F294091

General Info

Members Datasets Scaffolds Average Seq Length
191 138 382 355

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10000152|Ga0213875_1000015231
Length 397
Sequence MSAGAGESAIEFTLAGRLGDFALDVVFAAPMRGVTALFGPSGSGKTTILRCAAGLQRLSGRLQVGEDVWQDDAAGVFRPPHRRPIGYVFQEASLFPHLSVRDNLRFGAKRALPEHGVGALDFADIVKLLGIGHLLDRAPAALSGGERQRVAIGRALLSQPRLLLMDEPLASLDRLTKDEILPHLEAVHESLAIPILYVSHDIGEIERLADTLVLLENGRVAAAGELAVLQADLELPLARAPEAAVTLEGAVVGADETYALTTFAVAGGTLIVPGRQGGRGDRRRLRISASDVSFSRAAPEETTILNCLPVRIHSVSRHDRDAVQMNIVVGLGDDGGGARIVGRVTRKSQEALGLTAGRRVFAQIKSVALLASGAGGGPRHRAIAQSQQEKADEAQRA

Samples

Sample ID Description Type Environment
1 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
2 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
15 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
19 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
30 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
31 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
38 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
40 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
41 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
42 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
43 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
44 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
45 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
46 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
47 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
48 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
49 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
50 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
51 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
52 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
53 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
54 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
55 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
56 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
57 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
58 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
59 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
60 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
61 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
63 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
66 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
67 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
68 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
69 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
70 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
71 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
74 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
75 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
76 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
77 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
78 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
79 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
80 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
81 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
82 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
83 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
84 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
85 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
86 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
87 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
88 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
89 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
90 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
91 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
92 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
93 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
94 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
95 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
96 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
97 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
98 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
99 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
106 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
107 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
108 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
109 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
110 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
111 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
112 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
113 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
114 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
117 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
118 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
