F296301

General Info

Members Datasets Scaffolds Average Seq Length
192 144 384 185

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0323270|Ga0501044_0323270_785_1438
Length 217
Sequence MTNNVASNRRAAMRGHALGRSKDERMSRALIVVDVQRDFCEGGSLAVTGGAAVAAAVTRYVTSGADDVDHVVATRDFHIDPGEHFSEQPDFETSWPVHCVAGTLGADFHADFDHRGVEAIFSKGSFSGAYSGFEGANEDGTRLGDWLRENDVTSVDIVGIATDHCVRATALDAVRLGLRTRVLLDKTAGVARSSTDRALADLAAAGVELVGRPLSPA

Samples

Sample ID Description Type Environment
1 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
62 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
63 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
64 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
70 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
71 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
72 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
73 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
74 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
75 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
76 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
77 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
78 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
79 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
80 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
81 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
82 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
83 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
84 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
85 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
86 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
87 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
88 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
89 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
92 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
93 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
94 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
95 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
96 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
97 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
100 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
101 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
119 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
120 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
121 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
122 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
125 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
126 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
127 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
128 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
129 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
130 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
131 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
132 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
133 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
134 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
135 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
136 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
137 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
138 2928153084 Leifsonia sp. 563 Isolate Unclassified
139 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
140 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
141 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
142 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
143 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
144 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.75
Metatranscriptomes 0
Isolates 6.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.31
Nodule 1.04
Rhizoplane 8.33
Rhizosphere 66.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501044_0323270 3300049823 Bacteria 1467
2 Ga0055540_1000690 3300003792 Bacteria 23282
3 Ga0055540_1002591 3300003792 Bacteria 9416
4 Ga0070683_101077624 3300005329 Bacteria 772
5 Ga0070683_101474485 3300005329 Bacteria 654
6 Ga0070690_101071417 3300005330 Bacteria 638
7 Ga0070660_100210875 3300005339 Bacteria 1577
8 Ga0070661_101079427 3300005344 Bacteria 668
9 Ga0070659_100259703 3300005366 Bacteria 1441
10 Ga0070667_100194612 3300005367 Bacteria 1797
