F294082

General Info

Members Datasets Scaffolds Average Seq Length
191 121 172 297

Family's Representative Sequence

Representative Sequence 3300015261|Ga0182006_1020529|Ga0182006_10205292
Length 339
Sequence MPGLTRSTHGVDPTSRTLAHSLLYERRASAMTDLPPHRFDVIIIGGSYAGMSAALQLVRARRKVLIIDGGAPRNRNARVAHGFLGREGLPPEEIASQAREELLRYPTLTWLTGTAVSAQAIDDGGNFQVSVEAGQTFVAQRVILAHGVTDALPDIQGIGERWGRSVFHCPYCHGYEVFEGRIGVIGCAKDGGAAQALLLCDWGNITLFCSEASAKIDAAQRARLEACGVVIEATRVRAVEDTATVVLADARRVEVDALFISPHSRLSTDLAEQLGCELKDGGCITTDSAKQTTVPGVFACGDAARMAGSIALAVGEGALAGVAVHHSLMGCWNSGASIM

Samples

Sample ID Description Type Environment
1 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
2 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
3 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
4 2643221556 Massilia sp. Root1485 Isolate Unclassified
5 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
6 2643221684 Massilia sp. Root133 Isolate Unclassified
7 2738541280 Massilia sp. GV090 Isolate Unclassified
8 2738541300 Massilia sp. GV016 Isolate Unclassified
9 2738543018 Massilia sp. GV045 Isolate Unclassified
10 2738543030 Massilia sp. GV097 Isolate Unclassified
11 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
12 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
13 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
14 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
15 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
16 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
17 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
18 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
19 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
20 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
28 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
29 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
30 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
31 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
32 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
33 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
34 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
35 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
36 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
37 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
38 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
39 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
40 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
41 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
43 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
44 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
45 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
46 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
47 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
48 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
49 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
50 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
51 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
52 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
53 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
54 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
55 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
56 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
57 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
58 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
59 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
60 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
61 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
62 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
63 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
64 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
65 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
66 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
67 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
68 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
69 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
70 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
71 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
72 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
73 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
74 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
75 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
76 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
77 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
78 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
79 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
80 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
81 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
82 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
83 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
84 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
