F294783

General Info

Members Datasets Scaffolds Average Seq Length
191 142 382 788

Family's Representative Sequence

Representative Sequence 3300053093|Ga0500651_0000297|Ga0500651_0000297_25282_27876
Length 846
Sequence LPSRSALPVFATTGLRLAALILPDSPQHARKWRSTDFRRMAKPRSTVMLRNFRPPENLPMPRFALAALIALFCLPSAPAHAITLEQSMADPDWIGPAVETPYWSADGKTIYYKLKRNGSTIRDLHRIDPNGGNDVVVDPAAMAKADGSGIVYDRTRQRAAFARNGDIFIRDIATGRLTQVTRTPQQETAPQFSADGRALQYRSDNDWFVHDIASGVAGPAAIVKTEKDPEAKKPDDLGELQLRLFSTLRTIKADRDTKKENDTNYQKGDPTRTPVPFFLGDDVKIESSALSPDGRHLLIVTSPKGYDEGRVAKLQRYVTESGYEESEDERVRVGRNLPPPNTLWLLDLAGHTQGKIGITDLPGIKDDPLKKIRDENLAAKPASDTETPADRALTVQGIEWTRDGSQVAVQLRANDNKDRWIATVDFGGNKLINQHRLTDPAWINWNFNEFGWTDDNRTLWYLSEESGYSHLYTKLPGGKAKALTAGTFEVSDPALSPDGAWFYLRTNAEAPYSYDVYRVATNGGALNRLTHVKGMDSFALSPDGRQLAVLQSSPYVPSQLAVHPTEGGPAHTLTDTRTTEFKALSWPELEIVGVPSTHTKQPIWSKLYKPADFDASKKYPAVLFVHGAGYLQNTELGYPNYFREQMFHNLLTSQGYIVLDMDYRASAGYGRDWRTAIYRQMGHPELEDLIDGVSWLAANHAVDSKRVGIYGGSYGGFMSLMAMFRAPDMFAAGAALRPVTDWTSYNHGYTSNILNTPQDDAIAYARSSPIEFADGLKGGLLIAHGMIDDNVLFQDSVRLYQRLIELRKDDFELAGYPLERHGFVHSDSWYDEYKRIYKLFEKHLKP

Samples

Sample ID Description Type Environment
1 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
2 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
3 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
32 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
49 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
50 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
82 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
83 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
86 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
87 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
88 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
89 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
90 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
91 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
92 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
93 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
94 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
95 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
96 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
97 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
98 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
99 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
100 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
101 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
102 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
103 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
116 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
117 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
118 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
119 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
123 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
124 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
125 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
126 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
127 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
128 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
129 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
130 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
131 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
132 2919513703 Luteimonas sp. 3794 Isolate Unclassified
133 2919675420 Luteimonas terrae 4099 Isolate Unclassified
134 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
135 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
136 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
137 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
138 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
139 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
140 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
141 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
142 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.15
Metatranscriptomes 0
Isolates 7.85

