F296343

General Info

Members Datasets Scaffolds Average Seq Length
192 125 384 105

Family's Representative Sequence

Representative Sequence 3300053119|Ga0500595_086377|Ga0500595_086377_441_761
Length 106
Sequence MAKLRKNDNVVVLTGRDKGRQTTILQVIGDDRLLLEGVNVVKRHTKGNPNPSAGQPGGIREKEMPIHHSNVAIFNQATKKADKVGFKLLNDGKKVRIYKSTGEAID

Samples

Sample ID Description Type Environment
1 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
54 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
56 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
57 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
58 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
59 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
60 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
61 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
64 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
65 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
66 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
67 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
68 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
71 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
72 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
73 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
79 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
80 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
81 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
89 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
92 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
93 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
98 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
99 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
100 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
101 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
103 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
107 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
108 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
109 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
110 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
111 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
112 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
113 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
114 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
115 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
124 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
125 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.65
Metatranscriptomes 19.79
Isolates 1.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.94
Nodule 1.04
Rhizoplane 0.52
Rhizosphere 85.42
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500595_086377 3300053119 Unclassified 913
2 RicEn_FSXC22185_g1 2010549000 Bacteria 825
3 rootL2_10004257 3300003322 Bacteria 11441
4 Ga0055524_1029964 3300003775 Bacteria 1596
5 Ga0055528_1037491 3300003790 Bacteria 1139
6 Ga0055528_1038872 3300003790 Bacteria 1096
7 Ga0055530_10073925 3300003791 Bacteria 729
8 Ga0055540_1011339 3300003792 Bacteria 2882
9 Ga0055531_10021540 3300003794 Bacteria 2495
10 Ga0058861_10032824 3300004800 Bacteria 1948
11 Ga0070683_100451111 3300005329 Bacteria 1227
12 Ga0070692_10178216 3300005345 Bacteria 1230
13 Ga0070705_100003035 3300005440 Bacteria 8283
14 Ga0070700_100023087 3300005441 Bacteria 3637
15 Ga0070694_100022048 3300005444 Bacteria 4079
16 Ga0070681_10188570 3300005458 Bacteria 1982
17 Ga0068867_100118083 3300005459 Bacteria 2046
18 Ga0068867_100159199 3300005459 Bacteria 1779
19 Ga0070706_100467835 3300005467 Bacteria 1173
20 Ga0070707_100809736 3300005468 Bacteria 901
21 Ga0070698_100293080 3300005471 Bacteria 1558
22 Ga0070699_100137776 3300005518 Bacteria 2153
23 Ga0070697_100020637 3300005536 Bacteria 5214
24 Ga0070697_101287411 3300005536 Bacteria 652
25 Ga0068853_101581022 3300005539 Bacteria 635
26 Ga0070695_100001266 3300005545 Bacteria 13913
27 Ga0070695_101867723 3300005545 Bacteria 505