119 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
120 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
121 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
122 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
123 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
126 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
127 2643221719 Rhizobium sp. Root274 Isolate Unclassified
128 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
129 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
130 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
131 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
132 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
133 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
134 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
135 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
136 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
137 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
138 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.67
Metatranscriptomes 0
Isolates 7.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.14
Nodule 0.52
Rhizoplane 0
Rhizosphere 84.29
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213875_10000152 3300021388 Bacteria 73219
2 JGI25157J39369_1000411 3300002741 Bacteria 28952
3 Ga0070658_10148420 3300005327 Bacteria 1962
4 Ga0070666_10210117 3300005335 Bacteria 1370
5 Ga0070682_100016166 3300005337 Bacteria 4336
6 Ga0070714_100004435 3300005435 Bacteria 10567
7 Ga0070713_100003316 3300005436 Bacteria 10617
8 Ga0070711_100108832 3300005439 Bacteria 2031
9 Ga0070706_100023669 3300005467 Bacteria 5654
10 Ga0070707_100055362 3300005468 Bacteria 3803
11 Ga0068853_100042638 3300005539 Bacteria 3881
12 Ga0070696_100054305 3300005546 Bacteria 2791
13 Ga0068856_100354355 3300005614 Bacteria 1486
14 Ga0070712_100081986 3300006175 Bacteria 2339
15 Ga0097621_100201232 3300006237 Unclassified 1729
16 Ga0075428_100033026 3300006844 Bacteria 5715
17 Ga0075428_100040317 3300006844 Bacteria 5138
18 Ga0075428_100271046 3300006844 Bacteria 1826
19 Ga0075431_100070131 3300006847 Bacteria 3616
20 Ga0075431_100202539 3300006847 Bacteria 2030
21 Ga0075429_100039638 3300006880 Bacteria 4099
22 Ga0075436_100005591 3300006914 Bacteria 8628
23 Ga0075436_100008709 3300006914 Bacteria 6937
24 Ga0105240_10135811 3300009093 Bacteria 2946
25 Ga0111539_10121199 3300009094 Bacteria 3065
26 Ga0114129_10053347 3300009147 Bacteria 5671
27 Ga0105248_10000009 3300009177 Bacteria 403549
28 Ga0105237_10000071 3300009545 Bacteria 135695
29 Ga0105249_10246469 3300009553 Bacteria 1769
30 Ga0105239_10064306 3300010375 Bacteria 4028
31 Ga0157372_10309362 3300013307 Bacteria 1839
32 Ga0209258_108260 3300025242 Bacteria 1479
33 Ga0209026_1000069 3300025250 Bacteria 207574
34 Ga0209233_1000413 3300025261 Bacteria 33031
35 Ga0207684_10113772 3300025910 Bacteria 2317
36 Ga0207695_10146488 3300025913 Bacteria 2305
37 Ga0207671_10000099 3300025914 Bacteria 132378
38 Ga0207646_10021237 3300025922 Bacteria 6002
39 Ga0207664_10017175 3300025929 Bacteria 5297
40 Ga0207639_10030358 3300026041 Bacteria 3964
41 Ga0207428_10051852 3300027907 Bacteria 3278
42 Ga0268266_10000749 3300028379 Bacteria 43458
43 Ga0268266_10459196 3300028379 Bacteria 1212
44 Ga0265338_10000007 3300028800 Bacteria 498229
45 Ga0265338_10021585 3300028800 Bacteria 6709
46 Ga0265338_10127161 3300028800 Bacteria 2020
47 Ga0265324_10000112 3300029957 Bacteria 64370
48 Ga0265324_10013999 3300029957 Bacteria 2978
49 Ga0265325_10000001 3300031241 Bacteria 726814
50 Ga0265325_10002618 3300031241 Bacteria 12053
51 Ga0265325_10007667 3300031241 Bacteria 6446
52 Ga0265325_10013163 3300031241 Bacteria 4715
53 Ga0265325_10013651 3300031241 Bacteria 4617
54 Ga0265329_10047802 3300031242 Bacteria 1365
55 Ga0265340_10001208 3300031247 Bacteria 14776
56 Ga0265340_10003851 3300031247 Bacteria 8453
57 Ga0265340_10027954 3300031247 Bacteria 2839
58 Ga0265340_10093211 3300031247 Bacteria 1406
59 Ga0265339_10000689 3300031249 Bacteria 26094
60 Ga0265339_10012949 3300031249 Bacteria 5070
61 Ga0265331_10003245 3300031250 Bacteria 10600
62 Ga0265331_10042795 3300031250 Bacteria 2196
63 Ga0265327_10000547 3300031251 Bacteria 64250
64 Ga0265316_10017639 3300031344 Bacteria 6159
65 Ga0265316_10050631 3300031344 Bacteria 3265
66 Ga0265316_10115970 3300031344 Bacteria 2025
67 Ga0265316_10138814 3300031344 Bacteria 1827
68 Ga0265313_10005319 3300031595 Bacteria 9516
69 Ga0265313_10007432 3300031595 Bacteria 7493
70 Ga0265313_10007522 3300031595 Bacteria 7415
71 Ga0316575_10000077 3300031665 Bacteria 24214
72 Ga0265314_10000101 3300031711 Bacteria 129229
73 Ga0265314_10011988 3300031711 Bacteria 7108
74 Ga0265314_10015291 3300031711 Bacteria 6095
75 Ga0265314_10081359 3300031711 Bacteria 2134
76 Ga0265314_10108296 3300031711 Bacteria 1771
