F294104

General Info

Members Datasets Scaffolds Average Seq Length
191 132 185 217

Family's Representative Sequence

Representative Sequence 3300025303|Ga0209051_1084832|Ga0209051_10848321
Length 215
Sequence MTITITAFDRSPDGGKGLARDTRVRWALEEAGLPYEVRLVSPQAMKAPAHLALSPFGQIPTYEEDGLVLFESGAIILHIAQRHGGGLLPADPDARARAVSWMFAAVNSVEPPILELVIVKIVEGGKPWAAERRALVEERIRGPLRLLAARLGDAPWLDGAFSAGDLMMASVLLRLRPSGLLDEFPTLAAYVARGESRPAYQRAFAAQRAVNAPGA

Samples

Sample ID Description Type Environment
1 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
2 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
3 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
4 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
5 2831864461 Roseateles noduli HZ7 Isolate Nodule
6 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
32 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
34 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
37 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
42 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
44 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
46 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
58 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
59 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
60 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
61 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
62 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
63 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
64 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
65 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
66 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
67 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
68 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
69 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
70 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
71 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
72 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
73 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
74 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
75 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
76 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
77 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
78 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
79 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
80 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
81 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
82 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
83 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
84 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
85 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
86 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
87 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
88 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
89 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
90 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
91 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
92 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
93 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
94 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
95 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
96 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
97 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
98 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
99 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
100 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
101 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
102 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
103 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
104 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
105 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
106 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
107 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
108 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
109 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
110 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
116 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
117 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
118 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
119 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
120 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
121 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
122 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
123 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