Biome Distribution

Category Percentage (%)
Aerial Root 0.52
Bulb 0
Endosphere 18.85
Nodule 0
Rhizoplane 2.09
Rhizosphere 63.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500651_0000297 3300053093 Bacteria 28799
2 Ga0055526_1000003 3300003771 Bacteria 413092
3 Ga0055526_1001392 3300003771 Bacteria 17174
4 Ga0055537_1000287 3300003773 Bacteria 35894
5 Ga0055537_1000362 3300003773 Bacteria 30880
6 Ga0055524_1000002 3300003775 Bacteria 459550
7 Ga0055534_1000050 3300003784 Bacteria 92561
8 Ga0055534_1000637 3300003784 Bacteria 17887
9 Ga0055528_1000001 3300003790 Bacteria 402384
10 Ga0055528_1000406 3300003790 Bacteria 34907
11 Ga0055543_1007665 3300004625 Bacteria 2469
12 Ga0065165_1000035 3300005262 Bacteria 214086
13 Ga0065704_10079041 3300005289 Bacteria 4269
14 Ga0070661_100002051 3300005344 Bacteria 13889
15 Ga0070669_100000007 3300005353 Bacteria 233709
16 Ga0070667_100000235 3300005367 Bacteria 63272
17 Ga0070709_10000025 3300005434 Bacteria 129264
18 Ga0070711_100033815 3300005439 Bacteria 3406
19 Ga0070663_100000261 3300005455 Bacteria 26441
20 Ga0070685_10000745 3300005466 Bacteria 17722
21 Ga0068853_100059907 3300005539 Bacteria 3289
22 Ga0070665_100000280 3300005548 Bacteria 83526
23 Ga0070665_100001350 3300005548 Bacteria 29089
24 Ga0070665_100002183 3300005548 Bacteria 21810
25 Ga0068855_100041539 3300005563 Bacteria 5450
26 Ga0068855_100070000 3300005563 Bacteria 4082
27 Ga0068857_100010770 3300005577 Bacteria 7959
28 Ga0068856_100042217 3300005614 Bacteria 4486
29 Ga0068852_100017375 3300005616 Bacteria 5643
30 Ga0068859_100000400 3300005617 Bacteria 43086
31 Ga0068862_100000530 3300005844 Bacteria 40027
32 Ga0081540_1004438 3300005983 Bacteria 10699
33 Ga0075364_10000696 3300006051 Bacteria 17579
34 Ga0097621_100053378 3300006237 Bacteria 3295
35 Ga0068871_100007883 3300006358 Bacteria 7636
36 Ga0075428_100029794 3300006844 Bacteria 6037
37 Ga0097620_100000400 3300006931 Bacteria 43086
38 Ga0099795_10003363 3300007788 Bacteria 3947
39 Ga0105244_10015693 3300009036 Bacteria 4336
40 Ga0105240_10002634 3300009093 Bacteria 28597
41 Ga0105240_10088674 3300009093 Bacteria 3785
42 Ga0111539_10074945 3300009094 Bacteria 3987
43 Ga0105248_10000167 3300009177 Bacteria 76591
44 Ga0105237_10024062 3300009545 Bacteria 6231
45 Ga0105238_10001780 3300009551 Bacteria 21560
46 Ga0105249_10000271 3300009553 Bacteria 54577
47 Ga0105249_10052838 3300009553 Bacteria 3712
48 Ga0105239_10003787 3300010375 Bacteria 18410
49 Ga0105239_10004853 3300010375 Bacteria 15912
50 Ga0105239_10008744 3300010375 Bacteria 11467
51 Ga0157371_10000158 3300013102 Bacteria 99529
52 Ga0157369_10061813 3300013105 Bacteria 4037
53 Ga0157378_10011368 3300013297 Bacteria 7792
54 Ga0157372_10001239 3300013307 Bacteria 27601
55 Ga0157372_10002917 3300013307 Bacteria 18491
56 Ga0163163_10000779 3300014325 Bacteria 27070
57 Ga0163163_10096881 3300014325 Bacteria 2971
58 Ga0182008_10000360 3300014497 Bacteria 35424
59 Ga0157376_10001576 3300014969 Bacteria 15074
60 Ga0182007_10000019 3300015262 Bacteria 194770
61 Ga0182005_1000088 3300015265 Bacteria 69427
62 Ga0209233_1001016 3300025261 Bacteria 11970
63 Ga0209565_1000002 3300025263 Bacteria 1423083
64 Ga0209565_1000113 3300025263 Bacteria 116343
65 Ga0209673_1000002 3300025273 Bacteria 1423083
66 Ga0209673_1000581 3300025273 Bacteria 57816
67 Ga0209675_1000002 3300025291 Bacteria 1423083