11 Ga0070709_10319118 3300005434 Bacteria 1140
12 Ga0070713_100527089 3300005436 Bacteria 1117
13 Ga0070700_100638903 3300005441 Bacteria 839
14 Ga0070663_100010074 3300005455 Bacteria 5879
15 Ga0070707_100619040 3300005468 Bacteria 1045
16 Ga0070684_100261918 3300005535 Bacteria 1582
17 Ga0068857_100959255 3300005577 Bacteria 822
18 Ga0068856_100622727 3300005614 Bacteria 1100
19 Ga0068864_100002288 3300005618 Bacteria 15838
20 Ga0068870_10369882 3300005840 Bacteria 925
21 Ga0068863_100416653 3300005841 Bacteria 1315
22 Ga0068863_100906442 3300005841 Bacteria 882
23 Ga0068860_100172726 3300005843 Bacteria 2088
24 Ga0081455_10032337 3300005937 Bacteria 4715
25 Ga0081455_10038433 3300005937 Bacteria 4239
26 Ga0081455_10131663 3300005937 Bacteria 1955
27 Ga0070717_11240978 3300006028 Bacteria 678
28 Ga0075363_100004055 3300006048 Bacteria 6337
29 Ga0075363_100006849 3300006048 Bacteria 5208
30 Ga0075363_100021122 3300006048 Bacteria 3274
31 Ga0075363_100041366 3300006048 Bacteria 2430
32 Ga0075363_100187869 3300006048 Bacteria 1178
33 Ga0075364_10022304 3300006051 Bacteria 3997
34 Ga0075364_10027610 3300006051 Bacteria 3627
35 Ga0075364_10119457 3300006051 Bacteria 1764
36 Ga0075364_10417564 3300006051 Bacteria 916
37 Ga0075362_10236601 3300006177 Bacteria 896
38 Ga0075367_10004988 3300006178 Bacteria 6547
39 Ga0075369_10003238 3300006186 Bacteria 5912
40 Ga0075369_10024503 3300006186 Bacteria 2501
41 Ga0075369_10058222 3300006186 Bacteria 1682
42 Ga0075370_10009434 3300006353 Bacteria 5068
43 Ga0075370_10022670 3300006353 Bacteria 3451
44 Ga0075428_100080064 3300006844 Bacteria 3565
45 Ga0075428_100509895 3300006844 Bacteria 1287
46 Ga0075428_100658046 3300006844 Bacteria 1117
47 Ga0075430_100638702 3300006846 Bacteria 878
48 Ga0075434_100696876 3300006871 Bacteria 1033
49 Ga0075429_100327349 3300006880 Bacteria 1341
50 Ga0105245_10085642 3300009098 Bacteria 2889
51 Ga0105245_10923799 3300009098 Bacteria 915
52 Ga0114129_10117323 3300009147 Bacteria 3668
53 Ga0114129_10344293 3300009147 Bacteria 1976
54 Ga0114129_10449820 3300009147 Bacteria 1689
55 Ga0105248_10252658 3300009177 Bacteria 1984
56 Ga0163163_10063150 3300014325 Bacteria 3671
57 Ga0182008_10308038 3300014497 Bacteria 830
58 Ga0157379_10124116 3300014968 Bacteria 2323
59 Ga0209673_1015627 3300025273 Bacteria 2873
60 Ga0209051_1000237 3300025303 Bacteria 92688
61 Ga0207699_10034978 3300025906 Bacteria 2854
62 Ga0207643_10231344 3300025908 Bacteria 1134
63 Ga0207693_10071749 3300025915 Bacteria 2711
64 Ga0207657_10701395 3300025919 Bacteria 786
65 Ga0207687_10920057 3300025927 Bacteria 749
66 Ga0207700_10336517 3300025928 Bacteria 1311
67 Ga0207690_10421987 3300025932 Bacteria 1067
68 Ga0207669_10631196 3300025937 Bacteria 874
69 Ga0207704_10228505 3300025938 Bacteria 1382
70 Ga0207711_10027963 3300025941 Bacteria 4740
71 Ga0207689_10458853 3300025942 Bacteria 1065
72 Ga0207679_10131892 3300025945 Bacteria 2006
73 Ga0207703_10307117 3300026035 Bacteria 1449
74 Ga0207639_10412748 3300026041 Bacteria 1219
75 Ga0207678_10008529 3300026067 Bacteria 9030
76 Ga0207641_10203179 3300026088 Bacteria 1828
77 Ga0207641_10419128 3300026088 Bacteria 1289
78 Ga0207676_10081219 3300026095 Bacteria 2633
79 Ga0207674_10640930 3300026116 Bacteria 1026
80 Ga0207428_10342950 3300027907 Bacteria 1100
81 Ga0268264_10134402 3300028381 Bacteria 2197
82 Ga0316176_1119625 3300030732 Bacteria 785
83 Ga0265328_10093839 3300031239 Bacteria 1109
84 Ga0307513_10000002 3300031456 Bacteria 842612
85 Ga0307413_10086725 3300031824 Bacteria 2025
86 Ga0307410_10316691 3300031852 Bacteria 1236
87 Ga0307407_10083319 3300031903 Bacteria 1940
88 Ga0307409_100013774 3300031995 Bacteria 5225
89 Ga0307409_100959582 3300031995 Bacteria 871
90 Ga0307415_100016460 3300032126 Bacteria 4410
91 Ga0307415_100222772 3300032126 Bacteria 1513
92 Ga0373935_0348708 3300035692 Bacteria 1055
93 Ga0373933_0187157 3300035724 Bacteria 1322
94 Ga0373937_0057436 3300036401 Bacteria 3575
95 Ga0439436_0007833 3300041404 Bacteria 3282
96 Ga0439461_0002211 3300041410 Bacteria 3087
97 Ga0439466_0043062 3300041411 Bacteria 1500
98 Ga0439465_0006988 3300041413 Bacteria 3585
99 Ga0439465_0014048 3300041413 Bacteria 2493
100 Ga0439465_0166603 3300041413 Bacteria 792
101 Ga0451853_0799390 3300041512 Bacteria 676
102 Ga0439431_0045971 3300041997 Bacteria 1122
