F294995

General Info

Members Datasets Scaffolds Average Seq Length
192 134 384 302

Family's Representative Sequence

Representative Sequence 3300004799|Ga0058863_11958163|Ga0058863_119581632
Length 326
Sequence MDIGFMGLGRMGENMVRRLLRGGHRVVAWNRSKGKIDEVAKEGAVAAYTPADLVKELQPRRVIWLMVPAGQPVDDLIAELLPMLDKGDILIDGGNSNFRDSQRRHADLTAKGFEFLDIGTSGGIWGLEVGYCMMIGGSDDAFNYIEPLLKTLAPEDGYMHTGPSGSGHFTKMVHNGIEYGMLQAYGEGFEIIKASEFPVDLAALSEVWQHGSVVRSWLLDLAVRAFRKEGDLRSIRGYVEDSGEGRWTVQEAINESVPAPVITASLLARFASRQQESFSAKVVAALRNEFGGHAVQLEGGGSSGVSFSPDAPRSSSVVGGQSGRSK

Samples

Sample ID Description Type Environment
1 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
53 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
60 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
87 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
90 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
91 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
92 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
93 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
94 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
98 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
99 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
102 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
103 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
104 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
107 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
108 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
117 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
122 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
123 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
124 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
127 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
128 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
129 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
130 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
131 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
132 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
133 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
134 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.46
Metatranscriptomes 13.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 6.25
Rhizosphere 89.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_11958163 3300004799 Bacteria 2776
2 Ga0007409J51694_1038204 3300003575 Bacteria 1326
3 Ga0058861_12028731 3300004800 Bacteria 2893
4 Ga0070683_100010482 3300005329 Bacteria 7970
5 Ga0070683_100027287 3300005329 Bacteria 5148
6 Ga0070683_100136968 3300005329 Bacteria 2319
7 Ga0070680_100024226 3300005336 Bacteria 4844
8 Ga0070689_100007905 3300005340 Bacteria 7461
9 Ga0070687_100046899 3300005343 Bacteria 2214
10 Ga0070661_100007097 3300005344 Bacteria 7727
11 Ga0070671_100203748 3300005355 Bacteria 1678
12 Ga0070659_100004418 3300005366 Bacteria 10040
13 Ga0070705_100154394 3300005440 Bacteria 1527
14 Ga0070694_100109923 3300005444 Bacteria 1962
15 Ga0070681_10173380 3300005458 Bacteria 2078
16 Ga0070707_100000339 3300005468 Bacteria 45941
17 Ga0070707_100000785 3300005468 Bacteria 31403
18 Ga0070707_100050399 3300005468 Bacteria 3991
19 Ga0070699_100005134 3300005518 Bacteria 11517
20 Ga0070679_100013036 3300005530 Bacteria 7960
21 Ga0070679_100015675 3300005530 Bacteria 7287
22 Ga0070684_100010808 3300005535 Bacteria 7250
23 Ga0068853_100487431 3300005539 Bacteria 1163
24 Ga0070686_100074530 3300005544 Bacteria 2231
25 Ga0070696_100089787 3300005546 Bacteria 2185
26 Ga0070665_100001754 3300005548 Bacteria 24801
27 Ga0068854_100047271 3300005578 Bacteria 3067
28 Ga0068856_100047215 3300005614 Bacteria 4242
29 Ga0070702_100004305 3300005615 Bacteria 6488
30 Ga0068852_100004589 3300005616 Bacteria 9782
31 Ga0068852_100591768 3300005616 Bacteria 1113
32 Ga0068861_100050079 3300005719 Bacteria 3166
33 Ga0068862_100204925 3300005844 Bacteria 1780
34 Ga0081538_10000018 3300005981 Bacteria 143542
