F294227

General Info

Members Datasets Scaffolds Average Seq Length
191 85 382 173

Family's Representative Sequence

Representative Sequence 3300031240|Ga0265320_10065200|Ga0265320_100652002
Length 198
Sequence MFFLDYYRDSETEKKPMYGQGIWKGLKVTLTRFLQTYQSDLSWLLRGQKRYYSPEGIAYRSGKDNNGIFTIQYPEEDLPIPEEFRYVPFLVFDQKENGEKDVRCTSCGICAKVCPPQCIWIVRTSDPETGRPIPVPTEFYIDADVIMDHNYELASEHRNLLNMEQLLKPADYYRKIRPQNYAIQEAERQAKEKADAQQ

Samples

Sample ID Description Type Environment
1 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
49 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
50 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
51 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
52 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
53 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
54 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
55 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
60 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
61 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
62 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
63 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
64 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
65 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
66 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
67 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
70 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
72 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
73 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
74 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
75 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
76 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
77 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
78 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
79 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
80 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
81 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
82 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
83 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
84 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
85 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.48
Stem 0
Stem Tuber 0
Unclassified 17.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265320_10065200 3300031240 Bacteria 1729
2 SwRhRL2b_contig_3729193 2162886007 Bacteria 4371
3 JGI25406J46586_10010267 3300003203 Bacteria 4160
4 Ga0065704_10000566 3300005289 Bacteria 25698
5 Ga0065704_10371875 3300005289 Bacteria 784
6 Ga0065707_10082660 3300005295 Bacteria 12928
7 Ga0065707_10083881 3300005295 Bacteria 8046
8 Ga0065707_10177891 3300005295 Bacteria 1438
9 Ga0070689_100258486 3300005340 Unclassified 1439
10 Ga0070705_100106384 3300005440 Bacteria 1783
11 Ga0070705_100359433 3300005440 Bacteria 1064
12 Ga0070700_100038011 3300005441 Bacteria 2931
13 Ga0070694_100058948 3300005444 Bacteria 2613
14 Ga0070706_100287965 3300005467 Bacteria 1533
15 Ga0070707_100888000 3300005468 Bacteria 856
16 Ga0070698_100097389 3300005471 Bacteria 2917
17 Ga0070698_100710332 3300005471 Unclassified 947
18 Ga0070699_100152682 3300005518 Bacteria 2043
19 Ga0070699_100276798 3300005518 Bacteria 1503