28 Ga0070696_100004428 3300005546 Bacteria 9371
29 Ga0068858_101870745 3300005842 Bacteria 593
30 Ga0075362_10323325 3300006177 Bacteria 769
31 Ga0075366_10026067 3300006195 Bacteria 3421
32 Ga0075370_10953567 3300006353 Bacteria 525
33 Ga0075436_100002331 3300006914 Bacteria 13096
34 Ga0075436_100164914 3300006914 Bacteria 1563
35 Ga0099823_1000064 3300006944 Bacteria 50328
36 Ga0075435_100776538 3300007076 Bacteria 834
37 Ga0099794_10176851 3300007265 Bacteria 1089
38 Ga0105243_10341121 3300009148 Bacteria 1372
39 Ga0105248_10350820 3300009177 Bacteria 1661
40 Ga0105237_10169697 3300009545 Bacteria 2181
41 Ga0157378_11562075 3300013297 Bacteria 705
42 Ga0157372_10180877 3300013307 Bacteria 2441
43 Ga0163163_10305665 3300014325 Bacteria 1643
44 Ga0206349_1157331 3300020075 Bacteria 694
45 Ga0206354_10722014 3300020081 Bacteria 1721
46 Ga0209258_105352 3300025242 Bacteria 2202
47 Ga0209050_1008272 3300025298 Bacteria 5607
48 Ga0209051_1000938 3300025303 Bacteria 28786
49 Ga0209257_1019529 3300025304 Bacteria 2547
50 Ga0207671_10269801 3300025914 Bacteria 1340
51 Ga0207693_10636892 3300025915 Bacteria 829
52 Ga0207646_10158398 3300025922 Bacteria 2043
53 Ga0207709_11443517 3300025935 Bacteria 570
54 Ga0207704_10115591 3300025938 Bacteria 1824
55 Ga0207665_10125879 3300025939 Bacteria 1814
56 Ga0207708_10013450 3300026075 Bacteria 6119
57 Ga0207648_10065486 3300026089 Bacteria 3168
58 Ga0207648_11435430 3300026089 Bacteria 649
59 Ga0209389_1000305 3300027296 Bacteria 30534
60 Ga0209981_1039334 3300027378 Bacteria 705
61 Ga0265336_10000618 3300028666 Bacteria 19547
62 Ga0265338_10117192 3300028800 Bacteria 2132
63 Ga0265324_10000002 3300029957 Bacteria 382754
64 Ga0265324_10000500 3300029957 Bacteria 27131
65 Ga0265328_10003225 3300031239 Bacteria 7230
66 Ga0265325_10001662 3300031241 Bacteria 15453
67 Ga0265325_10014526 3300031241 Bacteria 4446
68 Ga0265325_10074612 3300031241 Bacteria 1696
69 Ga0265331_10002744 3300031250 Bacteria 11718
70 Ga0265331_10195800 3300031250 Bacteria 911
71 Ga0265327_10001331 3300031251 Bacteria 32073
72 Ga0265327_10003591 3300031251 Bacteria 14634
73 Ga0265327_10011983 3300031251 Bacteria 5905
74 Ga0265316_10045967 3300031344 Bacteria 3463
75 Ga0265316_10061349 3300031344 Bacteria 2921
76 Ga0265316_10101308 3300031344 Bacteria 2188
77 Ga0307508_10753018 3300031616 Bacteria 587
78 Ga0265314_10001521 3300031711 Bacteria 25613
79 Ga0265314_10055535 3300031711 Bacteria 2733
80 Ga0265314_10121046 3300031711 Bacteria 1647
81 Ga0316576_10012044 3300031727 Bacteria 5699
82 Ga0316576_10016311 3300031727 Bacteria 5012
83 Ga0316578_10000445 3300031728 Bacteria 13704
84 Ga0316578_10001214 3300031728 Bacteria 10228
85 Ga0316578_10088973 3300031728 Bacteria 1843
86 Ga0316578_10447130 3300031728 Bacteria 764
87 Ga0316577_10070317 3300031733 Bacteria 1954
88 Ga0307413_10324614 3300031824 Bacteria 1177
89 Ga0307413_10395470 3300031824 Bacteria 1081
90 Ga0307416_102155250 3300032002 Bacteria 659
91 Ga0307414_10121151 3300032004 Bacteria 2011
92 Ga0307414_11175532 3300032004 Bacteria 710
93 Ga0316583_10000730 3300032133 Bacteria 10224
94 Ga0316580_10008762 3300032139 Bacteria 3038
95 Ga0316593_10000041 3300032168 Bacteria 14110
96 Ga0316593_10000267 3300032168 Bacteria 8686
97 Ga0316593_10000658 3300032168 Bacteria 6651
98 Ga0316593_10003521 3300032168 Bacteria 3902
99 Ga0316593_10033972 3300032168 Bacteria 1672
100 Ga0316593_10058087 3300032168 Bacteria 1318
101 Ga0316593_10076354 3300032168 Bacteria 1164
102 Ga0316593_10169486 3300032168 Bacteria 800
103 Ga0316593_10172880 3300032168 Bacteria 792
104 Ga0316593_10285838 3300032168 Bacteria 622
105 Ga0316592_1000041 3300033524 Bacteria 10240
106 Ga0316592_1000599 3300033524 Bacteria 5204
107 Ga0316592_1005735 3300033524 Bacteria 2368
108 Ga0316592_1091869 3300033524 Bacteria 695
109 Ga0316588_1001345 3300033528 Bacteria 3987
110 Ga0316587_1000717 3300033529 Bacteria 3603
111 Ga0316596_1000014 3300033541 Bacteria 16366
112 Ga0316596_1000073 3300033541 Bacteria 11690