85 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
86 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
87 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
88 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
89 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
90 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
91 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
92 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
93 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
94 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
95 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
96 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
97 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
98 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
99 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
100 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
101 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
102 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
103 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
104 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
105 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
116 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
117 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
118 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
119 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
120 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
121 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.05
Metatranscriptomes 0
Isolates 9.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.9
Nodule 1.05
Rhizoplane 5.76
Rhizosphere 47.64
Stem 0
Stem Tuber 0
Unclassified 36.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000021 3300002739 Bacteria 39295
2 JGI25152J39213_1000246 3300002773 Bacteria 36282
3 JGI25150J39212_1000118 3300002774 Bacteria 44311
4 JGI25151J46595_10000110 3300003187 Bacteria 111972
5 JGI25153J46596_10010768 3300003215 Bacteria 4106
6 rootH1_10160946 3300003316 Bacteria 1674
7 rootL2_10081279 3300003322 Bacteria 5309
8 rootL2_10326246 3300003322 Unclassified 2930
9 Ga0055536_1002707 3300003781 Bacteria 9833
10 Ga0068855_100000082 3300005563 Bacteria 114668
11 Ga0075364_10000482 3300006051 Bacteria 20235
12 Ga0079104_1008929 3300006946 Bacteria 3444
13 Ga0105251_10005888 3300009011 Bacteria 7927
14 Ga0105244_10065382 3300009036 Bacteria 1822
15 Ga0157371_10000206 3300013102 Bacteria 86320
16 Ga0182008_10000737 3300014497 Bacteria 23180
17 Ga0182006_1000028 3300015261 Bacteria 249321
18 Ga0182006_1000226 3300015261 Bacteria 54606
19 Ga0182006_1020529 3300015261 Bacteria 2767
20 Ga0182007_10000061 3300015262 Bacteria 88102
21 Ga0182007_10000066 3300015262 Bacteria 83616
22 Ga0182005_1000001 3300015265 Bacteria 1014869
23 Ga0163161_10021662 3300017792 Bacteria 4517
24 Ga0163161_10216504 3300017792 Bacteria 1481
25 Ga0207425_1000012 3300025245 Bacteria 528324
26 Ga0209129_1000110 3300025258 Bacteria 150918
27 Ga0209673_1016406 3300025273 Bacteria 2772
28 Ga0209025_1000024 3300025294 Bacteria 528324
29 Ga0209758_1000150 3300025297 Bacteria 163494
30 Ga0209256_1043971 3300025299 Bacteria 1118
31 Ga0209281_1006841 3300027111 Bacteria 2917
32 Ga0265327_10000009 3300031251 Bacteria 616360
33 Ga0307405_10016115 3300031731 Bacteria 4067
34 Ga0307406_10125119 3300031901 Bacteria 1794
35 Ga0307412_10000491 3300031911 Bacteria 23628
36 Ga0307414_10010195 3300032004 Bacteria 5440
37 Ga0307414_10130950 3300032004 Bacteria 1947
38 Ga0439432_021813 3300042006 Bacteria 2119
39 Ga0466972_0011577 3300044658 Bacteria 4429
40 Ga0466965_0015028 3300044683 Bacteria 3672
41 Ga0466966_0020834 3300044684 Bacteria 4310
42 Ga0466966_0082545 3300044684 Bacteria 2000
43 Ga0466964_0031826 3300044706 Bacteria 2093
44 Ga0466968_0015259 3300044735 Bacteria 3042
45 Ga0466957_0039072 3300044842 Bacteria 2862
46 Ga0495650_0000001 3300046471 Bacteria 1085492
47 Ga0495585_0012316 3300046492 Bacteria 5039
48 Ga0495585_0105038 3300046492 Bacteria 1507
49 Ga0495596_0018465 3300046500 Bacteria 2873
50 Ga0495607_0000416 3300046501 Bacteria 43314
51 Ga0495583_0044812 3300046506 Bacteria 2049
52 Ga0495606_0054321 3300046507 Bacteria 2594
53 Ga0495606_0120040 3300046507 Bacteria 1574
54 Ga0495606_0133615 3300046507 Bacteria 1472
55 Ga0495610_0001846 3300046512 Bacteria 18362
56 Ga0495610_0003284 3300046512 Bacteria 12743
57 Ga0495616_0118242 3300046513 Bacteria 1225
58 Ga0495631_0000377 3300046518 Bacteria 30621
59 Ga0495632_0001444 3300046519 Bacteria 19775
60 Ga0495643_0017285 3300046522 Bacteria 4218
61 Ga0495648_0014354 3300046524 Bacteria 5803
62 Ga0495648_0081044 3300046524 Bacteria 1847
63 Ga0495654_0027598 3300046530 Bacteria 2909
64 Ga0495597_0006277 3300046542 Bacteria 6159
65 Ga0495633_0001625 3300046558 Bacteria 16968
66 Ga0495633_0010458 3300046558 Bacteria 5061
67 Ga0495656_0010313 3300046615 Bacteria 3393
68 Ga0495625_0004484 3300046660 Bacteria 13183