68 Ga0209675_1000007 3300025291 Bacteria 683430
69 Ga0209676_1000018 3300025292 Bacteria 631385
70 Ga0209676_1001924 3300025292 Bacteria 16781
71 Ga0209564_1000004 3300025295 Bacteria 1424639
72 Ga0209564_1000770 3300025295 Bacteria 44617
73 Ga0209050_1000109 3300025298 Bacteria 219706
74 Ga0209050_1000448 3300025298 Bacteria 74673
75 Ga0209256_1000004 3300025299 Bacteria 1424643
76 Ga0209051_1000449 3300025303 Bacteria 54625
77 Ga0209257_1000035 3300025304 Bacteria 631463
78 Ga0209257_1000474 3300025304 Bacteria 73194
79 Ga0209257_1001532 3300025304 Bacteria 26952
80 Ga0207655_1019773 3300025728 Bacteria 3499
81 Ga0207647_10001062 3300025904 Bacteria 21133
82 Ga0207647_10001826 3300025904 Bacteria 16328
83 Ga0207699_10000036 3300025906 Bacteria 129236
84 Ga0207707_10012546 3300025912 Bacteria 7366
85 Ga0207695_10000014 3300025913 Bacteria 812599
86 Ga0207695_10015109 3300025913 Bacteria 9109
87 Ga0207671_10006225 3300025914 Bacteria 10701
88 Ga0207671_10007565 3300025914 Bacteria 9407
89 Ga0207663_10021671 3300025916 Bacteria 3662
90 Ga0207649_10002034 3300025920 Bacteria 11509
91 Ga0207681_10000017 3300025923 Bacteria 294161
92 Ga0207694_10000946 3300025924 Bacteria 25601
93 Ga0207694_10018367 3300025924 Bacteria 5286
94 Ga0207706_10024233 3300025933 Bacteria 5440
95 Ga0207691_10057209 3300025940 Bacteria 3550
96 Ga0207691_10078927 3300025940 Bacteria 2963
97 Ga0207711_10002426 3300025941 Bacteria 16640
98 Ga0207712_10000301 3300025961 Bacteria 46175
99 Ga0207712_10002499 3300025961 Bacteria 11830
100 Ga0207658_10000665 3300025986 Bacteria 30020
101 Ga0207678_10000958 3300026067 Bacteria 26386
102 Ga0207678_10012590 3300026067 Bacteria 7432
103 Ga0207702_10011178 3300026078 Bacteria 7487
104 Ga0207674_10008694 3300026116 Bacteria 11690
105 Ga0207698_10013529 3300026142 Bacteria 5387
106 Ga0268266_10000008 3300028379 Bacteria 1161875
107 Ga0268266_10000017 3300028379 Bacteria 607272
108 Ga0268266_10001127 3300028379 Bacteria 33304
109 Ga0268266_10005416 3300028379 Bacteria 11905
110 Ga0268265_10000150 3300028380 Bacteria 86326
111 Ga0268265_10004238 3300028380 Bacteria 10010
112 Ga0307413_10037676 3300031824 Bacteria 2795
113 Ga0451793_1586308 3300041452 Bacteria 4841
114 Ga0451843_0110991 3300041509 Bacteria 3607
115 Ga0451577_0048737 3300042876 Bacteria 3783
116 Ga0453684_0000330 3300044712 Bacteria 198124
117 Ga0495638_0003743 3300046460 Bacteria 11835
118 Ga0495663_0005445 3300046525 Bacteria 3530
119 Ga0495672_0000069 3300047320 Bacteria 189627
120 Ga0495686_0004347 3300047472 Bacteria 11705
121 Ga0496105_0011931 3300048908 Bacteria 6880
122 Ga0496114_0004901 3300048917 Bacteria 10426
123 Ga0496115_0000002 3300048918 Bacteria 365286
124 Ga0496116_0012417 3300048919 Bacteria 6960
125 Ga0496117_0001903 3300048920 Bacteria 27999
126 Ga0496117_0019229 3300048920 Bacteria 5618
127 Ga0496118_0000274 3300048921 Bacteria 90649
128 Ga0496119_0000787 3300048922 Bacteria 42365
129 Ga0496120_0000776 3300048923 Bacteria 46146
130 Ga0496121_0019137 3300048924 Bacteria 6864
131 Ga0496122_0000079 3300048925 Bacteria 212416
132 Ga0496122_0000136 3300048925 Bacteria 170671
133 Ga0496123_0000073 3300048926 Bacteria 198307
134 Ga0496123_0005874 3300048926 Bacteria 12151
135 Ga0496123_0009582 3300048926 Bacteria 8698
136 Ga0496124_0000486 3300048927 Bacteria 68189
137 Ga0496124_0002068 3300048927 Bacteria 27193