113 Ga0316596_1000650 3300033541 Bacteria 6228
114 Ga0316596_1000766 3300033541 Bacteria 5881
115 Ga0316596_1031776 3300033541 Bacteria 1372
116 Ga0316596_1061312 3300033541 Bacteria 1003
117 Ga0316596_1088215 3300033541 Bacteria 835
118 Ga0373932_0244923 3300035112 Bacteria 652
119 Ga0373936_0274744 3300035113 Bacteria 756
120 Ga0373943_0664653 3300035170 Bacteria 616
121 Ga0316574_0005612 3300035398 Bacteria 6707
122 Ga0373931_0399093 3300035691 Bacteria 870
123 Ga0373935_0048532 3300035692 Bacteria 2688
124 Ga0373927_0616158 3300035695 Bacteria 717
125 Ga0373933_0234874 3300035724 Bacteria 1178
126 Ga0373947_0082113 3300035725 Bacteria 1997
127 Ga0373937_0228383 3300036401 Bacteria 1752
128 Ga0373937_0304200 3300036401 Bacteria 1507
129 Ga0373937_0840980 3300036401 Bacteria 866
130 Ga0316582_0099996 3300036647 Bacteria 1920
131 Ga0316582_0198826 3300036647 Bacteria 1367
132 Ga0316582_0542207 3300036647 Bacteria 801
133 Ga0316584_0004833 3300036712 Bacteria 8958
134 Ga0373925_0163298 3300037068 Bacteria 1755
135 Ga0451577_0012814 3300042876 Bacteria 7869
136 Ga0451577_0121977 3300042876 Bacteria 2335
137 Ga0451577_0288955 3300042876 Bacteria 1486
138 Ga0451577_0435040 3300042876 Bacteria 1191
139 Ga0451577_0466260 3300042876 Bacteria 1147
140 Ga0453683_0003443 3300044673 Bacteria 11656
141 Ga0453683_0363900 3300044673 Bacteria 930
142 Ga0453683_0708707 3300044673 Bacteria 660
143 Ga0453683_0941179 3300044673 Bacteria 572
144 Ga0466963_1343676 3300044694 Bacteria 501
145 Ga0453684_0000014 3300044712 Bacteria 993311
146 Ga0453684_0000682 3300044712 Bacteria 121090
147 Ga0453684_0001268 3300044712 Bacteria 75704
148 Ga0453684_0003526 3300044712 Bacteria 35001
149 Ga0453684_0026453 3300044712 Bacteria 8377
150 Ga0453684_0035225 3300044712 Bacteria 6924
151 Ga0453684_0052275 3300044712 Bacteria 5345
152 Ga0453684_0145970 3300044712 Bacteria 2818
153 Ga0453684_0436833 3300044712 Bacteria 1459
154 Ga0453684_0537871 3300044712 Bacteria 1289
155 Ga0453684_1151341 3300044712 Bacteria 817
156 Ga0451576_0000096 3300045051 Bacteria 221078
157 Ga0451576_0000909 3300045051 Bacteria 56035
158 Ga0451576_0044061 3300045051 Bacteria 4705
159 Ga0451576_0419975 3300045051 Bacteria 1403
160 Ga0451576_0774187 3300045051 Bacteria 1008
161 Ga0451576_0886009 3300045051 Bacteria 936
162 Ga0466967_0988843 3300045976 Bacteria 838
163 Ga0495681_0027011 3300047470 Bacteria 2977
164 Ga0496102_1529823 3300048905 Bacteria 586
165 Ga0496124_0030272 3300048927 Bacteria 4807
166 Ga0496126_0094581 3300048929 Bacteria 2622
167 Ga0501306_002779 3300049127 Bacteria 1827
168 Ga0501290_001582 3300049513 Bacteria 3072
169 Ga0501320_008553 3300049536 Bacteria 1009
170 Ga0501335_011291 3300049551 Bacteria 872
171 Ga0501337_000866 3300049553 Bacteria 1621
172 Ga0501071_0836955 3300049587 Bacteria 710
173 Ga0501209_000329 3300049656 Bacteria 5742
174 nmdc:mga0k408_78109_c2 3300050493 Bacteria 822
175 nmdc:mga08x19_141689_c1 3300050514 Bacteria 1624
176 nmdc:mga08x19_15449_c1 3300050514 Bacteria 4646
177 Ga0500607_007545 3300053121 Bacteria 6708
178 Ga0500622_0000002 3300053156 Bacteria 646442
179 Ga0500636_0017061 3300053177 Bacteria 4282
180 Ga0500637_0015290 3300053178 Bacteria 4066
181 Ga0500625_174794 3300053729 Bacteria 764
182 Ga0587070_044780 3300059491 Bacteria 861
183 Ga0587077_036405 3300059493 Bacteria 966
184 Ga0587083_0079963 3300059505 Bacteria 777
185 Ga0587085_006077 3300059506 Bacteria 1453
186 Ga0587090_068651 3300059510 Bacteria 688
187 Ga0587109_006245 3300059624 Bacteria 1751
188 Ga0587076_020602 3300059645 Bacteria 1084
189 Ga0587100_021546 3300059648 Bacteria 632
190 2547375770 2547132103 Bacteria 5115736
191 2843691333 2843690924 Bacteria 5169057
192 2894414505 2894414249 Bacteria 4405451
193 Ga0500595_086377
194 RicEn_FSXC22185_g1
195 rootL2_10004257
196 Ga0055524_1029964
197 Ga0055528_1037491
198 Ga0055528_1038872
199 Ga0055530_10073925
200 Ga0055540_1011339
201 Ga0055531_10021540
202 Ga0058861_10032824
203 Ga0070683_100451111
204 Ga0070692_10178216
205 Ga0070705_100003035