20 Ga0070699_100657958 3300005518 Unclassified 956
21 Ga0070699_100666120 3300005518 Bacteria 950
22 Ga0070699_100764789 3300005518 Bacteria 884
23 Ga0070697_100157126 3300005536 Bacteria 1920
24 Ga0070697_100236338 3300005536 Bacteria 1560
25 Ga0070697_100779033 3300005536 Bacteria 846
26 Ga0070695_100028268 3300005545 Bacteria 3479
27 Ga0070695_100180889 3300005545 Bacteria 1494
28 Ga0070696_100118621 3300005546 Bacteria 1913
29 Ga0070696_100201835 3300005546 Bacteria 1485
30 Ga0070704_100021038 3300005549 Bacteria 4221
31 Ga0070704_100272282 3300005549 Bacteria 1399
32 Ga0070704_100441270 3300005549 Bacteria 1119
33 Ga0070704_101031652 3300005549 Bacteria 745
34 Ga0068857_100049592 3300005577 Bacteria 3724
35 Ga0068857_100203035 3300005577 Unclassified 1807
36 Ga0068859_100041320 3300005617 Bacteria 4631
37 Ga0068859_100190809 3300005617 Bacteria 2133
38 Ga0068870_10109452 3300005840 Bacteria 1575
39 Ga0068862_100031716 3300005844 Bacteria 4463
40 Ga0068862_100415322 3300005844 Bacteria 1261
41 Ga0081539_10006020 3300005985 Bacteria 11907
42 Ga0075427_10001233 3300006194 Unclassified 3257
43 Ga0075428_100056888 3300006844 Bacteria 4282
44 Ga0075428_100387874 3300006844 Archaea 1497
45 Ga0075430_100057689 3300006846 Bacteria 3265
46 Ga0075431_100037168 3300006847 Bacteria 5018
47 Ga0075431_100152227 3300006847 Bacteria 2382
48 Ga0075434_100417924 3300006871 Unclassified 1362
49 Ga0075429_100024929 3300006880 Bacteria 5192
50 Ga0075429_100025143 3300006880 Bacteria 5169
51 Ga0075429_100203932 3300006880 Bacteria 1733
52 Ga0075429_100281134 3300006880 Archaea 1457
53 Ga0075429_100299647 3300006880 Bacteria 1407
54 Ga0075429_100321629 3300006880 Archaea 1354
55 Ga0097620_100041320 3300006931 Bacteria 4631
56 Ga0097620_100190800 3300006931 Bacteria 2133
57 Ga0111539_10772140 3300009094 Bacteria 1118
58 Ga0114129_10009582 3300009147 Bacteria 13816
59 Ga0114129_10032841 3300009147 Bacteria 7333
60 Ga0114129_10125125 3300009147 Bacteria 3535
61 Ga0114129_10144754 3300009147 Bacteria 3256
62 Ga0114129_10156014 3300009147 Archaea 3121
63 Ga0114129_10568405 3300009147 Unclassified 1472
64 Ga0105243_10099011 3300009148 Bacteria 2416
65 Ga0105243_10148087 3300009148 Unclassified 2011
66 Ga0105243_10148490 3300009148 Bacteria 2008
67 Ga0105241_10767635 3300009174 Bacteria 885
68 Ga0105242_10387929 3300009176 Unclassified 1300
69 Ga0105249_10119333 3300009553 Bacteria 2504
70 Ga0105249_10568672 3300009553 Bacteria 1186
71 Ga0157380_10108143 3300014326 Unclassified 2330
72 Ga0207653_10165299 3300025885 Bacteria 821
73 Ga0207643_10101049 3300025908 Unclassified 1691
74 Ga0207684_10531500 3300025910 Bacteria 1007
75 Ga0207646_10158174 3300025922 Bacteria 2044
76 Ga0207646_10628452 3300025922 Bacteria 963
77 Ga0207709_10061423 3300025935 Unclassified 2348
78 Ga0207709_10081025 3300025935 Bacteria 2092
79 Ga0207712_10428929 3300025961 Bacteria 1117
80 Ga0207708_10042200 3300026075 Bacteria 3478
81 Ga0207676_10324879 3300026095 Bacteria 1414
82 Ga0207676_11206097 3300026095 Bacteria 750
83 Ga0207674_10303193 3300026116 Bacteria 1546
84 Ga0207674_10305065 3300026116 Bacteria 1541
85 Ga0207675_100175452 3300026118 Bacteria 2050
86 Ga0268265_11260241 3300028380 Bacteria 738
87 Ga0265318_10027832 3300028577 Bacteria 2217
