F295352

General Info

Members Datasets Scaffolds Average Seq Length
192 149 384 407

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100404073|Ga0068855_1004040731
Length 449
Sequence MTILGLAEAMVAPLIRALCPDDVDLDREAIAERFARAAWSAIAEPGDRDAGHLVALLGAEASLGALTAVPWPPSDPNAIDVAPLEQALAPVGDRDLDHSDLVDAVKRWRPRVAVPTVLLALRQAARFGAGLLVPGDPDWPLGVDELGEHAPLALWARGDRTLLGRLERSVAIVGARAATGYGEHVTVEASSGLVDRGFTIVSGAAYGIDGIAHRAALASAGSTVAFLAGGVDRFYPAGHEALLARIVERGVVVSEVPPGTAPTRWRFLQRNRLIAAASRATIVVEAGWRSGSLNTASHAATLGRPVGAVPGPVTSAASAGCHKLLRETPAVCVTNADEMAELVAGDSPPVAGHPALMADDPXXXXTGQPPTRRSAPISPAIDPTGTRVRVLDALSDRSGRSVTRIGQLTGLAADRVRSELGLLELEGIVRELPAGWQKFTVKQLDARRG

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
7 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
8 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
9 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
14 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
35 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
36 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
55 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
56 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
59 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
60 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
61 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
62 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
63 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
64 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
65 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
66 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
67 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
68 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
69 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
70 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
71 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
72 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
73 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
74 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
75 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
76 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
77 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
78 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
91 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
92 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
93 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
94 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
95 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
98 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
99 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
100 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
101 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
102 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
103 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
104 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
105 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
106 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
107 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
108 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
109 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
110 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
111 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
112 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
113 2643221597 Microbacterium sp. Root180 Isolate Unclassified
114 2643221630 Microbacterium sp. Root322 Isolate Unclassified
115 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
116 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
117 2773857759 Microbacterium sp. 1294 Isolate Unclassified
118 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
119 2808606372 Agromyces sp. 23-23 Isolate Unclassified
120 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
121 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
122 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
123 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
124 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
125 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
126 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
127 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
128 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
129 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
130 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
131 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
132 2919069694 Microbacterium sp. 1154 Isolate Unclassified
133 2919395869 Microbacterium resistens 2980 Isolate Unclassified
134 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
135 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
136 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
137 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
138 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
139 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
140 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
141 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
142 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
143 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
144 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
145 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
146 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
147 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
148 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
149 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.69
Metatranscriptomes 0
Isolates 20.31