206 Ga0070700_100023087
207 Ga0070694_100022048
208 Ga0070681_10188570
209 Ga0068867_100118083
210 Ga0068867_100159199
211 Ga0070706_100467835
212 Ga0070707_100809736
213 Ga0070698_100293080
214 Ga0070699_100137776
215 Ga0070697_100020637
216 Ga0070697_101287411
217 Ga0068853_101581022
218 Ga0070695_100001266
219 Ga0070695_101867723
220 Ga0070696_100004428
221 Ga0068858_101870745
222 Ga0075362_10323325
223 Ga0075366_10026067
224 Ga0075370_10953567
225 Ga0075436_100002331
226 Ga0075436_100164914
227 Ga0099823_1000064
228 Ga0075435_100776538
229 Ga0099794_10176851
230 Ga0105243_10341121
231 Ga0105248_10350820
232 Ga0105237_10169697
233 Ga0157378_11562075
234 Ga0157372_10180877
235 Ga0163163_10305665
236 Ga0206349_1157331
237 Ga0206354_10722014
238 Ga0209258_105352
239 Ga0209050_1008272
240 Ga0209051_1000938
241 Ga0209257_1019529
242 Ga0207671_10269801
243 Ga0207693_10636892
244 Ga0207646_10158398
245 Ga0207709_11443517
246 Ga0207704_10115591
247 Ga0207665_10125879
248 Ga0207708_10013450
249 Ga0207648_10065486
250 Ga0207648_11435430
251 Ga0209389_1000305
252 Ga0209981_1039334
253 Ga0265336_10000618
254 Ga0265338_10117192
255 Ga0265324_10000002
256 Ga0265324_10000500
257 Ga0265328_10003225
258 Ga0265325_10001662
259 Ga0265325_10014526
260 Ga0265325_10074612
261 Ga0265331_10002744
262 Ga0265331_10195800
263 Ga0265327_10001331
264 Ga0265327_10003591
265 Ga0265327_10011983
266 Ga0265316_10045967
267 Ga0265316_10061349
268 Ga0265316_10101308
269 Ga0307508_10753018
270 Ga0265314_10001521
271 Ga0265314_10055535
272 Ga0265314_10121046
273 Ga0316576_10012044
274 Ga0316576_10016311
275 Ga0316578_10000445
276 Ga0316578_10001214
277 Ga0316578_10088973
278 Ga0316578_10447130
279 Ga0316577_10070317
280 Ga0307413_10324614
281 Ga0307413_10395470
282 Ga0307416_102155250
283 Ga0307414_10121151
284 Ga0307414_11175532
285 Ga0316583_10000730
286 Ga0316580_10008762
287 Ga0316593_10000041
288 Ga0316593_10000267
289 Ga0316593_10000658
290 Ga0316593_10003521
291 Ga0316593_10033972
292 Ga0316593_10058087
293 Ga0316593_10076354
294 Ga0316593_10169486
295 Ga0316593_10172880
296 Ga0316593_10285838
297 Ga0316592_1000041
298 Ga0316592_1000599
299 Ga0316592_1005735
300 Ga0316592_1091869
301 Ga0316588_1001345
302 Ga0316587_1000717
303 Ga0316596_1000014
304 Ga0316596_1000073
305 Ga0316596_1000650
306 Ga0316596_1000766
307 Ga0316596_1031776
308 Ga0316596_1061312
309 Ga0316596_1088215
310 Ga0373932_0244923
311 Ga0373936_0274744
312 Ga0373943_0664653
313 Ga0316574_0005612
314 Ga0373931_0399093
315 Ga0373935_0048532
316 Ga0373927_0616158
317 Ga0373933_0234874
318 Ga0373947_0082113
319 Ga0373937_0228383
320 Ga0373937_0304200
321 Ga0373937_0840980
322 Ga0316582_0099996
323 Ga0316582_0198826
324 Ga0316582_0542207
325 Ga0316584_0004833
326 Ga0373925_0163298
327 Ga0451577_0012814
328 Ga0451577_0121977
329 Ga0451577_0288955
330 Ga0451577_0435040
331 Ga0451577_0466260
332 Ga0453683_0003443
333 Ga0453683_0363900
334 Ga0453683_0708707
335 Ga0453683_0941179
336 Ga0466963_1343676
337 Ga0453684_0000014
338 Ga0453684_0000682
339 Ga0453684_0001268
340 Ga0453684_0003526
341 Ga0453684_0026453
342 Ga0453684_0035225
343 Ga0453684_0052275
344 Ga0453684_0145970
345 Ga0453684_0436833
346 Ga0453684_0537871
347 Ga0453684_1151341
348 Ga0451576_0000096
349 Ga0451576_0000909
350 Ga0451576_0044061
351 Ga0451576_0419975
352 Ga0451576_0774187
353 Ga0451576_0886009
354 Ga0466967_0988843
355 Ga0495681_0027011
356 Ga0496102_1529823
357 Ga0496124_0030272
358 Ga0496126_0094581
359 Ga0501306_002779
360 Ga0501290_001582
361 Ga0501320_008553
362 Ga0501335_011291
363 Ga0501337_000866
364 Ga0501071_0836955
365 Ga0501209_000329
366 nmdc:mga0k408_78109_c2
367 nmdc:mga08x19_141689_c1
368 nmdc:mga08x19_15449_c1
369 Ga0500607_007545
370 Ga0500622_0000002
371 Ga0500636_0017061
372 Ga0500637_0015290
373 Ga0500625_174794
374 Ga0587070_044780
375 Ga0587077_036405
376 Ga0587083_0079963
377 Ga0587085_006077
378 Ga0587090_068651
379 Ga0587109_006245
380 Ga0587076_020602
381 Ga0587100_021546
382 2547375770
383 2843691333
384 2894414505