69 Ga0495625_0058671 3300046660 Bacteria 2734
70 Ga0495659_0000008 3300046664 Bacteria 102082
71 Ga0495661_0002348 3300046665 Bacteria 14598
72 Ga0495661_0018264 3300046665 Bacteria 4616
73 Ga0495661_0037223 3300046665 Bacteria 3039
74 Ga0495661_0069047 3300046665 Bacteria 2071
75 Ga0495671_0000080 3300046692 Bacteria 92649
76 Ga0495649_0003383 3300046694 Bacteria 10786
77 Ga0495649_0023854 3300046694 Bacteria 3415
78 Ga0495589_0087246 3300046794 Bacteria 1515
79 Ga0495589_0166442 3300046794 Bacteria 1049
80 Ga0495672_0000449 3300047320 Bacteria 48964
81 Ga0495672_0000602 3300047320 Bacteria 40520
82 Ga0495672_0020452 3300047320 Bacteria 4338
83 Ga0495683_0085988 3300047323 Bacteria 1528
84 Ga0495687_048508 3300047443 Bacteria 1821
85 Ga0495679_011104 3300047446 Bacteria 3497
86 Ga0495686_0000438 3300047472 Bacteria 64190
87 Ga0495686_0002512 3300047472 Bacteria 17189
88 Ga0495626_0017681 3300048091 Bacteria 3595
89 Ga0496101_0101854 3300048904 Bacteria 2150
90 Ga0496105_0314175 3300048908 Bacteria 1257
91 Ga0496106_0000269 3300048909 Bacteria 36744
92 Ga0496109_0020258 3300048912 Bacteria 5874
93 Ga0496110_0406667 3300048913 Bacteria 1241
94 Ga0496111_0084046 3300048914 Bacteria 2326
95 Ga0496112_0276673 3300048915 Bacteria 1626
96 Ga0496113_0007305 3300048916 Bacteria 7092
97 Ga0496113_0135486 3300048916 Bacteria 1935
98 Ga0496115_0148012 3300048918 Bacteria 1938
99 Ga0496116_0001406 3300048919 Bacteria 27038
100 Ga0496116_0001793 3300048919 Bacteria 23337
101 Ga0496116_0004126 3300048919 Bacteria 13997
102 Ga0496116_0011632 3300048919 Bacteria 7261
103 Ga0496116_0021263 3300048919 Bacteria 4899
104 Ga0496116_0039506 3300048919 Bacteria 3262
105 Ga0496116_0085129 3300048919 Bacteria 1944
106 Ga0496116_0085697 3300048919 Bacteria 1935
107 Ga0496117_0000001 3300048920 Bacteria 2526244
108 Ga0496117_0009697 3300048920 Bacteria 8901
109 Ga0496117_0061264 3300048920 Bacteria 2587
110 Ga0496118_0000002 3300048921 Bacteria 1690764
111 Ga0496118_0004086 3300048921 Bacteria 17697
112 Ga0496118_0043203 3300048921 Bacteria 3546
113 Ga0496118_0068350 3300048921 Bacteria 2581
114 Ga0496118_0076968 3300048921 Bacteria 2368
115 Ga0496118_0211675 3300048921 Bacteria 1137
116 Ga0496119_0000209 3300048922 Bacteria 83605
117 Ga0496119_0053553 3300048922 Bacteria 2464
118 Ga0496119_0209609 3300048922 Bacteria 1003
119 Ga0496120_0000271 3300048923 Bacteria 86589
120 Ga0496121_0001433 3300048924 Bacteria 40291
121 Ga0496121_0007081 3300048924 Bacteria 13613
122 Ga0496121_0011009 3300048924 Bacteria 10097
123 Ga0496121_0012869 3300048924 Bacteria 9050
124 Ga0496121_0018446 3300048924 Bacteria 7034
125 Ga0496122_0003246 3300048925 Bacteria 21571
126 Ga0496122_0005071 3300048925 Bacteria 15906
127 Ga0496122_0007935 3300048925 Bacteria 11615
128 Ga0496122_0086487 3300048925 Bacteria 2157
129 Ga0496122_0094578 3300048925 Bacteria 2022
130 Ga0496122_0099231 3300048925 Bacteria 1953
131 Ga0496123_0000122 3300048926 Bacteria 158966
132 Ga0496123_0005787 3300048926 Bacteria 12276
133 Ga0496123_0018726 3300048926 Bacteria 5487
134 Ga0496123_0030645 3300048926 Bacteria 3933
135 Ga0496123_0082230 3300048926 Bacteria 1953
136 Ga0496124_0000447 3300048927 Bacteria 72640
137 Ga0496124_0000517 3300048927 Bacteria 66311
138 Ga0496124_0001983 3300048927 Bacteria 27904
139 Ga0496124_0002549 3300048927 Bacteria 23643
140 Ga0496124_0005756 3300048927 Bacteria 13798
141 Ga0496124_0010686 3300048927 Bacteria 9260
142 Ga0496124_0028615 3300048927 Bacteria 4983
143 Ga0496124_0079437 3300048927 Bacteria 2701
144 Ga0496124_0133645 3300048927 Bacteria 1967
145 Ga0496124_0135292 3300048927 Bacteria 1952
146 Ga0496124_0170342 3300048927 Bacteria 1687
147 Ga0496125_0000144 3300048928 Bacteria 156270
148 Ga0496125_0001175 3300048928 Bacteria 39654
149 Ga0496125_0001813 3300048928 Bacteria 29493
150 Ga0496125_0005175 3300048928 Bacteria 14661
151 Ga0496125_0066259 3300048928 Bacteria 2855
152 Ga0496125_0166199 3300048928 Bacteria 1490
153 Ga0496125_0225797 3300048928 Bacteria 1202
154 Ga0496126_0015518 3300048929 Bacteria 7659
155 Ga0496126_0311912 3300048929 Bacteria 1295
156 Ga0495678_000537 3300049459 Bacteria 36631
157 Ga0495682_0003578 3300049460 Bacteria 6862
158 Ga0501032_0025192 3300049569 Bacteria 4101
159 Ga0501033_0081882 3300049570 Bacteria 2367
160 Ga0501036_0168238 3300049572 Bacteria 1847
161 Ga0501037_0081243 3300049573 Bacteria 2350
162 Ga0501042_0055859 3300049578 Bacteria 2818
163 Ga0501046_0059138 3300049580 Bacteria 3003
164 Ga0501068_0057308 3300049584 Bacteria 2362
165 Ga0501080_0252134 3300049742 Bacteria 1609
166 Ga0501035_0079881 3300049822 Bacteria 2888
167 Ga0501044_0297526 3300049823 Bacteria 1543
168 Ga0501045_0158673 3300049824 Bacteria 1683
169 nmdc:mga00v17_608_c1 3300050491 Bacteria 19798
170 Ga0500618_000264 3300053125 Bacteria 40619
171 Ga0500568_0000153 3300053139 Bacteria 59952
172 Ga0500604_0031329 3300053151 Bacteria 1560