Biome Distribution

Category Percentage (%)
Aerial Root 1.04
Bulb 0
Endosphere 13.54
Nodule 0
Rhizoplane 5.21
Rhizosphere 60.94
Stem 0
Stem Tuber 0
Unclassified 1.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100404073 3300005563 Bacteria 1496
2 JGI25154J39366_1001932 3300002738 Bacteria 6189
3 Ga0070658_10000212 3300005327 Bacteria 51560
4 Ga0070658_10030550 3300005327 Bacteria 4328
5 Ga0070658_10050173 3300005327 Bacteria 3382
6 Ga0070671_100136967 3300005355 Bacteria 2064
7 Ga0070659_100004787 3300005366 Bacteria 9678
8 Ga0070685_10032488 3300005466 Bacteria 2923
9 Ga0068853_100008725 3300005539 Bacteria 8154
10 Ga0068855_100014429 3300005563 Bacteria 9513
11 Ga0068855_100107147 3300005563 Bacteria 3211
12 Ga0068855_100153305 3300005563 Bacteria 2619
13 Ga0068855_100357498 3300005563 Bacteria 1607
14 Ga0068857_100002864 3300005577 Bacteria 14183
15 Ga0068854_100070267 3300005578 Bacteria 2559
16 Ga0068856_100020849 3300005614 Bacteria 6370
17 Ga0068856_100355121 3300005614 Bacteria 1484
18 Ga0068852_100004370 3300005616 Bacteria 9985
19 Ga0068852_100016057 3300005616 Bacteria 5830
20 Ga0068859_100213744 3300005617 Bacteria 2015
21 Ga0068851_10000001 3300005834 Bacteria 495512
22 Ga0068863_100022356 3300005841 Bacteria 6038
23 Ga0068858_100000276 3300005842 Bacteria 55258
24 Ga0075365_10000199 3300006038 Bacteria 19923
25 Ga0075365_10000318 3300006038 Bacteria 16994
26 Ga0075363_100003313 3300006048 Bacteria 6826
27 Ga0075364_10023445 3300006051 Bacteria 3907
28 Ga0075367_10004377 3300006178 Bacteria 6888
29 Ga0075369_10019943 3300006186 Bacteria 2741
30 Ga0075370_10005015 3300006353 Bacteria 6515
31 Ga0097620_100213747 3300006931 Bacteria 2015
32 Ga0105240_10039120 3300009093 Bacteria 6076
33 Ga0105245_10020678 3300009098 Bacteria 5770
34 Ga0105245_10068159 3300009098 Bacteria 3224
35 Ga0105241_10004538 3300009174 Bacteria 10274
36 Ga0105248_10013171 3300009177 Bacteria 9105
37 Ga0105237_10001412 3300009545 Bacteria 31744
38 Ga0105237_10034810 3300009545 Bacteria 5096
39 Ga0105237_10088122 3300009545 Bacteria 3093
40 Ga0105238_10012883 3300009551 Bacteria 8441
41 Ga0105239_10033678 3300010375 Bacteria 5625
42 Ga0157371_10013777 3300013102 Bacteria 6127
43 Ga0157370_10007383 3300013104 Bacteria 11975
44 Ga0157369_10000573 3300013105 Bacteria 48456
45 Ga0163163_10008322 3300014325 Bacteria 9210
46 Ga0157379_10009067 3300014968 Bacteria 8668
47 Ga0209646_1000168 3300025246 Bacteria 86352
48 Ga0209148_1001063 3300025254 Bacteria 16857
49 Ga0207656_10000002 3300025321 Bacteria 792178
50 Ga0207688_10117342 3300025901 Bacteria 1550
51 Ga0207705_10000001 3300025909 Bacteria 2061880
52 Ga0207705_10049158 3300025909 Bacteria 3035
53 Ga0207654_10000001 3300025911 Bacteria 1816198
54 Ga0207695_10002597 3300025913 Bacteria 26478
55 Ga0207671_10000002 3300025914 Bacteria 1144816
56 Ga0207657_10234638 3300025919 Unclassified 1466
57 Ga0207694_10000274 3300025924 Bacteria 48845
58 Ga0207690_10001692 3300025932 Bacteria 13602
59 Ga0207711_10002762 3300025941 Bacteria 15463
60 Ga0207711_10032067 3300025941 Bacteria 4441
61 Ga0207667_10000272 3300025949 Bacteria 71730
62 Ga0207667_10009025 3300025949 Bacteria 11791
63 Ga0207667_10012849 3300025949 Bacteria 9622
64 Ga0207667_10165477 3300025949 Bacteria 2274
65 Ga0207640_10037772 3300025981 Bacteria 3042
66 Ga0207703_10000141 3300026035 Bacteria 86068
67 Ga0207641_10018261 3300026088 Bacteria 5749
68 Ga0207674_10033209 3300026116 Bacteria 5403
69 Ga0207675_100053910 3300026118 Bacteria 3752
70 Ga0207698_10002502 3300026142 Bacteria 10904
71 Ga0207698_10002624 3300026142 Bacteria 10681
72 Ga0307514_10001668 3300031649 Bacteria 25799
73 Ga0307514_10061640 3300031649 Bacteria 2856
74 Ga0307406_10000291 3300031901 Bacteria 29442
75 Ga0307406_10005712 3300031901 Bacteria 6812
76 Ga0307406_10013847 3300031901 Bacteria 4629
77 Ga0307412_10095984 3300031911 Bacteria 2086
78 Ga0307409_100062028 3300031995 Bacteria 2925
79 Ga0466972_0020690 3300044658 Bacteria 3287
80 Ga0495590_0000743 3300046457 Bacteria 14782
81 Ga0495645_0003825 3300046543 Bacteria 10242
82 Ga0495656_0008960 3300046615 Bacteria 3590
83 Ga0495625_0159363 3300046660 Bacteria 1513
84 Ga0496100_0210325 3300048903 Bacteria 1422
85 Ga0496105_0016641 3300048908 Bacteria 5872
86 Ga0496108_0019696 3300048911 Bacteria 5542
87 Ga0496109_0099562 3300048912 Bacteria 2696
88 Ga0496111_0144852 3300048914 Bacteria 1761