124 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
127 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
128 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
129 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
130 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
131 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
132 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.86
Metatranscriptomes 0
Isolates 3.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.8
Nodule 1.05
Rhizoplane 2.09
Rhizosphere 69.11
Stem 0
Stem Tuber 0
Unclassified 9.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10023951 3300003187 Bacteria 2505
2 JGI25153J46596_10000080 3300003215 Bacteria 113263
3 rootL2_10037535 3300003322 Bacteria 1361
4 Ga0055542_1015844 3300003762 Bacteria 1201
5 Ga0055529_1007536 3300003763 Bacteria 1475
6 Ga0055526_1001589 3300003771 Bacteria 15946
7 Ga0055537_1004457 3300003773 Bacteria 3999
8 Ga0055536_1043329 3300003781 Bacteria 1046
9 Ga0055530_10031417 3300003791 Bacteria 1394
10 Ga0055530_10064136 3300003791 Bacteria 810
11 Ga0055540_1000940 3300003792 Bacteria 18931
12 Ga0055531_10045639 3300003794 Bacteria 1214
13 Ga0070680_100114454 3300005336 Bacteria 2247
14 Ga0070660_100457668 3300005339 Bacteria 1059
15 Ga0070659_100249444 3300005366 Bacteria 1471
16 Ga0070679_100255503 3300005530 Bacteria 1708
17 Ga0068853_100035969 3300005539 Bacteria 4208
18 Ga0068857_100260962 3300005577 Bacteria 1590
19 Ga0068858_100001380 3300005842 Bacteria 25043
20 Ga0105245_10000296 3300009098 Bacteria 47660
21 Ga0105243_10625556 3300009148 Bacteria 1040
22 Ga0105241_11020008 3300009174 Bacteria 775
23 Ga0105238_10016082 3300009551 Bacteria 7567
24 Ga0105238_10611425 3300009551 Bacteria 1098
25 Ga0157378_10089746 3300013297 Bacteria 2793
26 Ga0163162_11328581 3300013306 Bacteria 817
27 Ga0207427_100599 3300025231 Bacteria 18018
28 Ga0209258_110971 3300025242 Bacteria 1157
29 Ga0207425_1000019 3300025245 Bacteria 399942
30 Ga0209677_108214 3300025253 Bacteria 2058
31 Ga0209148_1000872 3300025254 Bacteria 20992
32 Ga0209129_1000951 3300025258 Bacteria 17420
33 Ga0209565_1000089 3300025263 Bacteria 150511
34 Ga0209455_1003903 3300025272 Bacteria 5084
35 Ga0209673_1009961 3300025273 Bacteria 4053
36 Ga0209676_1008669 3300025292 Bacteria 4498
37 Ga0209025_1000268 3300025294 Bacteria 121656
38 Ga0209564_1001376 3300025295 Bacteria 25390
39 Ga0209758_1000019 3300025297 Bacteria 743682
40 Ga0209050_1000001 3300025298 Bacteria 3563507
41 Ga0209050_1012091 3300025298 Bacteria 4007
42 Ga0207426_1010067 3300025302 Bacteria 3696
43 Ga0209051_1000304 3300025303 Bacteria 77336
44 Ga0209051_1084832 3300025303 Bacteria 900
45 Ga0209257_1001237 3300025304 Bacteria 31611
46 Ga0207692_10214291 3300025898 Bacteria 1139
47 Ga0207705_10000474 3300025909 Bacteria 34416
48 Ga0207707_10006274 3300025912 Bacteria 10383
49 Ga0207657_10000141 3300025919 Bacteria 72714
50 Ga0207657_10208193 3300025919 Bacteria 1571
51 Ga0207652_10004999 3300025921 Bacteria 10739
52 Ga0207687_10000834 3300025927 Bacteria 20806
53 Ga0207690_10235200 3300025932 Bacteria 1409
54 Ga0207703_10000480 3300026035 Bacteria 41815
55 Ga0207702_10124659 3300026078 Bacteria 2310
56 Ga0265331_10067725 3300031250 Bacteria 1674
57 Ga0265327_10000200 3300031251 Bacteria 125094
58 Ga0307509_10139871 3300031507 Bacteria 2359
59 Ga0307510_10124627 3300033180 Bacteria 2270
60 Ga0436365_0175564 3300039437 Bacteria 984
61 Ga0466982_0000040 3300044672 Bacteria 41234
62 Ga0451576_0247251 3300045051 Bacteria 1864
63 Ga0466967_0120635 3300045976 Bacteria 2422
64 Ga0495603_0011849 3300046455 Bacteria 5277
65 Ga0495590_0017124 3300046457 Bacteria 2612
66 Ga0495591_000211 3300046458 Bacteria 58917
67 Ga0495591_026147 3300046458 Bacteria 1819
68 Ga0495638_0028467 3300046460 Bacteria 3608
69 Ga0495653_0122396 3300046463 Bacteria 1852
70 Ga0495605_0000110 3300046474 Bacteria 104425
71 Ga0495605_0003824 3300046474 Bacteria 8930
72 Ga0495605_0026355 3300046474 Bacteria 3022
73 Ga0495605_0049295 3300046474 Bacteria 2058
74 Ga0495584_0000431 3300046491 Bacteria 28819
75 Ga0495584_0022214 3300046491 Bacteria 3220
76 Ga0495585_0004559 3300046492 Bacteria 8961
77 Ga0495596_0015744 3300046500 Bacteria 3157
78 Ga0495596_0019141 3300046500 Bacteria 2816
79 Ga0495596_0066066 3300046500 Bacteria 1406
80 Ga0495596_0142615 3300046500 Bacteria 930
81 Ga0495607_0010228 3300046501 Bacteria 6311
82 Ga0495607_0015378 3300046501 Bacteria 4961
83 Ga0495607_0030587 3300046501 Bacteria 3304
84 Ga0495606_0042289 3300046507 Bacteria 3048
85 Ga0495610_0009078 3300046512 Bacteria 6337
86 Ga0495616_0000230 3300046513 Bacteria 45632