138 Ga0496125_0000486 3300048928 Bacteria 69727
139 Ga0496125_0004219 3300048928 Bacteria 16745
140 Ga0496126_0000052 3300048929 Bacteria 312383
141 Ga0496126_0001695 3300048929 Bacteria 32750
142 Ga0496126_0039172 3300048929 Bacteria 4401
143 Ga0501031_0004623 3300049568 Bacteria 8931
144 Ga0501031_0022958 3300049568 Bacteria 4069
145 Ga0501032_0000758 3300049569 Bacteria 26217
146 Ga0501033_0000455 3300049570 Bacteria 38949
147 Ga0501033_0021358 3300049570 Bacteria 4883
148 Ga0501034_0016596 3300049571 Bacteria 7550
149 Ga0501036_0007257 3300049572 Bacteria 9025
150 Ga0501037_0011958 3300049573 Bacteria 6394
151 Ga0501038_0001474 3300049574 Bacteria 21647
152 Ga0501039_0018296 3300049575 Bacteria 5377
153 Ga0501043_0051320 3300049579 Bacteria 3240
154 Ga0501043_0069912 3300049579 Bacteria 2757
155 Ga0501046_0011341 3300049580 Bacteria 7627
156 Ga0501046_0056362 3300049580 Bacteria 3085
157 Ga0501047_0003431 3300049581 Bacteria 14984
158 Ga0501047_0073769 3300049581 Bacteria 3285
159 Ga0501048_0018701 3300049582 Bacteria 5093
160 Ga0501070_0067099 3300049586 Bacteria 2971
161 Ga0501073_0005816 3300049589 Bacteria 9214
162 Ga0501079_0050812 3300049741 Bacteria 3199
163 Ga0501080_0006055 3300049742 Bacteria 10843
164 Ga0501080_0034615 3300049742 Bacteria 4716
165 Ga0501083_0003777 3300049744 Bacteria 10631
166 Ga0501035_0036942 3300049822 Bacteria 4425
167 Ga0501044_0002246 3300049823 Bacteria 22070
168 Ga0501044_0045807 3300049823 Bacteria 4530
169 Ga0501044_0075878 3300049823 Bacteria 3413
170 nmdc:mga00v17_35217_c1 3300050491 Bacteria 2978
171 nmdc:mga00v17_67_c2 3300050491 Bacteria 34972
172 nmdc:mga0n895_2021_c1 3300050512 Bacteria 15600
173 Ga0500610_0000284 3300053079 Bacteria 15301
174 Ga0500643_000450 3300053087 Bacteria 30395
175 Ga0500568_0002707 3300053139 Bacteria 10279
176 Ga0501082_0000983 3300060353 Bacteria 25153
177 2578456439 2576861471 Bacteria 4648976
178 2842761267 2842757796 Bacteria 3981385
179 2852651684 2852649853 Bacteria 4036942
180 2857444577 2857442823 Bacteria 4562550
181 2919514385 2919513703 Bacteria 3844312
182 2919677669 2919675420 Bacteria 3969095
183 2939590321 2939589442 Bacteria 4214238
184 2939626600 2939622612 Bacteria 4698046
185 2941479535 2941475908 Bacteria 4145589
186 2941493127 2941489479 Bacteria 6313767
187 2974307097 2974307012 Bacteria 4172388
188 2977247842 2977247770 Bacteria 4160543
189 2984517702 2984514374 Bacteria 4172479
190 2987606887 2987605356 Bacteria 4187822
191 2995949214 2995948881 Bacteria 6358104
192 Ga0500651_0000297
193 Ga0055526_1000003
194 Ga0055526_1001392
195 Ga0055537_1000287
196 Ga0055537_1000362
197 Ga0055524_1000002
198 Ga0055534_1000050
199 Ga0055534_1000637
200 Ga0055528_1000001
201 Ga0055528_1000406
202 Ga0055543_1007665
203 Ga0065165_1000035
204 Ga0065704_10079041
205 Ga0070661_100002051
206 Ga0070669_100000007
207 Ga0070667_100000235
208 Ga0070709_10000025
209 Ga0070711_100033815
210 Ga0070663_100000261
211 Ga0070685_10000745
212 Ga0068853_100059907
213 Ga0070665_100000280
214 Ga0070665_100001350
215 Ga0070665_100002183
216 Ga0068855_100041539
217 Ga0068855_100070000
218 Ga0068857_100010770
219 Ga0068856_100042217
220 Ga0068852_100017375
221 Ga0068859_100000400
222 Ga0068862_100000530
223 Ga0081540_1004438
224 Ga0075364_10000696
225 Ga0097621_100053378
226 Ga0068871_100007883
227 Ga0075428_100029794