35 Ga0081538_10001538 3300005981 Bacteria 23649
36 Ga0081538_10003867 3300005981 Bacteria 13986
37 Ga0081538_10012898 3300005981 Bacteria 6662
38 Ga0081538_10048435 3300005981 Bacteria 2591
39 Ga0075428_100226008 3300006844 Bacteria 2020
40 Ga0075430_100004368 3300006846 Bacteria 11934
41 Ga0075430_100017971 3300006846 Bacteria 6019
42 Ga0075431_100004499 3300006847 Bacteria 13681
43 Ga0075431_100049245 3300006847 Bacteria 4345
44 Ga0075431_100122188 3300006847 Bacteria 2687
45 Ga0075433_10012771 3300006852 Bacteria 6800
46 Ga0075429_100001873 3300006880 Bacteria 17424
47 Ga0099794_10011521 3300007265 Bacteria 3788
48 Ga0105240_10020034 3300009093 Bacteria 8930
49 Ga0105240_10142213 3300009093 Bacteria 2867
50 Ga0105245_10059530 3300009098 Bacteria 3439
51 Ga0105245_10160965 3300009098 Bacteria 2130
52 Ga0105247_10007482 3300009101 Bacteria 6696
53 Ga0114129_10017402 3300009147 Bacteria 10238
54 Ga0114129_10059036 3300009147 Bacteria 5364
55 Ga0114129_10061070 3300009147 Bacteria 5268
56 Ga0105243_10014763 3300009148 Bacteria 5909
57 Ga0105243_10197988 3300009148 Bacteria 1760
58 Ga0105242_10181471 3300009176 Bacteria 1857
59 Ga0105242_10255315 3300009176 Bacteria 1581
60 Ga0105238_10011336 3300009551 Bacteria 8970
61 Ga0105249_10036978 3300009553 Bacteria 4430
62 Ga0105239_10095034 3300010375 Bacteria 3293
63 Ga0105239_10264917 3300010375 Bacteria 1932
64 Ga0157371_10060881 3300013102 Bacteria 2676
65 Ga0157370_10011471 3300013104 Bacteria 9264
66 Ga0157380_10202161 3300014326 Bacteria 1763
67 Ga0157377_10040352 3300014745 Bacteria 2584
68 Ga0163161_10328342 3300017792 Bacteria 1211
69 Ga0197907_10113464 3300020069 Bacteria 1095
70 Ga0197907_10521842 3300020069 Bacteria 5294
71 Ga0197907_10572569 3300020069 Bacteria 4198
72 Ga0206356_10480245 3300020070 Bacteria 3505
73 Ga0206356_10724003 3300020070 Bacteria 6529
74 Ga0206356_11650618 3300020070 Bacteria 1109
75 Ga0206356_11674891 3300020070 Bacteria 2621
76 Ga0206349_1219320 3300020075 Bacteria 4124
77 Ga0206349_1935542 3300020075 Bacteria 2131
78 Ga0206355_1699483 3300020076 Bacteria 1642
79 Ga0206351_10360226 3300020077 Bacteria 5312
80 Ga0206352_10180454 3300020078 Bacteria 4753
81 Ga0206352_10961087 3300020078 Bacteria 2163
82 Ga0206354_10061159 3300020081 Bacteria 1422
83 Ga0206354_10759076 3300020081 Bacteria 2566
84 Ga0206353_11506495 3300020082 Bacteria 3730
85 Ga0206353_11556968 3300020082 Bacteria 2797
86 Ga0154015_1068568 3300020610 Bacteria 1523
87 Ga0213875_10002110 3300021388 Bacteria 12184
88 Ga0213875_10002429 3300021388 Bacteria 11155
89 Ga0213875_10075325 3300021388 Bacteria 1575
90 Ga0213871_10017199 3300021441 Bacteria 1754
91 Ga0224712_10000915 3300022467 Bacteria 6350
92 Ga0224712_10001120 3300022467 Bacteria 5953
93 Ga0224712_10001478 3300022467 Bacteria 5427
94 Ga0224712_10003175 3300022467 Bacteria 4215
95 Ga0224712_10057364 3300022467 Bacteria 1539
96 Ga0207710_10017616 3300025900 Bacteria 3029
97 Ga0207707_10002921 3300025912 Bacteria 15244
98 Ga0207707_10102893 3300025912 Bacteria 2496
99 Ga0207707_10314756 3300025912 Bacteria 1352
100 Ga0207695_10114556 3300025913 Bacteria 2671
101 Ga0207660_10106503 3300025917 Bacteria 2102
102 Ga0207660_10346231 3300025917 Bacteria 1190
103 Ga0207657_10006564 3300025919 Bacteria 12047
104 Ga0207649_10061146 3300025920 Bacteria 2370
105 Ga0207652_10003116 3300025921 Bacteria 13820
106 Ga0207652_10197427 3300025921 Bacteria 1810
107 Ga0207646_10000624 3300025922 Bacteria 46093
108 Ga0207664_10256889 3300025929 Bacteria 1527
109 Ga0207709_10015718 3300025935 Bacteria 4201
110 Ga0207670_10004850 3300025936 Bacteria 7306
111 Ga0207669_10199232 3300025937 Bacteria 1452
112 Ga0207661_10000761 3300025944 Bacteria 20979
113 Ga0207661_10012983 3300025944 Bacteria 6079
114 Ga0207661_10192658 3300025944 Bacteria 1788
115 Ga0207640_10011895 3300025981 Bacteria 4941
116 Ga0207674_10171547 3300026116 Bacteria 2122
117 Ga0207675_100212386 3300026118 Bacteria 1862
118 Ga0207698_10032099 3300026142 Bacteria 3800