103 Ga0439445_0087544 3300042004 Bacteria 875
104 Ga0439449_0007971 3300042007 Bacteria 4024
105 Ga0439449_0016827 3300042007 Bacteria 2746
106 Ga0439457_022047 3300042014 Bacteria 1410
107 Ga0450907_005870 3300042146 Bacteria 2061
108 Ga0439435_0019659 3300042436 Bacteria 1734
109 Ga0466972_0014347 3300044658 Bacteria 3970
110 Ga0466965_0141446 3300044683 Bacteria 1253
111 Ga0466965_0294396 3300044683 Bacteria 879
112 Ga0466964_0082595 3300044706 Bacteria 1382
113 Ga0466964_0267635 3300044706 Bacteria 849
114 Ga0466968_0129976 3300044735 Bacteria 1145
115 Ga0466968_0182695 3300044735 Bacteria 976
116 Ga0466970_0053243 3300044765 Bacteria 2161
117 Ga0466957_0084636 3300044842 Bacteria 1980
118 Ga0466958_0108091 3300045836 Bacteria 1735
119 Ga0466967_0088624 3300045976 Bacteria 2809
120 Ga0466967_0227870 3300045976 Bacteria 1773
121 Ga0495629_0379175 3300046459 Bacteria 962
122 Ga0495651_0110369 3300046462 Bacteria 2035
123 Ga0495653_0043154 3300046463 Bacteria 3508
124 Ga0495640_0084111 3300046533 Bacteria 2111
125 Ga0495667_0471400 3300046559 Bacteria 788
126 Ga0495670_0070040 3300046691 Bacteria 1774
127 Ga0495672_0190608 3300047320 Bacteria 1031
128 Ga0496100_0098183 3300048903 Bacteria 2013
129 Ga0496104_0008641 3300048907 Bacteria 9060
130 Ga0496105_0067911 3300048908 Bacteria 2944
131 Ga0496108_0012301 3300048911 Bacteria 6962
132 Ga0496108_0355269 3300048911 Bacteria 1279
133 Ga0496108_0905091 3300048911 Bacteria 757
134 Ga0496109_0023172 3300048912 Bacteria 5508
135 Ga0496110_0017996 3300048913 Bacteria 5919
136 Ga0496110_0405575 3300048913 Bacteria 1243
137 Ga0496111_0293093 3300048914 Bacteria 1206
138 Ga0496112_0098359 3300048915 Bacteria 2895
139 Ga0496112_0142026 3300048915 Bacteria 2370
140 Ga0496112_0332664 3300048915 Bacteria 1463
141 Ga0496113_0751464 3300048916 Bacteria 776
142 Ga0496114_0475632 3300048917 Bacteria 1105
143 Ga0496114_1139716 3300048917 Bacteria 665
144 Ga0496117_0000048 3300048920 Bacteria 295908
145 Ga0501033_0282714 3300049570 Bacteria 1171
146 Ga0501034_0034788 3300049571 Bacteria 5108
147 Ga0501034_0115152 3300049571 Bacteria 2677
148 Ga0501037_0001695 3300049573 Bacteria 15989
149 Ga0501039_0227063 3300049575 Bacteria 1467
150 Ga0501043_0001927 3300049579 Bacteria 17763
151 Ga0501047_0355274 3300049581 Bacteria 1302
152 Ga0501068_0096567 3300049584 Bacteria 1828
153 Ga0501070_0011888 3300049586 Bacteria 7351
154 Ga0501073_0102627 3300049589 Bacteria 1986
155 nmdc:mga03683_19257_c1 3300050489 Bacteria 2603
156 nmdc:mga03n38_309766_c1 3300050490 Bacteria 850
157 nmdc:mga03n38_6117_c1 3300050490 Bacteria 4157
158 nmdc:mga03n38_6888_c1 3300050490 Bacteria 3987
159 nmdc:mga03n38_85491_c1 3300050490 Bacteria 1491
160 nmdc:mga00v17_105973_c1 3300050491 Bacteria 1779
161 nmdc:mga00v17_250965_c1 3300050491 Bacteria 1147
162 nmdc:mga00v17_418930_c1 3300050491 Bacteria 870
163 nmdc:mga00v17_7234_c1 3300050491 Bacteria 5914
164 nmdc:mga0yw44_604222_c1 3300050492 Bacteria 745
165 nmdc:mga06z11_10372_c1 3300050494 Bacteria 3968
166 nmdc:mga05p37_1241943_c1 3300050507 Bacteria 765
167 nmdc:mga05p37_484885_c1 3300050507 Bacteria 1423
168 nmdc:mga05p37_862682_c1 3300050507 Bacteria 981
169 nmdc:mga0qj67_460584_c1 3300050509 Bacteria 1024
170 nmdc:mga0sz30_16430_c1 3300050516 Bacteria 2939
171 nmdc:mga0sz30_40341_c1 3300050516 Bacteria 1962
172 nmdc:mga0sz30_9730_c1 3300050516 Bacteria 3665
173 Ga0495601_0580601 3300053077 Bacteria 720
174 Ga0500635_0007559 3300053080 Bacteria 2951
175 Ga0495619_0012044 3300053085 Bacteria 5450
176 Ga0500569_055222 3300053109 Bacteria 1211
177 Ga0500616_0000040 3300053153 Bacteria 367604
178 Ga0500616_0004341 3300053153 Bacteria 10149
179 Ga0500645_004852 3300053730 Bacteria 5070
180 Ga0501084_0854242 3300054114 Bacteria 766
181 2523383204 2523231044 Bacteria 6434991
182 2772642322 2772190715 Bacteria 6959372
183 2842136066 2842134933 Bacteria 5847019
184 2844856518 2844852863 Bacteria 3849151
185 2928144980 2928142448 Bacteria 5288925
186 2928154834 2928153084 Bacteria 4020257
187 2929221029 2929219909 Bacteria 6984360
188 8003836486 8003830390 Bacteria 6541657
189 8003873895 8003870546 Bacteria 7396674
190 8054705011 8054704163 Bacteria 7247792
191 8056057499 8056054917 Bacteria 5736694
192 8057345881 8057345674 Bacteria 4160394
193 Ga0501044_0323270
194 Ga0055540_1000690