228 Ga0097620_100000400
229 Ga0099795_10003363
230 Ga0105244_10015693
231 Ga0105240_10002634
232 Ga0105240_10088674
233 Ga0111539_10074945
234 Ga0105248_10000167
235 Ga0105237_10024062
236 Ga0105238_10001780
237 Ga0105249_10000271
238 Ga0105249_10052838
239 Ga0105239_10003787
240 Ga0105239_10004853
241 Ga0105239_10008744
242 Ga0157371_10000158
243 Ga0157369_10061813
244 Ga0157378_10011368
245 Ga0157372_10001239
246 Ga0157372_10002917
247 Ga0163163_10000779
248 Ga0163163_10096881
249 Ga0182008_10000360
250 Ga0157376_10001576
251 Ga0182007_10000019
252 Ga0182005_1000088
253 Ga0209233_1001016
254 Ga0209565_1000002
255 Ga0209565_1000113
256 Ga0209673_1000002
257 Ga0209673_1000581
258 Ga0209675_1000002
259 Ga0209675_1000007
260 Ga0209676_1000018
261 Ga0209676_1001924
262 Ga0209564_1000004
263 Ga0209564_1000770
264 Ga0209050_1000109
265 Ga0209050_1000448
266 Ga0209256_1000004
267 Ga0209051_1000449
268 Ga0209257_1000035
269 Ga0209257_1000474
270 Ga0209257_1001532
271 Ga0207655_1019773
272 Ga0207647_10001062
273 Ga0207647_10001826
274 Ga0207699_10000036
275 Ga0207707_10012546
276 Ga0207695_10000014
277 Ga0207695_10015109
278 Ga0207671_10006225
279 Ga0207671_10007565
280 Ga0207663_10021671
281 Ga0207649_10002034
282 Ga0207681_10000017
283 Ga0207694_10000946
284 Ga0207694_10018367
285 Ga0207706_10024233
286 Ga0207691_10057209
287 Ga0207691_10078927
288 Ga0207711_10002426
289 Ga0207712_10000301
290 Ga0207712_10002499
291 Ga0207658_10000665
292 Ga0207678_10000958
293 Ga0207678_10012590
294 Ga0207702_10011178
295 Ga0207674_10008694
296 Ga0207698_10013529
297 Ga0268266_10000008
298 Ga0268266_10000017
299 Ga0268266_10001127
300 Ga0268266_10005416
301 Ga0268265_10000150
302 Ga0268265_10004238
303 Ga0307413_10037676
304 Ga0451793_1586308
305 Ga0451843_0110991
306 Ga0451577_0048737
307 Ga0453684_0000330
308 Ga0495638_0003743
309 Ga0495663_0005445
310 Ga0495672_0000069
311 Ga0495686_0004347
312 Ga0496105_0011931
313 Ga0496114_0004901
314 Ga0496115_0000002
315 Ga0496116_0012417
316 Ga0496117_0001903
317 Ga0496117_0019229
318 Ga0496118_0000274
319 Ga0496119_0000787
320 Ga0496120_0000776
321 Ga0496121_0019137
322 Ga0496122_0000079
323 Ga0496122_0000136
324 Ga0496123_0000073
325 Ga0496123_0005874
326 Ga0496123_0009582
327 Ga0496124_0000486
328 Ga0496124_0002068
329 Ga0496125_0000486
330 Ga0496125_0004219
331 Ga0496126_0000052
332 Ga0496126_0001695
333 Ga0496126_0039172
334 Ga0501031_0004623
335 Ga0501031_0022958
336 Ga0501032_0000758
337 Ga0501033_0000455
338 Ga0501033_0021358
339 Ga0501034_0016596
340 Ga0501036_0007257
341 Ga0501037_0011958
342 Ga0501038_0001474
343 Ga0501039_0018296
344 Ga0501043_0051320
345 Ga0501043_0069912
346 Ga0501046_0011341
347 Ga0501046_0056362
348 Ga0501047_0003431
349 Ga0501047_0073769
350 Ga0501048_0018701
351 Ga0501070_0067099
352 Ga0501073_0005816
353 Ga0501079_0050812
354 Ga0501080_0006055
355 Ga0501080_0034615
356 Ga0501083_0003777
357 Ga0501035_0036942
358 Ga0501044_0002246
359 Ga0501044_0045807
360 Ga0501044_0075878
361 nmdc:mga00v17_35217_c1
362 nmdc:mga00v17_67_c2
363 nmdc:mga0n895_2021_c1
364 Ga0500610_0000284
365 Ga0500643_000450
366 Ga0500568_0002707
367 Ga0501082_0000983
368 2578456439
369 2842761267
370 2852651684
371 2857444577
372 2919514385
373 2919677669
374 2939590321
375 2939626600
376 2941479535
377 2941493127
378 2974307097
379 2977247842
380 2984517702
381 2987606887
382 2995949214