119 Ga0207698_10873293 3300026142 Bacteria 905
120 Ga0209588_1055547 3300027671 Bacteria 1280
121 Ga0209974_10023505 3300027876 Bacteria 2040
122 Ga0268266_10002097 3300028379 Bacteria 22052
123 Ga0316577_10028666 3300031733 Bacteria 3107
124 Ga0307413_10032891 3300031824 Bacteria 2945
125 Ga0307406_10216410 3300031901 Bacteria 1421
126 Ga0307416_100051418 3300032002 Bacteria 3291
127 Ga0307415_100011999 3300032126 Bacteria 4990
128 Ga0373931_0426477 3300035691 Bacteria 844
129 Ga0436364_0587284 3300037853 Bacteria 1772
130 Ga0436364_0881244 3300037853 Bacteria 28600
131 Ga0436364_1069888 3300037853 Bacteria 65342
132 Ga0436365_0014399 3300039437 Bacteria 1893
133 Ga0436365_1447637 3300039437 Bacteria 3615
134 Ga0436362_0388802 3300039453 Bacteria 3386
135 Ga0466972_0008735 3300044658 Bacteria 5081
136 Ga0453683_0186885 3300044673 Bacteria 1314
137 Ga0466965_0002440 3300044683 Bacteria 7901
138 Ga0466965_0083312 3300044683 Bacteria 1619
139 Ga0453684_0033819 3300044712 Bacteria 7113
140 Ga0466968_0000514 3300044735 Bacteria 13170
141 Ga0466960_0006450 3300044901 Bacteria 4707
142 Ga0466967_1158174 3300045976 Bacteria 770
143 Ga0495641_0000048 3300046461 Bacteria 74033
144 Ga0495596_0014771 3300046500 Bacteria 3285
145 Ga0495616_0037990 3300046513 Bacteria 2474
146 Ga0495630_0197729 3300046517 Bacteria 1534
147 Ga0495587_0286486 3300046536 Bacteria 923
148 Ga0495674_0077456 3300047319 Bacteria 2859
149 Ga0495673_0071983 3300047469 Bacteria 1452
150 Ga0495681_0049826 3300047470 Bacteria 1978
151 Ga0495684_0230742 3300047471 Bacteria 1354
152 Ga0495686_0013404 3300047472 Bacteria 5687
153 Ga0495602_0368782 3300048088 Bacteria 1032
154 Ga0496103_0009484 3300048906 Bacteria 5764
155 Ga0496104_0030501 3300048907 Bacteria 5011
156 Ga0496105_0013943 3300048908 Bacteria 6389
157 Ga0496108_0023171 3300048911 Bacteria 5106
158 Ga0496108_0186447 3300048911 Bacteria 1797
159 Ga0496109_0009966 3300048912 Bacteria 8114
160 Ga0496109_0265196 3300048912 Bacteria 1618
161 Ga0496110_0020069 3300048913 Bacteria 5637
162 Ga0496110_0102769 3300048913 Bacteria 2563
163 Ga0496111_0027038 3300048914 Bacteria 4055
164 Ga0496112_0047341 3300048915 Bacteria 4219
165 Ga0496115_0002210 3300048918 Bacteria 13940
166 Ga0501040_0272282 3300049576 Bacteria 1209
167 Ga0501068_0139367 3300049584 Bacteria 1520
168 Ga0501071_0075134 3300049587 Bacteria 2467
169 Ga0501072_0079867 3300049588 Bacteria 2591
170 Ga0501076_0178468 3300049592 Bacteria 1731
171 Ga0501076_0298522 3300049592 Bacteria 1320
172 Ga0501076_0321542 3300049592 Bacteria 1269
173 Ga0501079_0152413 3300049741 Bacteria 1802
174 Ga0501080_0162556 3300049742 Bacteria 2062
175 Ga0501081_0451570 3300049743 Bacteria 955
176 nmdc:mga05p37_1601_c1 3300050507 Bacteria 26274
177 nmdc:mga05p37_24406_c1 3300050507 Bacteria 7347
178 nmdc:mga05p37_36588_c1 3300050507 Bacteria 6021
179 nmdc:mga09592_18840_c1 3300050508 Bacteria 5663
180 nmdc:mga09592_6666_c1 3300050508 Bacteria 9405
181 nmdc:mga0qj67_1286_c1 3300050509 Bacteria 17577
182 nmdc:mga0qj67_170920_c1 3300050509 Bacteria 1765
183 nmdc:mga06r32_124282_c1 3300050510 Bacteria 2547
184 nmdc:mga06r32_171621_c1 3300050510 Bacteria 2153
185 nmdc:mga06r32_40668_c1 3300050510 Bacteria 4415
186 nmdc:mga0a205_39902_c1 3300050515 Bacteria 4519
187 Ga0495601_0020403 3300053077 Bacteria 4048
188 Ga0495601_0020637 3300053077 Bacteria 4025
189 Ga0495595_0098436 3300053084 Bacteria 1410
190 Ga0495619_0299123 3300053085 Bacteria 1115
191 Ga0500616_0002585 3300053153 Bacteria 14880
192 Ga0530510_0000860 3300061734 Bacteria 20009
193 Ga0058863_11958163
194 Ga0007409J51694_1038204
195 Ga0058861_12028731
196 Ga0070683_100010482
197 Ga0070683_100027287
198 Ga0070683_100136968
199 Ga0070680_100024226
200 Ga0070689_100007905
201 Ga0070687_100046899
202 Ga0070661_100007097
203 Ga0070671_100203748
204 Ga0070659_100004418
205 Ga0070705_100154394
206 Ga0070694_100109923
207 Ga0070681_10173380
208 Ga0070707_100000339
209 Ga0070707_100000785
210 Ga0070707_100050399
211 Ga0070699_100005134