77 Ga0265342_10030991 3300031712 Bacteria 3309
78 Ga0265342_10033826 3300031712 Bacteria 3139
79 Ga0265342_10098699 3300031712 Bacteria 1667
80 Ga0307516_10027632 3300031730 Bacteria 5752
81 Ga0316577_10008945 3300031733 Bacteria 5379
82 Ga0307413_10036651 3300031824 Bacteria 2826
83 Ga0307406_10077052 3300031901 Bacteria 2205
84 Ga0373932_0021171 3300035112 Bacteria 1715
85 Ga0373943_0004922 3300035170 Bacteria 6031
86 Ga0373946_0012281 3300035171 Bacteria 3204
87 Ga0373931_0005681 3300035691 Bacteria 5793
88 Ga0373931_0042002 3300035691 Bacteria 2403
89 Ga0373947_0018502 3300035725 Bacteria 4011
90 Ga0373937_0146071 3300036401 Bacteria 2214
91 Ga0373925_0003185 3300037068 Bacteria 12828
92 Ga0436364_0154218 3300037853 Bacteria 60339
93 Ga0395901_0420993 3300038443 Bacteria 1370
94 Ga0400490_34423 3300038726 Bacteria 25553
95 Ga0400488_33058 3300038741 Bacteria 8116
96 Ga0400486_23976 3300038742 Bacteria 5770
97 Ga0400483_057506 3300039062 Bacteria 13085
98 Ga0400483_085795 3300039062 Bacteria 18002
99 Ga0400483_163876 3300039062 Bacteria 3052
100 Ga0451577_0000013 3300042876 Bacteria 550689
101 Ga0451577_0001952 3300042876 Bacteria 26006
102 Ga0451577_0010194 3300042876 Bacteria 8999
103 Ga0451577_0393756 3300042876 Bacteria 1257
104 Ga0453683_0000059 3300044673 Bacteria 187158
105 Ga0453683_0121188 3300044673 Bacteria 1647
106 Ga0453684_0000237 3300044712 Bacteria 236999
107 Ga0453684_0000585 3300044712 Bacteria 135647
108 Ga0453684_0007149 3300044712 Bacteria 20770
109 Ga0453684_0009945 3300044712 Bacteria 16411
110 Ga0451576_0000018 3300045051 Bacteria 550689
111 Ga0451576_0001981 3300045051 Bacteria 32534
112 Ga0451576_0004169 3300045051 Bacteria 19030
113 Ga0451576_0008944 3300045051 Bacteria 11681
114 Ga0451576_0011909 3300045051 Bacteria 9835
115 Ga0451576_0073524 3300045051 Bacteria 3557
116 Ga0451576_0108662 3300045051 Bacteria 2886
117 Ga0495603_0069597 3300046455 Bacteria 2070
118 Ga0495591_000016 3300046458 Bacteria 244927
119 Ga0495653_0001612 3300046463 Bacteria 17716
120 Ga0495580_0040044 3300046472 Bacteria 3351
121 Ga0495605_0000244 3300046474 Bacteria 64456
122 Ga0495584_0010339 3300046491 Bacteria 4797
123 Ga0495585_0002474 3300046492 Bacteria 13192
124 Ga0495607_0000031 3300046501 Bacteria 153964
125 Ga0495607_0004155 3300046501 Bacteria 10772
126 Ga0495606_0001163 3300046507 Bacteria 37215
127 Ga0495610_0096844 3300046512 Bacteria 1328
128 Ga0495631_0029058 3300046518 Bacteria 2518
129 Ga0495632_0023792 3300046519 Bacteria 3265
130 Ga0495637_0006895 3300046520 Bacteria 5672
131 Ga0495637_0020523 3300046520 Bacteria 3040
132 Ga0495587_0099511 3300046536 Bacteria 1676
133 Ga0495597_0000012 3300046542 Bacteria 212005
134 Ga0495635_0067620 3300046663 Bacteria 2451
135 Ga0495661_0000011 3300046665 Bacteria 277997
136 Ga0495588_0088935 3300046674 Bacteria 1617
137 Ga0495658_0000415 3300046683 Bacteria 23946
138 Ga0495649_0003266 3300046694 Bacteria 11047
139 Ga0495660_0000757 3300046810 Bacteria 24415
140 Ga0495683_0000013 3300047323 Bacteria 200428
141 Ga0495626_0007895 3300048091 Bacteria 5891
142 Ga0496124_0034363 3300048927 Bacteria 4451
143 Ga0496126_0003519 3300048929 Bacteria 19705
144 Ga0495678_007903 3300049459 Bacteria 5456
145 Ga0501031_0057773 3300049568 Bacteria 2528
146 Ga0501033_0077007 3300049570 Bacteria 2448
147 Ga0501033_0143314 3300049570 Bacteria 1727
148 Ga0501034_0066355 3300049571 Bacteria 3622
149 Ga0501034_0378560 3300049571 Bacteria 1341
150 Ga0501037_0078193 3300049573 Bacteria 2400
151 Ga0501038_0017233 3300049574 Bacteria 6531
152 Ga0501047_0002316 3300049581 Bacteria 18217
153 Ga0501047_0010947 3300049581 Bacteria 8582
154 Ga0501047_0042317 3300049581 Bacteria 4402
155 Ga0501067_0001062 3300049583 Bacteria 14793
156 Ga0501070_0041107 3300049586 Bacteria 3852
157 Ga0501071_0153434 3300049587 Bacteria 1719
158 Ga0501073_0036098 3300049589 Bacteria 3512
159 Ga0501073_0217405 3300049589 Bacteria 1320
160 Ga0501075_0083895 3300049591 Bacteria 2413
161 Ga0501076_0079256 3300049592 Bacteria 2636
162 Ga0501077_0035733 3300049593 Bacteria 3164
163 Ga0501079_0031887 3300049741 Bacteria 4050
164 Ga0501280_002626 3300049776 Bacteria 2943
165 Ga0501035_0009408 3300049822 Bacteria 9085
166 Ga0501044_0000885 3300049823 Bacteria 36113
167 Ga0501044_0086310 3300049823 Bacteria 3170
168 Ga0501044_0232419 3300049823 Bacteria 1791
169 nmdc:mga05p37_185351_c1 3300050507 Bacteria 2530
170 nmdc:mga09592_91557_c1 3300050508 Bacteria 2599
171 nmdc:mga0qj67_105080_c1 3300050509 Bacteria 2278
172 nmdc:mga06r32_359212_c1 3300050510 Bacteria 1441
173 Ga0500595_039982 3300053119 Bacteria 1515
174 Ga0500618_000775 3300053125 Bacteria 18003
175 Ga0500636_0002325 3300053177 Bacteria 10542
176 Ga0500637_0038209 3300053178 Bacteria 2703
177 Ga0501084_0085838 3300054114 Bacteria 2643