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00326

Peptidase_S9

Prolyl oligopeptidase family

641

846

0.96

PF00930

DPPIV_N

Dipeptidyl peptidase IV (DPP IV) N-terminal region

374

558

0.87

PF01738

DLH

Dienelactone hydrolase family

613

840

0.84

PF02129

Peptidase_S15

X-Pro dipeptidyl-peptidase (S15 family)

601

752

0.82

PF07676

PD40

WD40-like Beta Propeller Repeat

96

120

0.81

PF20434

BD-FAE

BD-FAE

606

803

0.78

PF00756

Esterase

Putative esterase

596

770

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wyd-assembly1.cif.gz_B c-terminal esterase domain of lc-est1 0.819 538 779
3wyd-assembly1.cif.gz_B c-terminal esterase domain of lc-est1 0.811 538 779
5yp1-assembly1.cif.gz_A crystal structure of dipeptidyl peptidase iv (dpp iv) from pseudoxanthomonas mexicana wo24 0.801 28 779
3f67-assembly1.cif.gz_A crystal structure of putative dienelactone hydrolase from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.799 522 775
5yp1-assembly1.cif.gz_A crystal structure of dipeptidyl peptidase iv (dpp iv) from pseudoxanthomonas mexicana wo24 0.7978 28 779
ID Description Score Start End Superfamily
2ecfA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9318 519 779 3.40.50.1820
af_M0R781_602_862_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9264 519 777 3.40.50.1820
5oljA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9252 519 777 3.40.50.1820
5oljA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9217 519 777 3.40.50.1820
2ecfA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9216 519 779 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A4Q5TAN6-F1-model_v4 S9 family peptidase 0.9982 642 779 GO:0006508
GO:0008236
GO:0008239
AF-A0A4Q5TAN6-F1-model_v4 S9 family peptidase 0.991 642 779 GO:0006508
GO:0008236
GO:0008239
AF-A0A0S7WFV5-F1-model_v4 Peptidase S9 prolyl oligopeptidase catalytic domain-containing protein 0.9845 604 777 GO:0006508
GO:0008236
GO:0008239
AF-A0A5C7SM28-F1-model_v4 S9 family peptidase 0.9795 677 779 GO:0006508
GO:0008236
GO:0008239
AF-A0A0S7WFV5-F1-model_v4 Peptidase S9 prolyl oligopeptidase catalytic domain-containing protein 0.9734 604 777 GO:0006508
GO:0008236
GO:0008239

Map