87 Ga0495616_0021174 3300046513 Bacteria 3525
88 Ga0495616_0028267 3300046513 Bacteria 2969
89 Ga0495616_0028914 3300046513 Bacteria 2930
90 Ga0495616_0133969 3300046513 Bacteria 1133
91 Ga0495631_0001794 3300046518 Bacteria 12728
92 Ga0495631_0009152 3300046518 Bacteria 4961
93 Ga0495631_0017152 3300046518 Bacteria 3431
94 Ga0495631_0025027 3300046518 Bacteria 2751
95 Ga0495631_0032782 3300046518 Bacteria 2340
96 Ga0495632_0001253 3300046519 Bacteria 21542
97 Ga0495632_0007645 3300046519 Bacteria 6755
98 Ga0495632_0058811 3300046519 Bacteria 1872
99 Ga0495637_0000011 3300046520 Bacteria 337279
100 Ga0495644_0001513 3300046523 Bacteria 9471
101 Ga0495644_0006473 3300046523 Bacteria 4539
102 Ga0495648_0000840 3300046524 Bacteria 32359
103 Ga0495648_0034900 3300046524 Bacteria 3266
104 Ga0495648_0044465 3300046524 Bacteria 2772
105 Ga0495648_0285068 3300046524 Bacteria 781
106 Ga0495642_0000017 3300046528 Bacteria 111313
107 Ga0495642_0001170 3300046528 Bacteria 12050
108 Ga0495642_0041557 3300046528 Bacteria 1870
109 Ga0495642_0047502 3300046528 Bacteria 1758
110 Ga0495654_0008746 3300046530 Bacteria 5576
111 Ga0495587_0070223 3300046536 Bacteria 2039
112 Ga0495609_0016671 3300046538 Bacteria 3421
113 Ga0495609_0018757 3300046538 Bacteria 3205
114 Ga0495597_0005724 3300046542 Bacteria 6530
115 Ga0495633_0003583 3300046558 Bacteria 10272
116 Ga0495668_0001424 3300046616 Bacteria 23205
117 Ga0495668_0066013 3300046616 Bacteria 1991
118 Ga0495611_0003407 3300046648 Bacteria 7016
119 Ga0495611_0015562 3300046648 Bacteria 3251
120 Ga0495611_0074201 3300046648 Bacteria 1557
121 Ga0495625_0008573 3300046660 Bacteria 8703
122 Ga0495661_0033439 3300046665 Bacteria 3243
123 Ga0495661_0098282 3300046665 Bacteria 1652
124 Ga0495588_0050238 3300046674 Bacteria 2145
125 Ga0495669_0006055 3300046684 Bacteria 5048
126 Ga0495669_0016898 3300046684 Bacteria 3129
127 Ga0495669_0065537 3300046684 Bacteria 1649
128 Ga0495670_0161250 3300046691 Bacteria 1178
129 Ga0495671_0000991 3300046692 Bacteria 19796
130 Ga0495671_0004433 3300046692 Bacteria 8394
131 Ga0495671_0009664 3300046692 Bacteria 5379
132 Ga0495649_0047062 3300046694 Bacteria 2346
133 Ga0495649_0200553 3300046694 Bacteria 1036
134 Ga0495589_0125329 3300046794 Bacteria 1235
135 Ga0495660_0003317 3300046810 Bacteria 9983
136 Ga0495660_0013210 3300046810 Bacteria 4784
137 Ga0495660_0043180 3300046810 Bacteria 2488
138 Ga0495604_0041093 3300047317 Bacteria 3628
139 Ga0495636_0004534 3300047318 Bacteria 5444
140 Ga0495672_0000543 3300047320 Bacteria 42854
141 Ga0495683_0000577 3300047323 Bacteria 27721
142 Ga0495687_000052 3300047443 Bacteria 199186
143 Ga0495677_0002277 3300047445 Bacteria 7578
144 Ga0495677_0003358 3300047445 Bacteria 6227
145 Ga0495679_025761 3300047446 Bacteria 1962
146 Ga0495685_017703 3300047447 Bacteria 2442
147 Ga0495681_0028319 3300047470 Bacteria 2884
148 Ga0495686_0000057 3300047472 Bacteria 250088
149 Ga0495686_0000203 3300047472 Bacteria 110612
150 Ga0495686_0005996 3300047472 Bacteria 9449
151 Ga0495686_0191862 3300047472 Bacteria 1177
152 Ga0495626_0004090 3300048091 Bacteria 9071
153 Ga0495626_0014124 3300048091 Bacteria 4130
154 Ga0495626_0043091 3300048091 Bacteria 2118
155 Ga0495626_0137852 3300048091 Bacteria 1036
156 Ga0496102_0005312 3300048905 Bacteria 10938
157 Ga0496110_0000463 3300048913 Bacteria 27632
158 Ga0496111_0112074 3300048914 Bacteria 2010
159 Ga0496115_0258339 3300048918 Bacteria 1433
160 Ga0496117_0063467 3300048920 Bacteria 2525
161 Ga0496121_0000114 3300048924 Bacteria 179427
162 Ga0496122_0007454 3300048925 Bacteria 12147
163 Ga0496123_0001749 3300048926 Bacteria 28654
164 Ga0496124_0009822 3300048927 Bacteria 9788
165 Ga0496124_0076084 3300048927 Bacteria 2772
166 Ga0496124_0166095 3300048927 Bacteria 1715
167 Ga0496125_0097101 3300048928 Bacteria 2184
168 Ga0496126_0000468 3300048929 Bacteria 80168
169 Ga0496126_0001024 3300048929 Bacteria 47517
170 Ga0495678_000053 3300049459 Bacteria 154277
171 Ga0495678_000225 3300049459 Bacteria 65737
172 Ga0495678_004176 3300049459 Bacteria 8514
173 Ga0495682_0010152 3300049460 Bacteria 3656
174 Ga0495682_0044276 3300049460 Bacteria 1628
175 Ga0501067_0004230 3300049583 Bacteria 7923
176 Ga0501077_0649713 3300049593 Bacteria 678
177 Ga0501083_0024689 3300049744 Bacteria 4162
178 Ga0501083_0024916 3300049744 Bacteria 4143
179 Ga0501083_0047022 3300049744 Bacteria 2917
180 nmdc:mga0yw44_350823_c1 3300050492 Bacteria 993
181 Ga0500643_000976 3300053087 Bacteria 17685
182 Ga0500559_0027892 3300053136 Bacteria 2411
183 Ga0500645_067446 3300053730 Bacteria 1029
184 Ga0501084_0010940 3300054114 Bacteria 7513
185 Ga0501082_0038643 3300060353 Bacteria 4117