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048928 Ga0496125_0166199 Ga0496125_0166199_429_1328 263
2 3300002773 JGI25152J39213_1000246 JGI25152J39213_100024637 265
3 3300002774 JGI25150J39212_1000118 JGI25150J39212_100011810 265
4 3300003187 JGI25151J46595_10000110 JGI25151J46595_1000011020 265
5 3300003215 JGI25153J46596_10010768 JGI25153J46596_100107682 265
6 3300025245 Ga0207425_1000012 Ga0207425_1000012145 265
7 3300025258 Ga0209129_1000110 Ga0209129_1000110145 265
8 3300025273 Ga0209673_1016406 Ga0209673_10164063 265
9 3300025294 Ga0209025_1000024 Ga0209025_1000024145 265
10 3300025297 Ga0209758_1000150 Ga0209758_100015020 265
11 3300025299 Ga0209256_1043971 Ga0209256_10439711 265
12 3300031901 Ga0307406_10125119 Ga0307406_101251191 265
13 3300048919 Ga0496116_0001406 Ga0496116_0001406_19541_20440 265
14 3300048919 Ga0496116_0004126 Ga0496116_0004126_1766_2665 265
15 3300048919 Ga0496116_0085129 Ga0496116_0085129_652_1551 265
16 3300048920 Ga0496117_0009697 Ga0496117_0009697_2172_3071 265
17 3300048920 Ga0496117_0061264 Ga0496117_0061264_930_1829 265
18 3300048921 Ga0496118_0043203 Ga0496118_0043203_81_980 265
19 3300048921 Ga0496118_0076968 Ga0496118_0076968_38_937 265
20 3300048924 Ga0496121_0012869 Ga0496121_0012869_4244_5143 265
21 3300048925 Ga0496122_0007935 Ga0496122_0007935_2336_3235 265
22 3300048925 Ga0496122_0099231 Ga0496122_0099231_676_1575 265
23 3300048926 Ga0496123_0005787 Ga0496123_0005787_3760_4659 265
24 3300048926 Ga0496123_0082230 Ga0496123_0082230_379_1278 265
25 3300048927 Ga0496124_0002549 Ga0496124_0002549_14601_15500 265
26 3300048927 Ga0496124_0010686 Ga0496124_0010686_4137_5036 265
27 3300048928 Ga0496125_0001813 Ga0496125_0001813_18046_18945 265
28 3300048929 Ga0496126_0015518 Ga0496126_0015518_3070_3969 265
29 3300031731 Ga0307405_10016115 Ga0307405_100161152 266
30 3300048916 Ga0496113_0135486 Ga0496113_0135486_122_1021 266
31 3300048919 Ga0496116_0085697 Ga0496116_0085697_354_1253 266
32 3300048925 Ga0496122_0086487 Ga0496122_0086487_683_1582 266
33 3300048927 Ga0496124_0079437 Ga0496124_0079437_1115_2014 266
34 3300048922 Ga0496119_0209609 Ga0496119_0209609_128_988 270
35 3300031911 Ga0307412_10000491 Ga0307412_1000049117 275
36 3300048922 Ga0496119_0053553 Ga0496119_0053553_1347_2246 275
37 3300048924 Ga0496121_0018446 Ga0496121_0018446_3929_4828 275
38 3300048925 Ga0496122_0094578 Ga0496122_0094578_441_1340 275
39 3300048926 Ga0496123_0018726 Ga0496123_0018726_688_1587 275
40 3300048927 Ga0496124_0133645 Ga0496124_0133645_397_1296 275
41 3300042006 Ga0439432_021813 Ga0439432_021813_1121_1981 279
42 3300046615 Ga0495656_0010313 Ga0495656_0010313_2162_3112 279
43 3300049580 Ga0501046_0059138 Ga0501046_0059138_2137_2982 281
44 iso_pu_bacteria 2932410948 2932412010 282
45 iso_pu_bacteria 2932416698 2932418424 282
46 3300017792 Ga0163161_10021662 Ga0163161_100216624 283
47 3300048919 Ga0496116_0021263 Ga0496116_0021263_572_1468 286