89 Ga0496113_0031219 3300048916 Bacteria 3864
90 Ga0496113_0070607 3300048916 Bacteria 2655
91 Ga0496114_0047101 3300048917 Bacteria 3585
92 Ga0496114_0138400 3300048917 Unclassified 2106
93 Ga0496115_0287653 3300048918 Bacteria 1349
94 Ga0496117_0000884 3300048920 Bacteria 46176
95 Ga0496117_0017804 3300048920 Bacteria 5922
96 Ga0496119_0001615 3300048922 Bacteria 26709
97 Ga0496120_0000426 3300048923 Bacteria 66901
98 Ga0496120_0038062 3300048923 Bacteria 2849
99 Ga0496120_0057708 3300048923 Bacteria 2184
100 Ga0496122_0000995 3300048925 Bacteria 50459
101 Ga0496122_0024071 3300048925 Bacteria 5340
102 Ga0496123_0000533 3300048926 Bacteria 65458
103 Ga0496125_0042701 3300048928 Bacteria 3858
104 Ga0496125_0047035 3300048928 Bacteria 3613
105 Ga0496126_0005783 3300048929 Bacteria 13983
106 Ga0501031_0004759 3300049568 Bacteria 8819
107 Ga0501031_0089096 3300049568 Bacteria 2012
108 Ga0501032_0028499 3300049569 Bacteria 3837
109 Ga0501033_0040406 3300049570 Bacteria 3482
110 Ga0501034_0015266 3300049571 Bacteria 7893
111 Ga0501034_0059948 3300049571 Bacteria 3822
112 Ga0501034_0064862 3300049571 Bacteria 3665
113 Ga0501036_0002259 3300049572 Bacteria 15044
114 Ga0501037_0002192 3300049573 Bacteria 14116
115 Ga0501038_0007077 3300049574 Bacteria 10362
116 Ga0501039_0001077 3300049575 Bacteria 19999
117 Ga0501043_0002730 3300049579 Bacteria 14759
118 Ga0501043_0014915 3300049579 Bacteria 6083
119 Ga0501046_0000772 3300049580 Bacteria 30987
120 Ga0501046_0030952 3300049580 Bacteria 4343
121 Ga0501047_0019312 3300049581 Bacteria 6538
122 Ga0501048_0004488 3300049582 Bacteria 10622
123 Ga0501068_0049879 3300049584 Bacteria 2529
124 Ga0501068_0112048 3300049584 Bacteria 1697
125 Ga0501070_0006161 3300049586 Bacteria 10222
126 Ga0501070_0016111 3300049586 Bacteria 6283
127 Ga0501070_0035684 3300049586 Bacteria 4153
128 Ga0501070_0081690 3300049586 Bacteria 2674
129 Ga0501071_0003074 3300049587 Bacteria 10340
130 Ga0501073_0000183 3300049589 Bacteria 41086
131 Ga0501073_0138265 3300049589 Bacteria 1688
132 Ga0501080_0011275 3300049742 Bacteria 8182
133 Ga0501035_0017886 3300049822 Bacteria 6538
134 Ga0501044_0005810 3300049823 Bacteria 13669
135 Ga0501045_0051245 3300049824 Bacteria 3012
136 nmdc:mga03n38_4408_c1 3300050490 Bacteria 4660
137 nmdc:mga00v17_120039_c1 3300050491 Bacteria 1673
138 nmdc:mga0yw44_613_c1 3300050492 Bacteria 12911
139 nmdc:mga06z11_16500_c1 3300050494 Bacteria 3329
140 Ga0500643_000072 3300053087 Bacteria 112810
141 Ga0500651_0000368 3300053093 Bacteria 24842
142 Ga0500650_0019666 3300053098 Bacteria 2950
143 Ga0500556_0000001 3300053104 Bacteria 1135060
144 Ga0500559_0000063 3300053136 Bacteria 87005
145 Ga0500568_0000003 3300053139 Bacteria 863587
146 Ga0500568_0000028 3300053139 Bacteria 161589
147 Ga0500568_0001635 3300053139 Bacteria 14132
148 Ga0500568_0006164 3300053139 Bacteria 6066
149 Ga0500573_0007852 3300053140 Bacteria 5848
150 Ga0500573_0050794 3300053140 Bacteria 2384
151 Ga0500573_0065322 3300053140 Bacteria 2080
152 Ga0500590_002795 3300053148 Bacteria 7876
153 Ga0500620_000032 3300053155 Bacteria 27722
154 2588108971 2585428157 Bacteria 3018951
155 2643733843 2643221542 Bacteria 3563959
156 2643996061 2643221597 Bacteria 3347721
157 2644170424 2643221630 Bacteria 3601215
158 2644679977 2643221724 Bacteria 3593515
159 2774380199 2773857758 Bacteria 3592392
160 2774384302 2773857759 Bacteria 2963774
161 2774399325 2773857763 Bacteria 4180068
162 2808901785 2808606372 Bacteria 4649509
163 2833711126 2833709550 Bacteria 4008291
164 2852645984 2852643534 Bacteria 3013378
165 2852647450 2852646457 Bacteria 3408613
166 2852665092 2852663356 Bacteria 4090475
167 2857713000 2857710386 Bacteria 3186771
168 2857720149 2857720070 Bacteria 3189373
169 2857733941 2857733635 Bacteria 3532004
170 2857738723 2857737099 Bacteria 3104305
171 2870630519 2870628048 Bacteria 3696012
172 2895661636 2895660088 Bacteria 3782833
173 2904511828 2904509784 Bacteria 3520416
174 2908680745 2908678064 Bacteria 3482747
175 2919071706 2919069694 Bacteria 3622919
176 2919396456 2919395869 Bacteria 3704152
177 2919446481 2919443155 Bacteria 4072969
178 2928092021 2928090899 Bacteria 3158267
179 2939658707 2939657138 Bacteria 3740283
180 2939662603 2939660829 Bacteria 3784848
181 2945971963 2945968032 Bacteria 4111363
182 2964327196 2964326757 Bacteria 3290868
183 2974297331 2974294766 Bacteria 3767688
184 2974326430 2974324384 Bacteria 3750535