195 Ga0055540_1002591
196 Ga0070683_101077624
197 Ga0070683_101474485
198 Ga0070690_101071417
199 Ga0070660_100210875
200 Ga0070661_101079427
201 Ga0070659_100259703
202 Ga0070667_100194612
203 Ga0070709_10319118
204 Ga0070713_100527089
205 Ga0070700_100638903
206 Ga0070663_100010074
207 Ga0070707_100619040
208 Ga0070684_100261918
209 Ga0068857_100959255
210 Ga0068856_100622727
211 Ga0068864_100002288
212 Ga0068870_10369882
213 Ga0068863_100416653
214 Ga0068863_100906442
215 Ga0068860_100172726
216 Ga0081455_10032337
217 Ga0081455_10038433
218 Ga0081455_10131663
219 Ga0070717_11240978
220 Ga0075363_100004055
221 Ga0075363_100006849
222 Ga0075363_100021122
223 Ga0075363_100041366
224 Ga0075363_100187869
225 Ga0075364_10022304
226 Ga0075364_10027610
227 Ga0075364_10119457
228 Ga0075364_10417564
229 Ga0075362_10236601
230 Ga0075367_10004988
231 Ga0075369_10003238
232 Ga0075369_10024503
233 Ga0075369_10058222
234 Ga0075370_10009434
235 Ga0075370_10022670
236 Ga0075428_100080064
237 Ga0075428_100509895
238 Ga0075428_100658046
239 Ga0075430_100638702
240 Ga0075434_100696876
241 Ga0075429_100327349
242 Ga0105245_10085642
243 Ga0105245_10923799
244 Ga0114129_10117323
245 Ga0114129_10344293
246 Ga0114129_10449820
247 Ga0105248_10252658
248 Ga0163163_10063150
249 Ga0182008_10308038
250 Ga0157379_10124116
251 Ga0209673_1015627
252 Ga0209051_1000237
253 Ga0207699_10034978
254 Ga0207643_10231344
255 Ga0207693_10071749
256 Ga0207657_10701395
257 Ga0207687_10920057
258 Ga0207700_10336517
259 Ga0207690_10421987
260 Ga0207669_10631196
261 Ga0207704_10228505
262 Ga0207711_10027963
263 Ga0207689_10458853
264 Ga0207679_10131892
265 Ga0207703_10307117
266 Ga0207639_10412748
267 Ga0207678_10008529
268 Ga0207641_10203179
269 Ga0207641_10419128
270 Ga0207676_10081219
271 Ga0207674_10640930
272 Ga0207428_10342950
273 Ga0268264_10134402
274 Ga0316176_1119625
275 Ga0265328_10093839
276 Ga0307513_10000002
277 Ga0307413_10086725
278 Ga0307410_10316691
279 Ga0307407_10083319
280 Ga0307409_100013774
281 Ga0307409_100959582
282 Ga0307415_100016460
283 Ga0307415_100222772
284 Ga0373935_0348708
285 Ga0373933_0187157
286 Ga0373937_0057436
287 Ga0439436_0007833
288 Ga0439461_0002211
289 Ga0439466_0043062
290 Ga0439465_0006988
291 Ga0439465_0014048
292 Ga0439465_0166603
293 Ga0451853_0799390
294 Ga0439431_0045971
295 Ga0439445_0087544
296 Ga0439449_0007971
297 Ga0439449_0016827
298 Ga0439457_022047
299 Ga0450907_005870
300 Ga0439435_0019659
301 Ga0466972_0014347
302 Ga0466965_0141446
303 Ga0466965_0294396
304 Ga0466964_0082595
305 Ga0466964_0267635
306 Ga0466968_0129976
307 Ga0466968_0182695
308 Ga0466970_0053243
309 Ga0466957_0084636
310 Ga0466958_0108091
311 Ga0466967_0088624
312 Ga0466967_0227870
313 Ga0495629_0379175
314 Ga0495651_0110369
315 Ga0495653_0043154
316 Ga0495640_0084111
317 Ga0495667_0471400
318 Ga0495670_0070040
319 Ga0495672_0190608
320 Ga0496100_0098183
321 Ga0496104_0008641
322 Ga0496105_0067911
323 Ga0496108_0012301
324 Ga0496108_0355269
325 Ga0496108_0905091
326 Ga0496109_0023172
327 Ga0496110_0017996
328 Ga0496110_0405575
329 Ga0496111_0293093
330 Ga0496112_0098359
331 Ga0496112_0142026
332 Ga0496112_0332664
333 Ga0496113_0751464
334 Ga0496114_0475632
335 Ga0496114_1139716
336 Ga0496117_0000048
337 Ga0501033_0282714
338 Ga0501034_0034788
339 Ga0501034_0115152
340 Ga0501037_0001695
341 Ga0501039_0227063
342 Ga0501043_0001927
343 Ga0501047_0355274
344 Ga0501068_0096567
345 Ga0501070_0011888
346 Ga0501073_0102627
347 nmdc:mga03683_19257_c1
348 nmdc:mga03n38_309766_c1
349 nmdc:mga03n38_6117_c1
350 nmdc:mga03n38_6888_c1
351 nmdc:mga03n38_85491_c1
352 nmdc:mga00v17_105973_c1
353 nmdc:mga00v17_250965_c1
354 nmdc:mga00v17_418930_c1
355 nmdc:mga00v17_7234_c1
356 nmdc:mga0yw44_604222_c1
357 nmdc:mga06z11_10372_c1
358 nmdc:mga05p37_1241943_c1
359 nmdc:mga05p37_484885_c1
360 nmdc:mga05p37_862682_c1
361 nmdc:mga0qj67_460584_c1
362 nmdc:mga0sz30_16430_c1
363 nmdc:mga0sz30_40341_c1
364 nmdc:mga0sz30_9730_c1
365 Ga0495601_0580601
366 Ga0500635_0007559
367 Ga0495619_0012044
368 Ga0500569_055222
369 Ga0500616_0000040
370 Ga0500616_0004341
371 Ga0500645_004852
372 Ga0501084_0854242
373 2523383204
374 2772642322
375 2842136066
376 2844856518
377 2928144980
378 2928154834
379 2929221029
380 8003836486
381 8003873895
382 8054705011
383 8056057499
384 8057345881