48 3300046692 Ga0495671_0000080 Ga0495671_0000080_63387_64340 287
49 3300053139 Ga0500568_0000153 Ga0500568_0000153_28732_29622 287
50 3300048929 Ga0496126_0311912 Ga0496126_0311912_272_1138 288
51 3300046512 Ga0495610_0001846 Ga0495610_0001846_17363_18319 289
52 3300046518 Ga0495631_0000377 Ga0495631_0000377_23467_24423 289
53 iso_pu_bacteria 8003014200 8003015652 292
54 3300048925 Ga0496122_0005071 Ga0496122_0005071_13297_14223 294
55 3300048926 Ga0496123_0030645 Ga0496123_0030645_2643_3569 294
56 3300006051 Ga0075364_10000482 Ga0075364_1000048212 295
57 3300049569 Ga0501032_0025192 Ga0501032_0025192_1648_2535 295
58 3300049570 Ga0501033_0081882 Ga0501033_0081882_1271_2158 295
59 3300049573 Ga0501037_0081243 Ga0501037_0081243_344_1231 295
60 3300049578 Ga0501042_0055859 Ga0501042_0055859_491_1378 295
61 3300049584 Ga0501068_0057308 Ga0501068_0057308_759_1646 295
62 3300049742 Ga0501080_0252134 Ga0501080_0252134_239_1126 295
63 3300049822 Ga0501035_0079881 Ga0501035_0079881_1780_2667 295
64 3300049823 Ga0501044_0297526 Ga0501044_0297526_419_1306 295
65 3300049824 Ga0501045_0158673 Ga0501045_0158673_720_1607 295
66 iso_pu_bacteria 2582581299 2585229684 295
67 iso_pu_bacteria 2585427594 2585844061 295
68 iso_pu_bacteria 2643221634 2644190423 295
69 3300003316 rootH1_10160946 rootH1_101609462 296
70 3300046665 Ga0495661_0002348 Ga0495661_0002348_11615_12511 297
71 3300048904 Ga0496101_0101854 Ga0496101_0101854_568_1464 297
72 3300048912 Ga0496109_0020258 Ga0496109_0020258_4732_5628 297
73 3300048915 Ga0496112_0276673 Ga0496112_0276673_513_1409 297
74 3300048916 Ga0496113_0007305 Ga0496113_0007305_1418_2314 297
75 3300048925 Ga0496122_0003246 Ga0496122_0003246_2196_3092 297
76 3300048926 Ga0496123_0000122 Ga0496123_0000122_17207_18103 297
77 3300048928 Ga0496125_0005175 Ga0496125_0005175_2163_3059 297
78 iso_pu_bacteria 2738541280 2738742238 297
79 iso_pu_bacteria 2738541300 2738841410 297
80 iso_pu_bacteria 2738543018 2739272280 297
81 iso_pu_bacteria 2738543030 2739341324 297
82 iso_pu_bacteria 2941475908 2941476247 297
83 3300005563 Ga0068855_100000082 Ga0068855_10000008236 298
84 3300006946 Ga0079104_1008929 Ga0079104_10089292 298
85 3300014497 Ga0182008_10000737 Ga0182008_1000073717 298
86 3300015261 Ga0182006_1000028 Ga0182006_100002878 298
87 3300015262 Ga0182007_10000066 Ga0182007_1000006628 298
88 3300015265 Ga0182005_1000001 Ga0182005_1000001881 298
89 3300027111 Ga0209281_1006841 Ga0209281_10068412 298
90 3300046492 Ga0495585_0105038 Ga0495585_0105038_188_1087 298
91 3300046500 Ga0495596_0018465 Ga0495596_0018465_921_1820 298
92 3300046506 Ga0495583_0044812 Ga0495583_0044812_1014_1913 298
93 3300046507 Ga0495606_0133615 Ga0495606_0133615_227_1126 298
94 3300046542 Ga0495597_0006277 Ga0495597_0006277_552_1505 298
95 3300046664 Ga0495659_0000008 Ga0495659_0000008_85085_86038 298
96 3300046694 Ga0495649_0023854 Ga0495649_0023854_2401_3300 298
97 3300046794 Ga0495589_0087246 Ga0495589_0087246_255_1154 298