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17136

ribosomal_L24

Ribosomal proteins 50S L24/mitochondrial 39S L24

38

105

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cgv-assembly1.cif.gz_t tiamulin bound to the 50s subunit 0.9505 4 103
8cam-assembly1.cif.gz_t evernimicin bound to the 50s subunit 0.9472 1 103
6vwn-assembly1.cif.gz_S 70s ribosome bound to hiv frameshifting stem-loop (fss) and p-site trna (non-rotated conformation, structure ii) 0.9457 1 103
6vwl-assembly1.cif.gz_S 70s ribosome bound to hiv frameshifting stem-loop (fss) and p/e trna (rotated conformation) 0.9424 4 103
7nwt-assembly1.cif.gz_U initiated 70s ribosome in complex with 2a protein from encephalomyocarditis virus (emcv) 0.9423 1 104
ID Description Score Start End Superfamily
af_Q69T55_240_282_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8935 4 36 2.30.30.30
af_C6KSP8_36_136_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8897 1 100 2.30.30.30
af_Q55DJ4_14_116_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8853 4 101 2.30.30.30
af_C6SX56_4_111_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.883 4 100 2.30.30.30
af_Q653V9_69_173_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8614 4 101 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A7C3GS56-F1-model_v4 Large ribosomal subunit protein uL24 (50S ribosomal protein L24) 0.9916 1 66 GO:0003723
GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2E0ICJ6-F1-model_v4 Large ribosomal subunit protein uL24 0.9783 1 103 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A352Q4Q8-F1-model_v4 Large ribosomal subunit protein uL24 (50S ribosomal protein L24) 0.9775 1 82 GO:0003723
GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2E2ZH91-F1-model_v4 Large ribosomal subunit protein uL24 0.9745 1 103 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2E0ICJ6-F1-model_v4 Large ribosomal subunit protein uL24 0.9691 1 103 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map