212 Ga0070679_100013036
213 Ga0070679_100015675
214 Ga0070684_100010808
215 Ga0068853_100487431
216 Ga0070686_100074530
217 Ga0070696_100089787
218 Ga0070665_100001754
219 Ga0068854_100047271
220 Ga0068856_100047215
221 Ga0070702_100004305
222 Ga0068852_100004589
223 Ga0068852_100591768
224 Ga0068861_100050079
225 Ga0068862_100204925
226 Ga0081538_10000018
227 Ga0081538_10001538
228 Ga0081538_10003867
229 Ga0081538_10012898
230 Ga0081538_10048435
231 Ga0075428_100226008
232 Ga0075430_100004368
233 Ga0075430_100017971
234 Ga0075431_100004499
235 Ga0075431_100049245
236 Ga0075431_100122188
237 Ga0075433_10012771
238 Ga0075429_100001873
239 Ga0099794_10011521
240 Ga0105240_10020034
241 Ga0105240_10142213
242 Ga0105245_10059530
243 Ga0105245_10160965
244 Ga0105247_10007482
245 Ga0114129_10017402
246 Ga0114129_10059036
247 Ga0114129_10061070
248 Ga0105243_10014763
249 Ga0105243_10197988
250 Ga0105242_10181471
251 Ga0105242_10255315
252 Ga0105238_10011336
253 Ga0105249_10036978
254 Ga0105239_10095034
255 Ga0105239_10264917
256 Ga0157371_10060881
257 Ga0157370_10011471
258 Ga0157380_10202161
259 Ga0157377_10040352
260 Ga0163161_10328342
261 Ga0197907_10113464
262 Ga0197907_10521842
263 Ga0197907_10572569
264 Ga0206356_10480245
265 Ga0206356_10724003
266 Ga0206356_11650618
267 Ga0206356_11674891
268 Ga0206349_1219320
269 Ga0206349_1935542
270 Ga0206355_1699483
271 Ga0206351_10360226
272 Ga0206352_10180454
273 Ga0206352_10961087
274 Ga0206354_10061159
275 Ga0206354_10759076
276 Ga0206353_11506495
277 Ga0206353_11556968
278 Ga0154015_1068568
279 Ga0213875_10002110
280 Ga0213875_10002429
281 Ga0213875_10075325
282 Ga0213871_10017199
283 Ga0224712_10000915
284 Ga0224712_10001120
285 Ga0224712_10001478
286 Ga0224712_10003175
287 Ga0224712_10057364
288 Ga0207710_10017616
289 Ga0207707_10002921
290 Ga0207707_10102893
291 Ga0207707_10314756
292 Ga0207695_10114556
293 Ga0207660_10106503
294 Ga0207660_10346231
295 Ga0207657_10006564
296 Ga0207649_10061146
297 Ga0207652_10003116
298 Ga0207652_10197427
299 Ga0207646_10000624
300 Ga0207664_10256889
301 Ga0207709_10015718
302 Ga0207670_10004850
303 Ga0207669_10199232
304 Ga0207661_10000761
305 Ga0207661_10012983
306 Ga0207661_10192658
307 Ga0207640_10011895
308 Ga0207674_10171547
309 Ga0207675_100212386
310 Ga0207698_10032099
311 Ga0207698_10873293
312 Ga0209588_1055547
313 Ga0209974_10023505
314 Ga0268266_10002097
315 Ga0316577_10028666
316 Ga0307413_10032891
317 Ga0307406_10216410
318 Ga0307416_100051418
319 Ga0307415_100011999
320 Ga0373931_0426477
321 Ga0436364_0587284
322 Ga0436364_0881244
323 Ga0436364_1069888
324 Ga0436365_0014399
325 Ga0436365_1447637
326 Ga0436362_0388802
327 Ga0466972_0008735
328 Ga0453683_0186885
329 Ga0466965_0002440
330 Ga0466965_0083312
331 Ga0453684_0033819
332 Ga0466968_0000514
333 Ga0466960_0006450
334 Ga0466967_1158174
335 Ga0495641_0000048
336 Ga0495596_0014771
337 Ga0495616_0037990
338 Ga0495630_0197729
339 Ga0495587_0286486
340 Ga0495674_0077456
341 Ga0495673_0071983
342 Ga0495681_0049826
343 Ga0495684_0230742
344 Ga0495686_0013404
345 Ga0495602_0368782
346 Ga0496103_0009484
347 Ga0496104_0030501
348 Ga0496105_0013943
349 Ga0496108_0023171
350 Ga0496108_0186447
351 Ga0496109_0009966
352 Ga0496109_0265196
353 Ga0496110_0020069
354 Ga0496110_0102769
355 Ga0496111_0027038
356 Ga0496112_0047341
357 Ga0496115_0002210
358 Ga0501040_0272282
359 Ga0501068_0139367
360 Ga0501071_0075134
361 Ga0501072_0079867
362 Ga0501076_0178468
363 Ga0501076_0298522
364 Ga0501076_0321542
365 Ga0501079_0152413
366 Ga0501080_0162556
367 Ga0501081_0451570
368 nmdc:mga05p37_1601_c1
369 nmdc:mga05p37_24406_c1
370 nmdc:mga05p37_36588_c1
371 nmdc:mga09592_18840_c1
372 nmdc:mga09592_6666_c1
373 nmdc:mga0qj67_1286_c1
374 nmdc:mga0qj67_170920_c1
375 nmdc:mga06r32_124282_c1
376 nmdc:mga06r32_171621_c1
377 nmdc:mga06r32_40668_c1
378 nmdc:mga0a205_39902_c1
379 Ga0495601_0020403
380 Ga0495601_0020637
381 Ga0495595_0098436
382 Ga0495619_0299123
383 Ga0500616_0002585
384 Ga0530510_0000860