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048914 Ga0496111_0112074 Ga0496111_0112074_922_1569 205
2 iso_pu_bacteria 2831864461 2831865328 208
3 iso_pu_bacteria 2903748898 2903755479 208
4 iso_pu_bacteria 2643221639 2644219122 210
5 iso_pu_bacteria 2643221646 2644255638 210
6 3300005530 Ga0070679_100255503 Ga0070679_1002555032 211
7 3300045976 Ga0466967_0120635 Ga0466967_0120635_243_878 211
8 iso_pu_bacteria 2818991438 2819550734 211
9 3300005577 Ga0068857_100260962 Ga0068857_1002609623 212
10 3300044672 Ga0466982_0000040 Ga0466982_0000040_31343_31981 212
11 3300046463 Ga0495653_0122396 Ga0495653_0122396_893_1531 212
12 3300046536 Ga0495587_0070223 Ga0495587_0070223_1123_1761 212
13 3300046542 Ga0495597_0005724 Ga0495597_0005724_1010_1648 212
14 3300047317 Ga0495604_0041093 Ga0495604_0041093_1089_1727 212
15 3300047472 Ga0495686_0005996 Ga0495686_0005996_976_1614 212
16 3300048929 Ga0496126_0001024 Ga0496126_0001024_42409_43047 212
17 3300003322 rootL2_10037535 rootL2_100375352 213
18 3300003771 Ga0055526_1001589 Ga0055526_100158918 213
19 3300003773 Ga0055537_1004457 Ga0055537_10044575 213
20 3300003791 Ga0055530_10064136 Ga0055530_100641361 213
21 3300005336 Ga0070680_100114454 Ga0070680_1001144543 213
22 3300009148 Ga0105243_10625556 Ga0105243_106255561 213
23 3300013306 Ga0163162_11328581 Ga0163162_113285811 213
24 3300025231 Ga0207427_100599 Ga0207427_1005993 213
25 3300025263 Ga0209565_1000089 Ga0209565_1000089128 213
26 3300025273 Ga0209673_1009961 Ga0209673_10099612 213
27 3300025295 Ga0209564_1001376 Ga0209564_100137620 213
28 3300025298 Ga0209050_1012091 Ga0209050_10120912 213
29 3300025302 Ga0207426_1010067 Ga0207426_10100672 213
30 3300025909 Ga0207705_10000474 Ga0207705_1000047418 213
31 3300025912 Ga0207707_10006274 Ga0207707_100062748 213
32 3300025919 Ga0207657_10000141 Ga0207657_100001418 213
33 3300025921 Ga0207652_10004999 Ga0207652_100049997 213
34 3300045051 Ga0451576_0247251 Ga0451576_0247251_325_966 213
35 3300047472 Ga0495686_0000057 Ga0495686_0000057_109636_110277 213
36 iso_pu_bacteria 2593339239 2595451090 213
37 3300005366 Ga0070659_100249444 Ga0070659_1002494442 214
38 3300025303 Ga0209051_1084832 Ga0209051_10848321 214
39 3300025932 Ga0207690_10235200 Ga0207690_102352001 214
40 3300026078 Ga0207702_10124659 Ga0207702_101246592 214
41 3300039437 Ga0436365_0175564 Ga0436365_0175564_236_883 214
42 3300046455 Ga0495603_0011849 Ga0495603_0011849_1910_2554 214
43 3300046474 Ga0495605_0049295 Ga0495605_0049295_920_1564 214
44 3300046513 Ga0495616_0000230 Ga0495616_0000230_39505_40149 214
45 3300046518 Ga0495631_0032782 Ga0495631_0032782_665_1309 214
46 3300046519 Ga0495632_0001253 Ga0495632_0001253_3956_4600 214
47 3300046524 Ga0495648_0285068 Ga0495648_0285068_106_750 214
48 3300046528 Ga0495642_0001170 Ga0495642_0001170_3433_4077 214
49 3300046674 Ga0495588_0050238 Ga0495588_0050238_974_1618 214
50 3300046684 Ga0495669_0016898 Ga0495669_0016898_1094_1738 214