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

28

212

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pl1-assembly1.cif.gz_A determination of the crystal structure of the pyrazinamidase from m.tuberculosis : a structure-function analysis for prediction resistance to pyrazinamide. 0.9852 1 187
3pl1-assembly1.cif.gz_A determination of the crystal structure of the pyrazinamidase from m.tuberculosis : a structure-function analysis for prediction resistance to pyrazinamide. 0.9695 1 187
1im5-assembly1.cif.gz_A crystal structure of pyrazinamidase of pyrococcus horikoshii in complex with zinc 0.885 2 187
3r2j-assembly2.cif.gz_C crystal structure of pnc1 from l. infantum in complex with nicotinate 0.8754 1 187
1im5-assembly1.cif.gz_A crystal structure of pyrazinamidase of pyrococcus horikoshii in complex with zinc 0.8615 2 187
ID Description Score Start End Superfamily
3pl1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9852 1 187 3.40.50.850
3pl1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9695 1 187 3.40.50.850
1im5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.885 2 187 3.40.50.850
af_Q4DD94_19_219_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8724 2 186 3.40.50.850
1im5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8615 2 187 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A1H6IT21-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9934 1 187 GO:0016787
GO:0019363
GO:0046872
AF-D5LFY8-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9923 70 187 GO:0016787
GO:0019363
GO:0046872
AF-A0A4R5WK76-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9922 1 187 GO:0016787
GO:0019363
GO:0046872
AF-K0EP89-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9904 2 186 GO:0016787
GO:0019363
GO:0046872
AF-A0A849BXB8-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9887 2 187 GO:0016787
GO:0019363
GO:0046872

Map