178 2523466884 2523231067 Bacteria 5230452
179 2644297380 2643221653 Bacteria 4569637
180 2644655633 2643221719 Bacteria 4568197
181 2738669962 2738541265 Bacteria 6594665
182 2738748355 2738541282 Bacteria 6593925
183 2738857397 2738541303 Bacteria 6591772
184 2738945758 2738541317 Bacteria 5340176
185 2739348673 2738543031 Bacteria 5769731
186 2817491259 2816332298 Bacteria 6852809
187 2842338413 2842333319 Bacteria 8899485
188 2913310559 2913308742 Bacteria 5350706
189 2989777692 2989776772 Bacteria 4843317
190 3000019612 3000017691 Bacteria 3772574
191 8057160871 8057160832 Bacteria 3268302
192 Ga0213875_10000152
193 JGI25157J39369_1000411
194 Ga0070658_10148420
195 Ga0070666_10210117
196 Ga0070682_100016166
197 Ga0070714_100004435
198 Ga0070713_100003316
199 Ga0070711_100108832
200 Ga0070706_100023669
201 Ga0070707_100055362
202 Ga0068853_100042638
203 Ga0070696_100054305
204 Ga0068856_100354355
205 Ga0070712_100081986
206 Ga0097621_100201232
207 Ga0075428_100033026
208 Ga0075428_100040317
209 Ga0075428_100271046
210 Ga0075431_100070131
211 Ga0075431_100202539
212 Ga0075429_100039638
213 Ga0075436_100005591
214 Ga0075436_100008709
215 Ga0105240_10135811
216 Ga0111539_10121199
217 Ga0114129_10053347
218 Ga0105248_10000009
219 Ga0105237_10000071
220 Ga0105249_10246469
221 Ga0105239_10064306
222 Ga0157372_10309362
223 Ga0209258_108260
224 Ga0209026_1000069
225 Ga0209233_1000413
226 Ga0207684_10113772
227 Ga0207695_10146488
228 Ga0207671_10000099
229 Ga0207646_10021237
230 Ga0207664_10017175
231 Ga0207639_10030358
232 Ga0207428_10051852
233 Ga0268266_10000749
234 Ga0268266_10459196
235 Ga0265338_10000007
236 Ga0265338_10021585
237 Ga0265338_10127161
238 Ga0265324_10000112
239 Ga0265324_10013999
240 Ga0265325_10000001
241 Ga0265325_10002618
242 Ga0265325_10007667
243 Ga0265325_10013163
244 Ga0265325_10013651
245 Ga0265329_10047802
246 Ga0265340_10001208
247 Ga0265340_10003851
248 Ga0265340_10027954
249 Ga0265340_10093211
250 Ga0265339_10000689
251 Ga0265339_10012949
252 Ga0265331_10003245
253 Ga0265331_10042795
254 Ga0265327_10000547
255 Ga0265316_10017639
256 Ga0265316_10050631
257 Ga0265316_10115970
258 Ga0265316_10138814
259 Ga0265313_10005319
260 Ga0265313_10007432
261 Ga0265313_10007522
262 Ga0316575_10000077
263 Ga0265314_10000101
264 Ga0265314_10011988
265 Ga0265314_10015291
266 Ga0265314_10081359
267 Ga0265314_10108296
268 Ga0265342_10030991
269 Ga0265342_10033826
270 Ga0265342_10098699
271 Ga0307516_10027632
272 Ga0316577_10008945
273 Ga0307413_10036651
274 Ga0307406_10077052
275 Ga0373932_0021171
276 Ga0373943_0004922
277 Ga0373946_0012281
278 Ga0373931_0005681
279 Ga0373931_0042002
280 Ga0373947_0018502
281 Ga0373937_0146071
282 Ga0373925_0003185
283 Ga0436364_0154218
284 Ga0395901_0420993
285 Ga0400490_34423
286 Ga0400488_33058
287 Ga0400486_23976
288 Ga0400483_057506
289 Ga0400483_085795
290 Ga0400483_163876
291 Ga0451577_0000013
292 Ga0451577_0001952
293 Ga0451577_0010194
294 Ga0451577_0393756
295 Ga0453683_0000059
296 Ga0453683_0121188
297 Ga0453684_0000237
298 Ga0453684_0000585
299 Ga0453684_0007149
300 Ga0453684_0009945
301 Ga0451576_0000018
302 Ga0451576_0001981
303 Ga0451576_0004169
304 Ga0451576_0008944
305 Ga0451576_0011909
306 Ga0451576_0073524
307 Ga0451576_0108662
308 Ga0495603_0069597
309 Ga0495591_000016
310 Ga0495653_0001612
311 Ga0495580_0040044
312 Ga0495605_0000244
313 Ga0495584_0010339
314 Ga0495585_0002474
315 Ga0495607_0000031
316 Ga0495607_0004155
317 Ga0495606_0001163
318 Ga0495610_0096844
319 Ga0495631_0029058
320 Ga0495632_0023792
321 Ga0495637_0006895
322 Ga0495637_0020523
323 Ga0495587_0099511
324 Ga0495597_0000012
325 Ga0495635_0067620
326 Ga0495661_0000011
327 Ga0495588_0088935
328 Ga0495658_0000415
329 Ga0495649_0003266
330 Ga0495660_0000757
331 Ga0495683_0000013
332 Ga0495626_0007895
333 Ga0496124_0034363
334 Ga0496126_0003519
335 Ga0495678_007903
336 Ga0501031_0057773
337 Ga0501033_0077007
338 Ga0501033_0143314
339 Ga0501034_0066355
340 Ga0501034_0378560
341 Ga0501037_0078193
342 Ga0501038_0017233
343 Ga0501047_0002316
344 Ga0501047_0010947
345 Ga0501047_0042317
346 Ga0501067_0001062
347 Ga0501070_0041107
348 Ga0501071_0153434
349 Ga0501073_0036098
350 Ga0501073_0217405
351 Ga0501075_0083895
352 Ga0501076_0079256
353 Ga0501077_0035733
354 Ga0501079_0031887
355 Ga0501280_002626
356 Ga0501035_0009408
357 Ga0501044_0000885
358 Ga0501044_0086310
359 Ga0501044_0232419
360 nmdc:mga05p37_185351_c1
361 nmdc:mga09592_91557_c1
362 nmdc:mga0qj67_105080_c1
363 nmdc:mga06r32_359212_c1
364 Ga0500595_039982
365 Ga0500618_000775
366 Ga0500636_0002325
367 Ga0500637_0038209
368 Ga0501084_0085838
369 2523466884
370 2644297380
371 2644655633
372 2738669962
373 2738748355
374 2738857397
375 2738945758
376 2739348673
377 2817491259
378 2842338413
379 2913310559
380 2989777692
381 3000019612
382 8057160871