51 3300046810 Ga0495660_0003317 Ga0495660_0003317_7005_7649 214
52 3300047318 Ga0495636_0004534 Ga0495636_0004534_2967_3611 214
53 3300048924 Ga0496121_0000114 Ga0496121_0000114_153671_154315 214
54 3300049593 Ga0501077_0649713 Ga0501077_0649713_24_668 214
55 3300049744 Ga0501083_0024916 Ga0501083_0024916_786_1430 214
56 3300003187 JGI25151J46595_10023951 JGI25151J46595_100239512 215
57 3300003215 JGI25153J46596_10000080 JGI25153J46596_1000008022 215
58 3300003762 Ga0055542_1015844 Ga0055542_10158441 215
59 3300003763 Ga0055529_1007536 Ga0055529_10075362 215
60 3300003781 Ga0055536_1043329 Ga0055536_10433292 215
61 3300003791 Ga0055530_10031417 Ga0055530_100314172 215
62 3300003792 Ga0055540_1000940 Ga0055540_10009407 215
63 3300003794 Ga0055531_10045639 Ga0055531_100456392 215
64 3300005339 Ga0070660_100457668 Ga0070660_1004576681 215
65 3300005539 Ga0068853_100035969 Ga0068853_1000359694 215
66 3300005842 Ga0068858_100001380 Ga0068858_1000013806 215
67 3300009098 Ga0105245_10000296 Ga0105245_1000029616 215
68 3300009174 Ga0105241_11020008 Ga0105241_110200081 215
69 3300009551 Ga0105238_10016082 Ga0105238_1001608215 215
70 3300009551 Ga0105238_10611425 Ga0105238_106114251 215
71 3300013297 Ga0157378_10089746 Ga0157378_100897462 215
72 3300025242 Ga0209258_110971 Ga0209258_1109712 215
73 3300025245 Ga0207425_1000019 Ga0207425_1000019251 215
74 3300025253 Ga0209677_108214 Ga0209677_1082143 215
75 3300025254 Ga0209148_1000872 Ga0209148_100087215 215
76 3300025258 Ga0209129_1000951 Ga0209129_100095116 215
77 3300025272 Ga0209455_1003903 Ga0209455_10039033 215
78 3300025292 Ga0209676_1008669 Ga0209676_10086697 215
79 3300025294 Ga0209025_1000268 Ga0209025_100026882 215
80 3300025297 Ga0209758_1000019 Ga0209758_1000019336 215
81 3300025298 Ga0209050_1000001 Ga0209050_10000011423 215
82 3300025303 Ga0209051_1000304 Ga0209051_100030453 215
83 3300025304 Ga0209257_1001237 Ga0209257_100123726 215
84 3300025898 Ga0207692_10214291 Ga0207692_102142912 215
85 3300025919 Ga0207657_10208193 Ga0207657_102081931 215
86 3300025927 Ga0207687_10000834 Ga0207687_1000083414 215
87 3300026035 Ga0207703_10000480 Ga0207703_1000048015 215
88 3300031250 Ga0265331_10067725 Ga0265331_100677251 215
89 3300031251 Ga0265327_10000200 Ga0265327_1000020019 215
90 3300031507 Ga0307509_10139871 Ga0307509_101398712 215
91 3300033180 Ga0307510_10124627 Ga0307510_101246271 215
92 3300046457 Ga0495590_0017124 Ga0495590_0017124_271_918 215
93 3300046458 Ga0495591_000211 Ga0495591_000211_37475_38122 215
94 3300046458 Ga0495591_026147 Ga0495591_026147_244_891 215
95 3300046460 Ga0495638_0028467 Ga0495638_0028467_1875_2522 215
96 3300046474 Ga0495605_0000110 Ga0495605_0000110_50028_50711 215
97 3300046474 Ga0495605_0003824 Ga0495605_0003824_4150_4797 215
98 3300046474 Ga0495605_0026355 Ga0495605_0026355_1257_1907 215
99 3300046491 Ga0495584_0000431 Ga0495584_0000431_7379_8026 215
100 3300046491 Ga0495584_0022214 Ga0495584_0022214_801_1451 215