185 2977231581 2977228692 Bacteria 3450105
186 2977236935 2977236895 Bacteria 3569373
187 2977254111 2977251589 Bacteria 2952848
188 2977266809 2977264416 Bacteria 3750737
189 2984545275 2984542743 Bacteria 3569378
190 2984581213 2984580707 Bacteria 3351387
191 8004185323 8004182704 Bacteria 3391155
192 8004213947 8004212874 Bacteria 2861420
193 Ga0068855_100404073
194 JGI25154J39366_1001932
195 Ga0070658_10000212
196 Ga0070658_10030550
197 Ga0070658_10050173
198 Ga0070671_100136967
199 Ga0070659_100004787
200 Ga0070685_10032488
201 Ga0068853_100008725
202 Ga0068855_100014429
203 Ga0068855_100107147
204 Ga0068855_100153305
205 Ga0068855_100357498
206 Ga0068857_100002864
207 Ga0068854_100070267
208 Ga0068856_100020849
209 Ga0068856_100355121
210 Ga0068852_100004370
211 Ga0068852_100016057
212 Ga0068859_100213744
213 Ga0068851_10000001
214 Ga0068863_100022356
215 Ga0068858_100000276
216 Ga0075365_10000199
217 Ga0075365_10000318
218 Ga0075363_100003313
219 Ga0075364_10023445
220 Ga0075367_10004377
221 Ga0075369_10019943
222 Ga0075370_10005015
223 Ga0097620_100213747
224 Ga0105240_10039120
225 Ga0105245_10020678
226 Ga0105245_10068159
227 Ga0105241_10004538
228 Ga0105248_10013171
229 Ga0105237_10001412
230 Ga0105237_10034810
231 Ga0105237_10088122
232 Ga0105238_10012883
233 Ga0105239_10033678
234 Ga0157371_10013777
235 Ga0157370_10007383
236 Ga0157369_10000573
237 Ga0163163_10008322
238 Ga0157379_10009067
239 Ga0209646_1000168
240 Ga0209148_1001063
241 Ga0207656_10000002
242 Ga0207688_10117342
243 Ga0207705_10000001
244 Ga0207705_10049158
245 Ga0207654_10000001
246 Ga0207695_10002597
247 Ga0207671_10000002
248 Ga0207657_10234638
249 Ga0207694_10000274
250 Ga0207690_10001692
251 Ga0207711_10002762
252 Ga0207711_10032067
253 Ga0207667_10000272
254 Ga0207667_10009025
255 Ga0207667_10012849
256 Ga0207667_10165477
257 Ga0207640_10037772
258 Ga0207703_10000141
259 Ga0207641_10018261
260 Ga0207674_10033209
261 Ga0207675_100053910
262 Ga0207698_10002502
263 Ga0207698_10002624
264 Ga0307514_10001668
265 Ga0307514_10061640
266 Ga0307406_10000291
267 Ga0307406_10005712
268 Ga0307406_10013847
269 Ga0307412_10095984
270 Ga0307409_100062028
271 Ga0466972_0020690
272 Ga0495590_0000743
273 Ga0495645_0003825
274 Ga0495656_0008960
275 Ga0495625_0159363
276 Ga0496100_0210325
277 Ga0496105_0016641
278 Ga0496108_0019696
279 Ga0496109_0099562
280 Ga0496111_0144852
281 Ga0496113_0031219
282 Ga0496113_0070607
283 Ga0496114_0047101
284 Ga0496114_0138400
285 Ga0496115_0287653
286 Ga0496117_0000884
287 Ga0496117_0017804
288 Ga0496119_0001615
289 Ga0496120_0000426
290 Ga0496120_0038062
291 Ga0496120_0057708
292 Ga0496122_0000995
293 Ga0496122_0024071
294 Ga0496123_0000533
295 Ga0496125_0042701
296 Ga0496125_0047035
297 Ga0496126_0005783
298 Ga0501031_0004759
299 Ga0501031_0089096
300 Ga0501032_0028499
301 Ga0501033_0040406
302 Ga0501034_0015266
303 Ga0501034_0059948
304 Ga0501034_0064862
305 Ga0501036_0002259
306 Ga0501037_0002192
307 Ga0501038_0007077
308 Ga0501039_0001077
309 Ga0501043_0002730
310 Ga0501043_0014915
311 Ga0501046_0000772
312 Ga0501046_0030952
313 Ga0501047_0019312
314 Ga0501048_0004488
315 Ga0501068_0049879
316 Ga0501068_0112048
317 Ga0501070_0006161
318 Ga0501070_0016111
319 Ga0501070_0035684
320 Ga0501070_0081690
321 Ga0501071_0003074
322 Ga0501073_0000183
323 Ga0501073_0138265
324 Ga0501080_0011275
325 Ga0501035_0017886
326 Ga0501044_0005810
327 Ga0501045_0051245
328 nmdc:mga03n38_4408_c1
329 nmdc:mga00v17_120039_c1
330 nmdc:mga0yw44_613_c1
331 nmdc:mga06z11_16500_c1
332 Ga0500643_000072
333 Ga0500651_0000368
334 Ga0500650_0019666
335 Ga0500556_0000001
336 Ga0500559_0000063
337 Ga0500568_0000003
338 Ga0500568_0000028
339 Ga0500568_0001635
340 Ga0500568_0006164
341 Ga0500573_0007852
342 Ga0500573_0050794
343 Ga0500573_0065322
344 Ga0500590_002795
345 Ga0500620_000032
346 2588108971
347 2643733843
348 2643996061
349 2644170424
350 2644679977
351 2774380199
352 2774384302
353 2774399325
354 2808901785
355 2833711126
356 2852645984
357 2852647450
358 2852665092
359 2857713000
360 2857720149
361 2857733941
362 2857738723
363 2870630519
364 2895661636
365 2904511828
366 2908680745
367 2919071706
368 2919396456
369 2919446481
370 2928092021
371 2939658707
372 2939662603
373 2945971963
374 2964327196
375 2974297331
376 2974326430
377 2977231581
378 2977236935
379 2977254111
380 2977266809
381 2984545275
382 2984581213
383 8004185323
384 8004213947