98 3300046794 Ga0495589_0166442 Ga0495589_0166442_77_976 298
99 3300047320 Ga0495672_0000602 Ga0495672_0000602_4879_5832 298
100 3300047323 Ga0495683_0085988 Ga0495683_0085988_14_913 298
101 3300047446 Ga0495679_011104 Ga0495679_011104_1967_2866 298
102 3300047472 Ga0495686_0000438 Ga0495686_0000438_52059_52958 298
103 3300048091 Ga0495626_0017681 Ga0495626_0017681_1444_2343 298
104 3300048914 Ga0496111_0084046 Ga0496111_0084046_768_1736 298
105 3300048919 Ga0496116_0039506 Ga0496116_0039506_493_1461 298
106 3300048920 Ga0496117_0000001 Ga0496117_0000001_783964_784932 298
107 3300048921 Ga0496118_0000002 Ga0496118_0000002_783964_784932 298
108 3300048927 Ga0496124_0135292 Ga0496124_0135292_670_1638 298
109 3300048928 Ga0496125_0066259 Ga0496125_0066259_589_1557 298
110 3300049460 Ga0495682_0003578 Ga0495682_0003578_942_1841 298
111 3300053125 Ga0500618_000264 Ga0500618_000264_33923_34819 298
112 3300009011 Ga0105251_10005888 Ga0105251_100058883 299
113 3300046519 Ga0495632_0001444 Ga0495632_0001444_12182_13081 299
114 3300046558 Ga0495633_0010458 Ga0495633_0010458_2451_3362 299
115 3300048913 Ga0496110_0406667 Ga0496110_0406667_74_982 299
116 3300048921 Ga0496118_0004086 Ga0496118_0004086_9095_10018 299
117 3300048921 Ga0496118_0068350 Ga0496118_0068350_951_1862 299
118 3300048927 Ga0496124_0000447 Ga0496124_0000447_27488_28396 299
119 3300048928 Ga0496125_0001175 Ga0496125_0001175_32808_33731 299
120 3300047472 Ga0495686_0002512 Ga0495686_0002512_785_1693 300
121 3300048927 Ga0496124_0000517 Ga0496124_0000517_29292_30203 300
122 iso_pu_bacteria 2643221556 2643800804 300
123 iso_pu_bacteria 2643221684 2644471034 300
124 iso_pu_bacteria 8047673197 8047677306 300
125 3300009036 Ga0105244_10065382 Ga0105244_100653822 301
126 3300013102 Ga0157371_10000206 Ga0157371_1000020643 301
127 3300015262 Ga0182007_10000061 Ga0182007_1000006161 301
128 3300032004 Ga0307414_10010195 Ga0307414_100101955 301
129 3300046660 Ga0495625_0004484 Ga0495625_0004484_10686_11639 301
130 3300048908 Ga0496105_0314175 Ga0496105_0314175_180_1097 301
131 3300048909 Ga0496106_0000269 Ga0496106_0000269_13973_14878 301
132 3300048919 Ga0496116_0001793 Ga0496116_0001793_19581_20498 301
133 3300048921 Ga0496118_0211675 Ga0496118_0211675_168_1085 301
134 3300048922 Ga0496119_0000209 Ga0496119_0000209_41673_42590 301
135 3300048923 Ga0496120_0000271 Ga0496120_0000271_44640_45557 301
136 3300048924 Ga0496121_0007081 Ga0496121_0007081_8128_9129 301
137 3300048927 Ga0496124_0001983 Ga0496124_0001983_15035_15952 301
138 3300048927 Ga0496124_0005756 Ga0496124_0005756_3108_4025 301
139 3300048928 Ga0496125_0000144 Ga0496125_0000144_47106_48107 301
140 3300050491 nmdc:mga00v17_608_c1 nmdc:mga00v17_608_c1_18780_19712 301
141 3300053151 Ga0500604_0031329 Ga0500604_0031329_644_1549 301
142 iso_pu_bacteria 2600255292 2601668272 301
143 iso_pu_bacteria 2857442823 2857443092 301
144 iso_pu_bacteria 2857547612 2857550489 301