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

2

162

0.98

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

167

289

0.91

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

2

96

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fp1-assembly1.cif.gz_A the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with competitive inhibitor no. 1 0.9672 1 31
6fox-assembly2.cif.gz_B the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with kynurenine 0.9631 1 31
5x6q-assembly1.cif.gz_A crystal structure of pseudomonas fluorescens kmo in complex with ro 61-8048 0.9616 1 31
7kpt-assembly1.cif.gz_A crystal structure of ctde in complex with fad and substrate 4 0.9613 1 28
6fph-assembly1.cif.gz_A the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with competitive inhibitor no. 1h 0.9609 1 31
ID Description Score Start End Superfamily
af_P75728_4_256_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9621 2 28 3.50.50.60
4e21B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9516 1 178 3.40.50.720
6cr0A01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9406 2 30 3.50.50.60
3zdnC01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.939 2 30 3.50.50.60
5twcA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9381 2 30 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A0L0LZ89-F1-model_v4 deleted 0.9971 1 115
AF-A0A6I5CPF4-F1-model_v4 6-phosphogluconate dehydrogenase 0.995 49 154 GO:0004616
GO:0050661
AF-A0A525I822-F1-model_v4 6-phosphogluconate dehydrogenase (Decarboxylating) 0.9914 1 88 GO:0004616
GO:0050661
AF-A0A7C2WQY9-F1-model_v4 6-phosphogluconate dehydrogenase 0.9909 1 115 GO:0004616
GO:0050661
AF-A0A7W0X915-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.988 1 134 GO:0004616
GO:0050661

Map