88 Ga0265323_10045831 3300028653 Unclassified 1570
89 Ga0265340_10064329 3300031247 Bacteria 1748
90 Ga0265327_10013384 3300031251 Bacteria 5450
91 Ga0316575_10058071 3300031665 Unclassified 1543
92 Ga0316575_10100266 3300031665 Bacteria 1177
93 Ga0316578_10281895 3300031728 Unclassified 995
94 Ga0316578_10350092 3300031728 Bacteria 879
95 Ga0307405_10089992 3300031731 Bacteria 2029
96 Ga0307413_10139752 3300031824 Bacteria 1671
97 Ga0307413_10376528 3300031824 Bacteria 1104
98 Ga0307410_10178246 3300031852 Bacteria 1607
99 Ga0307409_100150425 3300031995 Bacteria 2020
100 Ga0307416_100086377 3300032002 Bacteria 2674
101 Ga0307411_10830482 3300032005 Unclassified 816
102 Ga0307415_100040832 3300032126 Bacteria 3077
103 Ga0307415_100540750 3300032126 Bacteria 1026
104 Ga0316574_0339536 3300035398 Bacteria 952
105 Ga0316582_0097220 3300036647 Bacteria 1945
106 Ga0316582_0141535 3300036647 Bacteria 1622
107 Ga0316584_0031634 3300036712 Bacteria 3913
108 Ga0316581_0090151 3300037588 Unclassified 944
109 Ga0400489_42137 3300039093 Bacteria 4046
110 Ga0451577_0003960 3300042876 Bacteria 15976
111 Ga0451577_0010457 3300042876 Bacteria 8866
112 Ga0451577_0030948 3300042876 Unclassified 4832
113 Ga0451577_0079777 3300042876 Bacteria 2918
114 Ga0451577_0169935 3300042876 Unclassified 1964
115 Ga0451577_0265702 3300042876 Bacteria 1553
116 Ga0451577_0327644 3300042876 Bacteria 1389
117 Ga0451577_0543136 3300042876 Bacteria 1055
118 Ga0451577_0957097 3300042876 Bacteria 770
119 Ga0453683_0004454 3300044673 Bacteria 9933
120 Ga0453683_0024260 3300044673 Bacteria 3860
121 Ga0453683_0155538 3300044673 Bacteria 1445
122 Ga0453683_0462987 3300044673 Bacteria 821
123 Ga0453684_0000003 3300044712 Bacteria 1481694
124 Ga0453684_0000044 3300044712 Bacteria 585643
125 Ga0453684_0000415 3300044712 Bacteria 174067
126 Ga0453684_0000430 3300044712 Bacteria 171415
127 Ga0453684_0005462 3300044712 Bacteria 25166
128 Ga0453684_0007294 3300044712 Bacteria 20459
129 Ga0453684_0010082 3300044712 Bacteria 16235
130 Ga0453684_0010741 3300044712 Bacteria 15555
131 Ga0453684_0017427 3300044712 Bacteria 11127
132 Ga0453684_0030986 3300044712 Bacteria 7536
133 Ga0453684_0044768 3300044712 Bacteria 5915
134 Ga0453684_0055145 3300044712 Bacteria 5169
135 Ga0453684_0075321 3300044712 Bacteria 4243
136 Ga0453684_0110568 3300044712 Bacteria 3339
137 Ga0453684_0113416 3300044712 Bacteria 3288
138 Ga0453684_0119346 3300044712 Bacteria 3187
139 Ga0453684_0164723 3300044712 Bacteria 2618
140 Ga0453684_0215189 3300044712 Bacteria 2230
141 Ga0453684_0384231 3300044712 Bacteria 1576
142 Ga0453684_0450751 3300044712 Bacteria 1432
143 Ga0453684_0477088 3300044712 Bacteria 1384
144 Ga0453684_0749601 3300044712 Unclassified 1057
145 Ga0453684_0790019 3300044712 Unclassified 1024
146 Ga0453684_0942583 3300044712 Unclassified 922
147 Ga0453684_1076119 3300044712 Unclassified 851
148 Ga0453684_1328933 3300044712 Bacteria 749
149 Ga0451576_0004702 3300045051 Bacteria 17561
150 Ga0451576_0040313 3300045051 Bacteria 4944
151 Ga0451576_0060492 3300045051 Unclassified 3951
152 Ga0451576_0082935 3300045051 Bacteria 3335
153 Ga0451576_0107241 3300045051 Unclassified 2906
154 Ga0451576_0190431 3300045051 Unclassified 2142