101 3300046492 Ga0495585_0004559 Ga0495585_0004559_8215_8898 215
102 3300046500 Ga0495596_0015744 Ga0495596_0015744_874_1521 215
103 3300046500 Ga0495596_0019141 Ga0495596_0019141_1635_2282 215
104 3300046500 Ga0495596_0066066 Ga0495596_0066066_411_1058 215
105 3300046500 Ga0495596_0142615 Ga0495596_0142615_116_799 215
106 3300046501 Ga0495607_0010228 Ga0495607_0010228_5177_5860 215
107 3300046501 Ga0495607_0015378 Ga0495607_0015378_4048_4695 215
108 3300046501 Ga0495607_0030587 Ga0495607_0030587_2103_2753 215
109 3300046507 Ga0495606_0042289 Ga0495606_0042289_1747_2397 215
110 3300046512 Ga0495610_0009078 Ga0495610_0009078_4135_4782 215
111 3300046513 Ga0495616_0021174 Ga0495616_0021174_2168_2815 215
112 3300046513 Ga0495616_0028267 Ga0495616_0028267_1281_1964 215
113 3300046513 Ga0495616_0028914 Ga0495616_0028914_1174_1824 215
114 3300046513 Ga0495616_0133969 Ga0495616_0133969_114_761 215
115 3300046518 Ga0495631_0001794 Ga0495631_0001794_8476_9123 215
116 3300046518 Ga0495631_0009152 Ga0495631_0009152_3327_3974 215
117 3300046518 Ga0495631_0017152 Ga0495631_0017152_2240_2890 215
118 3300046518 Ga0495631_0025027 Ga0495631_0025027_1743_2426 215
119 3300046519 Ga0495632_0007645 Ga0495632_0007645_2358_3005 215
120 3300046519 Ga0495632_0058811 Ga0495632_0058811_289_936 215
121 3300046520 Ga0495637_0000011 Ga0495637_0000011_315837_316484 215
122 3300046523 Ga0495644_0001513 Ga0495644_0001513_580_1263 215
123 3300046523 Ga0495644_0006473 Ga0495644_0006473_1739_2386 215
124 3300046524 Ga0495648_0000840 Ga0495648_0000840_9482_10165 215
125 3300046524 Ga0495648_0034900 Ga0495648_0034900_658_1305 215
126 3300046524 Ga0495648_0044465 Ga0495648_0044465_1548_2195 215
127 3300046528 Ga0495642_0000017 Ga0495642_0000017_27343_28026 215
128 3300046528 Ga0495642_0041557 Ga0495642_0041557_146_793 215
129 3300046528 Ga0495642_0047502 Ga0495642_0047502_208_855 215
130 3300046530 Ga0495654_0008746 Ga0495654_0008746_413_1096 215
131 3300046538 Ga0495609_0016671 Ga0495609_0016671_915_1565 215
132 3300046538 Ga0495609_0018757 Ga0495609_0018757_1375_2022 215
133 3300046558 Ga0495633_0003583 Ga0495633_0003583_5541_6188 215
134 3300046616 Ga0495668_0001424 Ga0495668_0001424_15150_15833 215
135 3300046616 Ga0495668_0066013 Ga0495668_0066013_658_1305 215
136 3300046648 Ga0495611_0003407 Ga0495611_0003407_6306_6953 215
137 3300046648 Ga0495611_0015562 Ga0495611_0015562_1286_1969 215
138 3300046648 Ga0495611_0074201 Ga0495611_0074201_841_1491 215
139 3300046660 Ga0495625_0008573 Ga0495625_0008573_300_947 215
140 3300046665 Ga0495661_0033439 Ga0495661_0033439_2514_3197 215
141 3300046665 Ga0495661_0098282 Ga0495661_0098282_670_1317 215
142 3300046684 Ga0495669_0006055 Ga0495669_0006055_1706_2353 215
143 3300046684 Ga0495669_0065537 Ga0495669_0065537_584_1231 215
144 3300046691 Ga0495670_0161250 Ga0495670_0161250_432_1082 215
145 3300046692 Ga0495671_0000991 Ga0495671_0000991_9322_10005 215
146 3300046692 Ga0495671_0004433 Ga0495671_0004433_6674_7321 215