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02481

DNA_processg_A

DNA recombination-mediator protein A

123

335

0.96

PF17782

DprA_WH

DprA winged helix domain

373

435

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ljk-assembly1.cif.gz_H structural insights into the unique single-stranded dna binding mode of dna processing protein a from helicobacter pylori 0.9476 108 317
7kk0-assembly1.cif.gz_A crystal structure of the marr family transcriptional regulator from variovorax paradoxus bound to catechol 0.9166 336 390
7kfo-assembly1.cif.gz_A-2 crystal structure of the marr family transcriptional regulator from variovorax paradoxus bound to indole 3 acetic acid 0.9122 336 390
2g7u-assembly1.cif.gz_A 2.3 a structure of putative catechol degradative operon regulator from rhodococcus sp. rha1 0.9064 334 390
7l19-assembly1.cif.gz_A-2 crystal structure of the marr family transcriptional regulator from enterobacter soli strain lf7 bound to indole 3 acetic acid 0.9041 336 389
ID Description Score Start End Superfamily
af_P30852_292_361_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9696 340 390 1.10.10.10
4ljkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9342 108 325 3.40.50.450
af_Q2FZ33_2_246_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9302 98 319 3.40.50.450
2xrnA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9276 338 389 1.10.10.10
2g7uC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.92 336 390 1.10.10.10
ID Description Score Start End GO Terms
AF-X8FDA6-F1-model_v4 deleted 0.9918 151 265
AF-A0A1X3D1S3-F1-model_v4 DNA protecting protein DprA 0.9865 130 284 GO:0009294
AF-A0A417AS90-F1-model_v4 deleted 0.9851 151 287
AF-A0A6I3HCI9-F1-model_v4 deleted 0.9829 130 319
AF-A0A7K1BZ86-F1-model_v4 DNA-protecting protein DprA 0.9809 163 322 GO:0009294

Map