155 Ga0451576_0222130 3300045051 Bacteria 1972
156 Ga0451576_0418287 3300045051 Unclassified 1406
157 Ga0501031_0418153 3300049568 Unclassified 867
158 Ga0501071_0290200 3300049587 Bacteria 1239
159 Ga0501072_0282285 3300049588 Bacteria 1321
160 Ga0501075_0043505 3300049591 Bacteria 3368
161 Ga0501076_0040231 3300049592 Bacteria 3673
162 Ga0501079_0091341 3300049741 Bacteria 2359
163 Ga0501079_0111916 3300049741 Bacteria 2122
164 Ga0501080_0045517 3300049742 Bacteria 4085
165 nmdc:mga05p37_108156_c1 3300050507 Unclassified 3421
166 nmdc:mga05p37_108613_c1 3300050507 Bacteria 3413
167 nmdc:mga05p37_241829_c1 3300050507 Bacteria 2170
168 nmdc:mga05p37_364495_c1 3300050507 Bacteria 1698
169 nmdc:mga05p37_542245_c1 3300050507 Bacteria 1326
170 nmdc:mga05p37_6775_c1 3300050507 Bacteria 13503
171 nmdc:mga05p37_69163_c1 3300050507 Bacteria 4343
172 nmdc:mga09592_130701_c1 3300050508 Unclassified 2160
173 nmdc:mga09592_144893_c1 3300050508 Bacteria 2048
174 nmdc:mga09592_149244_c1 3300050508 Unclassified 2016
175 nmdc:mga09592_17976_c1 3300050508 Bacteria 5794
176 nmdc:mga09592_18296_c2 3300050508 Bacteria 3712
177 nmdc:mga09592_232275_c1 3300050508 Unclassified 1598
178 nmdc:mga09592_52551_c1 3300050508 Bacteria 3439
179 nmdc:mga0qj67_163396_c1 3300050509 Archaea 1807
180 nmdc:mga0qj67_82536_c1 3300050509 Bacteria 2577
181 nmdc:mga06r32_808220_c1 3300050510 Archaea 898
182 nmdc:mga06r32_88379_c1 3300050510 Archaea 3025
183 nmdc:mga08y16_212089_c1 3300050511 Bacteria 2005
184 nmdc:mga08y16_712539_c1 3300050511 Bacteria 1002
185 nmdc:mga0n895_129472_c1 3300050512 Bacteria 2548
186 nmdc:mga0n895_211949_c1 3300050512 Unclassified 1967
187 nmdc:mga0a205_31346_c1 3300050515 Bacteria 5094
188 nmdc:mga0a205_494867_c1 3300050515 Bacteria 1080
189 Ga0501084_0486806 3300054114 Bacteria 1043
190 Ga0501082_0378442 3300060353 Bacteria 1235
191 Ga0501082_0661741 3300060353 Bacteria 914
192 Ga0265320_10065200
193 SwRhRL2b_contig_3729193
194 JGI25406J46586_10010267
195 Ga0065704_10000566
196 Ga0065704_10371875
197 Ga0065707_10082660
198 Ga0065707_10083881
199 Ga0065707_10177891
200 Ga0070689_100258486
201 Ga0070705_100106384
202 Ga0070705_100359433
203 Ga0070700_100038011
204 Ga0070694_100058948
205 Ga0070706_100287965
206 Ga0070707_100888000
207 Ga0070698_100097389
208 Ga0070698_100710332
209 Ga0070699_100152682
210 Ga0070699_100276798
211 Ga0070699_100657958
212 Ga0070699_100666120
213 Ga0070699_100764789
214 Ga0070697_100157126
215 Ga0070697_100236338
216 Ga0070697_100779033
217 Ga0070695_100028268
218 Ga0070695_100180889
219 Ga0070696_100118621
220 Ga0070696_100201835
221 Ga0070704_100021038
222 Ga0070704_100272282
223 Ga0070704_100441270
224 Ga0070704_101031652
225 Ga0068857_100049592
226 Ga0068857_100203035
227 Ga0068859_100041320
228 Ga0068859_100190809
229 Ga0068870_10109452
230 Ga0068862_100031716
231 Ga0068862_100415322
232 Ga0081539_10006020
233 Ga0075427_10001233
234 Ga0075428_100056888
235 Ga0075428_100387874
236 Ga0075430_100057689
237 Ga0075431_100037168
238 Ga0075431_100152227
239 Ga0075434_100417924
240 Ga0075429_100024929
241 Ga0075429_100025143
242 Ga0075429_100203932
243 Ga0075429_100281134
244 Ga0075429_100299647
245 Ga0075429_100321629
246 Ga0097620_100041320