147 3300046692 Ga0495671_0009664 Ga0495671_0009664_1059_1706 215
148 3300046694 Ga0495649_0047062 Ga0495649_0047062_1373_2020 215
149 3300046694 Ga0495649_0200553 Ga0495649_0200553_41_688 215
150 3300046794 Ga0495589_0125329 Ga0495589_0125329_290_937 215
151 3300046810 Ga0495660_0013210 Ga0495660_0013210_642_1289 215
152 3300046810 Ga0495660_0043180 Ga0495660_0043180_812_1462 215
153 3300047320 Ga0495672_0000543 Ga0495672_0000543_20796_21443 215
154 3300047323 Ga0495683_0000577 Ga0495683_0000577_6279_6926 215
155 3300047443 Ga0495687_000052 Ga0495687_000052_163907_164554 215
156 3300047445 Ga0495677_0002277 Ga0495677_0002277_5490_6137 215
157 3300047445 Ga0495677_0003358 Ga0495677_0003358_3114_3797 215
158 3300047446 Ga0495679_025761 Ga0495679_025761_396_1043 215
159 3300047447 Ga0495685_017703 Ga0495685_017703_395_1042 215
160 3300047470 Ga0495681_0028319 Ga0495681_0028319_428_1111 215
161 3300047472 Ga0495686_0000203 Ga0495686_0000203_33886_34533 215
162 3300047472 Ga0495686_0191862 Ga0495686_0191862_206_889 215
163 3300048091 Ga0495626_0004090 Ga0495626_0004090_2458_3105 215
164 3300048091 Ga0495626_0014124 Ga0495626_0014124_1615_2262 215
165 3300048091 Ga0495626_0043091 Ga0495626_0043091_669_1319 215
166 3300048091 Ga0495626_0137852 Ga0495626_0137852_337_984 215
167 3300048905 Ga0496102_0005312 Ga0496102_0005312_1541_2224 215
168 3300048913 Ga0496110_0000463 Ga0496110_0000463_19698_20345 215
169 3300048918 Ga0496115_0258339 Ga0496115_0258339_191_841 215
170 3300048920 Ga0496117_0063467 Ga0496117_0063467_1560_2216 215
171 3300048925 Ga0496122_0007454 Ga0496122_0007454_4868_5524 215
172 3300048926 Ga0496123_0001749 Ga0496123_0001749_14149_14805 215
173 3300048927 Ga0496124_0009822 Ga0496124_0009822_7215_7871 215
174 3300048927 Ga0496124_0076084 Ga0496124_0076084_2053_2700 215
175 3300048927 Ga0496124_0166095 Ga0496124_0166095_247_897 215
176 3300048928 Ga0496125_0097101 Ga0496125_0097101_302_958 215
177 3300048929 Ga0496126_0000468 Ga0496126_0000468_53089_53745 215
178 3300049459 Ga0495678_000053 Ga0495678_000053_5098_5745 215
179 3300049459 Ga0495678_000225 Ga0495678_000225_2469_3116 215
180 3300049459 Ga0495678_004176 Ga0495678_004176_4279_4926 215
181 3300049460 Ga0495682_0010152 Ga0495682_0010152_1296_1943 215
182 3300049460 Ga0495682_0044276 Ga0495682_0044276_432_1079 215
183 3300049583 Ga0501067_0004230 Ga0501067_0004230_1222_1983 215
184 3300049744 Ga0501083_0024689 Ga0501083_0024689_2994_3755 215
185 3300049744 Ga0501083_0047022 Ga0501083_0047022_892_1653 215
186 3300050492 nmdc:mga0yw44_350823_c1 nmdc:mga0yw44_350823_c1_303_950 215
187 3300053087 Ga0500643_000976 Ga0500643_000976_14224_14871 215
188 3300053136 Ga0500559_0027892 Ga0500559_0027892_910_1563 215
189 3300053730 Ga0500645_067446 Ga0500645_067446_127_774 215
190 3300054114 Ga0501084_0010940 Ga0501084_0010940_3355_4116 215
191 3300060353 Ga0501082_0038643 Ga0501082_0038643_1156_1917 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