145 iso_pu_bacteria 2941475908 2941476307 301
146 3300003322 rootL2_10326246 rootL2_103262463 302
147 3300015261 Ga0182006_1020529 Ga0182006_10205292 302
148 3300031251 Ga0265327_10000009 Ga0265327_10000009272 302
149 3300047320 Ga0495672_0020452 Ga0495672_0020452_866_1783 302
150 iso_pu_bacteria 2842757796 2842757991 302
151 3300015261 Ga0182006_1000226 Ga0182006_100022644 303
152 3300003322 rootL2_10081279 rootL2_100812793 304
153 3300017792 Ga0163161_10216504 Ga0163161_102165042 304
154 3300032004 Ga0307414_10130950 Ga0307414_101309502 304
155 3300044684 Ga0466966_0020834 Ga0466966_0020834_2927_3847 304
156 3300044684 Ga0466966_0082545 Ga0466966_0082545_708_1625 304
157 3300044706 Ga0466964_0031826 Ga0466964_0031826_127_1047 304
158 3300046471 Ga0495650_0000001 Ga0495650_0000001_426216_427136 304
159 3300046501 Ga0495607_0000416 Ga0495607_0000416_37433_38353 304
160 3300046512 Ga0495610_0003284 Ga0495610_0003284_7496_8431 304
161 3300046522 Ga0495643_0017285 Ga0495643_0017285_2467_3387 304
162 3300046524 Ga0495648_0014354 Ga0495648_0014354_4506_5426 304
163 3300046524 Ga0495648_0081044 Ga0495648_0081044_543_1478 304
164 3300046665 Ga0495661_0037223 Ga0495661_0037223_524_1444 304
165 3300046665 Ga0495661_0069047 Ga0495661_0069047_1126_2046 304
166 3300046694 Ga0495649_0003383 Ga0495649_0003383_5569_6504 304
167 3300047320 Ga0495672_0000449 Ga0495672_0000449_21927_22862 304
168 3300047443 Ga0495687_048508 Ga0495687_048508_880_1800 304
169 3300048927 Ga0496124_0170342 Ga0496124_0170342_162_1082 304
170 3300048928 Ga0496125_0225797 Ga0496125_0225797_186_1106 304
171 3300049459 Ga0495678_000537 Ga0495678_000537_26089_27024 304
172 3300049572 Ga0501036_0168238 Ga0501036_0168238_322_1242 304
173 3300003781 Ga0055536_1002707 Ga0055536_100270710 305
174 3300044658 Ga0466972_0011577 Ga0466972_0011577_3081_4025 305
175 3300044683 Ga0466965_0015028 Ga0466965_0015028_1760_2704 305
176 3300044735 Ga0466968_0015259 Ga0466968_0015259_837_1781 305
177 3300044842 Ga0466957_0039072 Ga0466957_0039072_825_1769 305
178 3300046530 Ga0495654_0027598 Ga0495654_0027598_446_1435 305
179 3300046558 Ga0495633_0001625 Ga0495633_0001625_2926_3915 305
180 3300048918 Ga0496115_0148012 Ga0496115_0148012_132_1049 305
181 3300048924 Ga0496121_0001433 Ga0496121_0001433_36788_37798 305
182 3300048924 Ga0496121_0011009 Ga0496121_0011009_7522_8511 305
183 3300046507 Ga0495606_0054321 Ga0495606_0054321_402_1355 306
184 3300046665 Ga0495661_0018264 Ga0495661_0018264_2906_3856 306
185 3300048927 Ga0496124_0028615 Ga0496124_0028615_2018_2968 306
186 3300046492 Ga0495585_0012316 Ga0495585_0012316_2431_3357 308
187 3300046507 Ga0495606_0120040 Ga0495606_0120040_616_1542 308
188 3300046513 Ga0495616_0118242 Ga0495616_0118242_21_947 308
189 3300046660 Ga0495625_0058671 Ga0495625_0058671_1267_2193 308
190 3300002739 JGI25158J39367_1000021 JGI25158J39367_100002129 311
191 3300048919 Ga0496116_0011632 Ga0496116_0011632_5764_6708 311

