 446
122 3300006847 Ga0075431_100040870 Ga0075431_1000408702 446
123 3300009093 Ga0105240_10020988 Ga0105240_100209883 446
124 3300009545 Ga0105237_10101368 Ga0105237_101013683 446
125 3300009551 Ga0105238_10154348 Ga0105238_101543481 446
126 3300025909 Ga0207705_10024474 Ga0207705_100244742 446
127 3300025911 Ga0207654_10027483 Ga0207654_100274832 446
128 3300025912 Ga0207707_10026048 Ga0207707_100260482 446
129 3300025913 Ga0207695_10018629 Ga0207695_100186294 446
130 3300025914 Ga0207671_10058444 Ga0207671_100584443 446
131 3300025924 Ga0207694_10063157 Ga0207694_100631572 446
132 3300025960 Ga0207651_10020116 Ga0207651_100201162 446
133 3300026116 Ga0207674_10016523 Ga0207674_100165234 446
134 3300026116 Ga0207674_10142902 Ga0207674_101429022 446
135 3300031238 Ga0265332_10055864 Ga0265332_100558642 446
136 3300031711 Ga0265314_10047070 Ga0265314_100470702 446
137 3300031712 Ga0265342_10078121 Ga0265342_100781212 446
138 3300050510 nmdc:mga06r32_38773_c1 nmdc:mga06r32_38773_c1_856_2229 446
139 iso_pu_bacteria 2684623219 2687234829 448
140 3300049571 Ga0501034_0114624 Ga0501034_0114624_772_2184 449
141 3300005353 Ga0070669_100053989 Ga0070669_1000539892 450
142 3300005354 Ga0070675_100010953 Ga0070675_1000109533 450
143 3300005548 Ga0070665_100080204 Ga0070665_1000802042 452
144 iso_pu_bacteria 2684623219 2687235082 453
145 iso_pu_bacteria 2684623219 2687240400 455
146 3300005539 Ga0068853_100012657 Ga0068853_1000126574 456
147 3300026041 Ga0207639_10099738 Ga0207639_100997382 456
148 3300046522 Ga0495643_0000290 Ga0495643_0000290_6154_7536 456
149 3300005563 Ga0068855_100003685 Ga0068855_10000368513 457
150 3300009098 Ga0105245_10011006 Ga0105245_100110063 457
151 3300025949 Ga0207667_10020535 Ga0207667_100205352 457
152 3300028800 Ga0265338_10019993 Ga0265338_100199932 457
153 3300031238 Ga0265332_10015897 Ga0265332_100158972 457
154 3300031241 Ga0265325_10000503 Ga0265325_100005033 457
155 3300031249 Ga0265339_10000890 Ga0265339_100008908 457
156 3300031250 Ga0265331_10004006 Ga0265331_100040065 457
157 3300031250 Ga0265331_10026158 Ga0265331_100261582 457
158 3300031711 Ga0265314_10001541 Ga0265314_1000154117 457
159 3300005937 Ga0081455_10029606 Ga0081455_100296063 458
160 3300009094 Ga0111539_10004601 Ga0111539_1000460117 458
161 3300010375 Ga0105239_10198200 Ga0105239_101982003 458
162 3300027907 Ga0207428_10012386 Ga0207428_100123863 458
163 3300050511 nmdc:mga08y16_9027_c1 nmdc:mga08y16_9027_c1_3431_4945 458
164 3300054114 Ga0501084_0039079 Ga0501084_0039079_2178_3554 458
165 3300005719 Ga0068861_100161647 Ga0068861_1001616472 459
166 3300006852 Ga0075433_10019785 Ga0075433_100197853 459
167 3300005468 Ga0070707_100001031 Ga0070707_10000103120 460
168 3300005518 Ga0070699_100135494 Ga0070699_1001354942 460
169 3300005563 Ga0068855_100123825 Ga0068855_1001238252 460
170 3300025922 Ga0207646_10001528 Ga0207646_100015285 460
171 3300025949 Ga0207667_10023689 Ga0207667_100236896 460
172 3300049571 Ga0501034_0012729 Ga0501034_0012729_107_1645 460
173 3300053077 Ga0495601_0007175 Ga0495601_0007175_129_1532 460
174 iso_pu_bacteria 2671180531 2673163432 460
175 3300005331 Ga0070670_100110795 Ga0070670_1001107952 461
176 3300005563 Ga0068855_100131512 Ga0068855_1001315122 462
177 3300006844 Ga0075428_100060074 Ga0075428_1000600744 462
178 3300009545 Ga0105237_10031510 Ga0105237_100315103 462
179 3300025914 Ga0207671_10022709 Ga0207671_100227091 462
180 3300005539 Ga0068853_100016516 Ga0068853_1000165164 463
181 3300006844 Ga0075428_100004358 Ga0075428_1000043582 463
182 3300026041 Ga0207639_10002811 Ga0207639_1000281114 463
183 3300005353 Ga0070669_100034391 Ga0070669_1000343912 465
184 3300014326 Ga0157380_10073052 Ga0157380_100730522 465
185 3300025923 Ga0207681_10132091 Ga0207681_101320912 465
186 3300025925 Ga0207650_10029981 Ga0207650_100299813 465
187 3300053136 Ga0500559_0023113 Ga0500559_0023113_794_2278 465
188 3300005335 Ga0070666_10011178 Ga0070666_100111782 466
189 3300006844 Ga0075428_100034070 Ga0075428_1000340702 466
190 3300006880 Ga0075429_100157439 Ga0075429_1001574392 466
191 3300005295 Ga0065707_10090523 Ga0065707_100905233 479

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07394

DUF1501

Protein of unknown function (DUF1501)

69

515

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zg7-assembly1.cif.gz_A structural basis for inhibition of human autotaxin by four novel compounds 0.6958 315 389
5mhp-assembly1.cif.gz_A novel imidazo[1,2-a]pyridine derivatives with potent autotaxin/enpp2 inhibitor activity 0.6918 315 389
6y5m-assembly1.cif.gz_A crystal structure of mouse autotaxin in complex with compound 1a 0.6908 315 389
2xr9-assembly1.cif.gz_A crystal structure of autotaxin (enpp2) 0.6884 315 389
5ijs-assembly1.cif.gz_A crystal structure of autotaxin with orthovanadate bound as a trigonal bipyramidal intermediate analog 0.6853 315 389
ID Description Score Start End Superfamily
af_Q4DMU3_256_347_1.20.272.10 Mainly Alpha;Up-down Bundle;Zinc Finger, Delta Prime; domain 3; 0.6041 236 281 1.20.272.10
af_P0AD27_254_505_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5926 67 449 3.40.720.10
af_O45359_17_416_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5858 305 479 3.40.720.10
af_P0AD27_254_505_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5805 67 449 3.40.720.10
af_P75785_205_504_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5727 65 450 3.40.720.10
ID Description Score Start End GO Terms
AF-A0A225DNH9-F1-model_v4 Sulfatase 0.9652 359 479
AF-A0A3B8KYX2-F1-model_v4 DUF1501 domain-containing protein 0.9648 365 479
AF-A0A353Z806-F1-model_v4 DUF1501 domain-containing protein 0.9617 353 479
AF-A0A1N6DNS1-F1-model_v4 Planctomycete cytochrome C 0.9601 66 479 GO:0009055
GO:0020037
GO:0046872
AF-A0A2E7L5W7-F1-model_v4 DUF1501 domain-containing protein 0.9595 406 479

Feature Viewer

pLDDT pTM Quality
82.71 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map