22

82

0.93

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

126

193

0.93

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

22

86

0.93

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

15

81

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ycd-assembly1.cif.gz_A-2 structure of a novel glutathione transferase from agrobacterium tumefaciens. 0.9843 2 211
3lq7-assembly1.cif.gz_A crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9749 1 213
3lq7-assembly1.cif.gz_B crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9722 1 213
3lq7-assembly1.cif.gz_A crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9702 1 213
2ycd-assembly1.cif.gz_A-2 structure of a novel glutathione transferase from agrobacterium tumefaciens. 0.9661 2 211
ID Description Score Start End Superfamily
2ycdA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9883 2 87 3.40.30.10
3lq7A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9883 2 85 3.40.30.10
2ycdA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.977 2 87 3.40.30.10
2ycdA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.975 88 203 1.20.1050.10
3lq7B02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.973 88 203 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A441BT83-F1-model_v4 Glutathione S-transferase family protein 1.004 85 174 GO:0016740
AF-A0A527A1T9-F1-model_v4 Glutathione S-transferase 0.997 1 78 GO:0016740
AF-A0A285U9C8-F1-model_v4 Glutathione S-transferase 0.9941 1 210 GO:0016740
AF-A0A529NGU8-F1-model_v4 Glutathione S-transferase 0.9936 1 108 GO:0016740
AF-A0A527Z608-F1-model_v4 Glutathione S-transferase family protein 0.9932 1 180 GO:0016740

Feature Viewer

pLDDT pTM Quality
94.48 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map