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03459

TOBE

TOBE domain

302

371

0.89

PF00005

ABC_tran

ABC transporter

23

170

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fr3-assembly1.cif.gz_A the high resolution structure of a molybdate binding protein from sporomusa ovata 0.9469 297 358
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.8974 8 221
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.8962 8 230
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.8744 8 221
1h9m-assembly1.cif.gz_A two crystal structures of the cytoplasmic molybdate-binding protein modg suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. peg-grown form with molybdate bound 0.873 242 361
ID Description Score Start End Superfamily
af_P09833_289_351_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9601 299 357 2.40.50.100
af_P09833_10_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9568 16 225 3.40.50.300
1fr3A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9469 297 358 2.40.50.100
3d31B03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.917 285 359 2.40.50.100
3d31A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9055 8 221 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A538RU00-F1-model_v4 ATP-binding cassette domain-containing protein 0.9488 8 221 GO:0005524
GO:0016887
AF-A0A259RJW4-F1-model_v4 ABC transporter domain-containing protein 0.9302 1 221 GO:0005524
GO:0005886
GO:0016887
AF-A0A0D8IF12-F1-model_v4 Molybdenum import ATP-binding protein ModC (EC 3.6.3.29) 0.9236 8 221 GO:0005524
GO:0016887
AF-A0A7C3NV77-F1-model_v4 ABC transporter ATP-binding protein 0.9219 6 221 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-A0A538RU00-F1-model_v4 ATP-binding cassette domain-containing protein 0.9197 8 221 GO:0005524
GO:0016887

Map