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00890

FAD_binding_2

FAD binding domain

40

122

0.89

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

39

317

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nte-assembly1.cif.gz_B crystal structure of deph 0.9825 11 307
4jna-assembly2.cif.gz_B crystal structure of the deph complex with dimethyl-fk228 0.9802 13 307
3fbs-assembly2.cif.gz_B the crystal structure of the oxidoreductase from agrobacterium tumefaciens 0.9746 11 307
4nte-assembly1.cif.gz_A crystal structure of deph 0.9706 11 307
4jna-assembly2.cif.gz_B crystal structure of the deph complex with dimethyl-fk228 0.9704 13 307
ID Description Score Start End Superfamily
4jn9A02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9553 125 234 3.50.50.60
4jnaA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9516 11 307 3.50.50.60
4ntdA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9401 125 234 3.50.50.60
4jn9A02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9382 125 234 3.50.50.60
af_Q9BKQ5_2_341_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9334 12 43 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A366D7M2-F1-model_v4 Thioredoxin reductase 0.9925 11 308 GO:0016491
AF-A0A4Y9Q273-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9907 13 103 GO:0016491
AF-A0A258LVP3-F1-model_v4 Thioredoxin reductase 0.9895 11 306 GO:0016491
AF-C4APT1-F1-model_v4 deleted 0.9891 11 283
AF-A0A439KQW2-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9876 13 88

Feature Viewer

pLDDT pTM Quality
92.57 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map