247 Ga0097620_100190800
248 Ga0111539_10772140
249 Ga0114129_10009582
250 Ga0114129_10032841
251 Ga0114129_10125125
252 Ga0114129_10144754
253 Ga0114129_10156014
254 Ga0114129_10568405
255 Ga0105243_10099011
256 Ga0105243_10148087
257 Ga0105243_10148490
258 Ga0105241_10767635
259 Ga0105242_10387929
260 Ga0105249_10119333
261 Ga0105249_10568672
262 Ga0157380_10108143
263 Ga0207653_10165299
264 Ga0207643_10101049
265 Ga0207684_10531500
266 Ga0207646_10158174
267 Ga0207646_10628452
268 Ga0207709_10061423
269 Ga0207709_10081025
270 Ga0207712_10428929
271 Ga0207708_10042200
272 Ga0207676_10324879
273 Ga0207676_11206097
274 Ga0207674_10303193
275 Ga0207674_10305065
276 Ga0207675_100175452
277 Ga0268265_11260241
278 Ga0265318_10027832
279 Ga0265323_10045831
280 Ga0265340_10064329
281 Ga0265327_10013384
282 Ga0316575_10058071
283 Ga0316575_10100266
284 Ga0316578_10281895
285 Ga0316578_10350092
286 Ga0307405_10089992
287 Ga0307413_10139752
288 Ga0307413_10376528
289 Ga0307410_10178246
290 Ga0307409_100150425
291 Ga0307416_100086377
292 Ga0307411_10830482
293 Ga0307415_100040832
294 Ga0307415_100540750
295 Ga0316574_0339536
296 Ga0316582_0097220
297 Ga0316582_0141535
298 Ga0316584_0031634
299 Ga0316581_0090151
300 Ga0400489_42137
301 Ga0451577_0003960
302 Ga0451577_0010457
303 Ga0451577_0030948
304 Ga0451577_0079777
305 Ga0451577_0169935
306 Ga0451577_0265702
307 Ga0451577_0327644
308 Ga0451577_0543136
309 Ga0451577_0957097
310 Ga0453683_0004454
311 Ga0453683_0024260
312 Ga0453683_0155538
313 Ga0453683_0462987
314 Ga0453684_0000003
315 Ga0453684_0000044
316 Ga0453684_0000415
317 Ga0453684_0000430
318 Ga0453684_0005462
319 Ga0453684_0007294
320 Ga0453684_0010082
321 Ga0453684_0010741
322 Ga0453684_0017427
323 Ga0453684_0030986
324 Ga0453684_0044768
325 Ga0453684_0055145
326 Ga0453684_0075321
327 Ga0453684_0110568
328 Ga0453684_0113416
329 Ga0453684_0119346
330 Ga0453684_0164723
331 Ga0453684_0215189
332 Ga0453684_0384231
333 Ga0453684_0450751
334 Ga0453684_0477088
335 Ga0453684_0749601
336 Ga0453684_0790019
337 Ga0453684_0942583
338 Ga0453684_1076119
339 Ga0453684_1328933
340 Ga0451576_0004702
341 Ga0451576_0040313
342 Ga0451576_0060492
343 Ga0451576_0082935
344 Ga0451576_0107241
345 Ga0451576_0190431
346 Ga0451576_0222130
347 Ga0451576_0418287
348 Ga0501031_0418153
349 Ga0501071_0290200
350 Ga0501072_0282285
351 Ga0501075_0043505
352 Ga0501076_0040231
353 Ga0501079_0091341
354 Ga0501079_0111916
355 Ga0501080_0045517
356 nmdc:mga05p37_108156_c1
357 nmdc:mga05p37_108613_c1
358 nmdc:mga05p37_241829_c1
359 nmdc:mga05p37_364495_c1
360 nmdc:mga05p37_542245_c1
361 nmdc:mga05p37_6775_c1
362 nmdc:mga05p37_69163_c1
363 nmdc:mga09592_130701_c1
364 nmdc:mga09592_144893_c1
365 nmdc:mga09592_149244_c1
366 nmdc:mga09592_17976_c1
367 nmdc:mga09592_18296_c2
368 nmdc:mga09592_232275_c1
369 nmdc:mga09592_52551_c1
370 nmdc:mga0qj67_163396_c1
371 nmdc:mga0qj67_82536_c1
372 nmdc:mga06r32_808220_c1
373 nmdc:mga06r32_88379_c1
374 nmdc:mga08y16_212089_c1
375 nmdc:mga08y16_712539_c1
376 nmdc:mga0n895_129472_c1
377 nmdc:mga0n895_211949_c1
378 nmdc:mga0a205_31346_c1
379 nmdc:mga0a205_494867_c1
380 Ga0501084_0486806
381 Ga0501082_0378442
382 Ga0501082_0661741

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map