F296372

General Info

Members Datasets Scaffolds Average Seq Length
192 174 384 360

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2510065059|2510315090
Length 378
Sequence TVVGRSHDPCARVIPLRLKVDTDAIDPYVVRLRSFEGMPQPPDNCGFLDAALETADGETALFAGATGNLRVFGVDPSELDGDIVFVVPSRKTAHRLIRASSPHNTLLITERCDQLCVMCSQPPKKQHVNMFPFFETAVLLAPENSTIGLSGGEPTLFKSELFEFLRETMARRHDIDFHILTNAQHFGRADLAELRDLDLSRILWGVPVYSSAGAIHDQIVGKQGAFEQVRKNLSVLCEAGARIELRTVLMKPNAPGLLDLAKFVAVTLPFTDTWAIMQLENIGYGRQNWGSLFFDSSLGFDLVGKALDFAVSRGINTKLYNFPLCTVPADYRVFAPSTISDWKRAYVADCADCDLRNECGGFFEWHPKAHGYGRFGVA

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
4 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
10 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
11 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
12 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
13 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
14 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
15 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
16 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
17 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
18 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
19 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
20 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
21 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
22 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
23 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
24 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
25 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
26 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
27 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
33 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
34 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
35 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
36 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
37 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
38 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
39 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
40 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
41 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
42 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
43 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
44 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
45 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
46 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
47 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
48 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
49 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
50 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
51 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
52 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
53 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
54 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
55 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
56 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
57 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
58 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
59 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
60 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
61 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
62 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
63 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
64 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
65 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
66 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
67 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
68 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
69 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
70 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
71 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
72 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
73 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
74 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
75 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
76 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
77 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
78 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
79 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
80 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
81 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
82 2791355262 Rhizobium sp. M1 Isolate Nodule
83 2791355263 Rhizobium chutanense C5 Isolate Nodule
84 2791355264 Rhizobium sp. S9 Isolate Nodule
85 2802429634 Rhizobium anhuiense S10 Isolate Nodule
86 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
87 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
88 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
89 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
90 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
91 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
92 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
93 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
94 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
95 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
96 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
97 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
98 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
99 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
100 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
101 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
102 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
103 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
104 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
105 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
106 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
107 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
108 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
109 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
110 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
111 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
112 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
113 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
114 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
115 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
116 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
117 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
118 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
119 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
120 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
121 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
122 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
123 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
124 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
125 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
126 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
127 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
128 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
129 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
130 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
131 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
132 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
133 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
134 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
135 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
136 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
137 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
138 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
139 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
140 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
141 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
142 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
143 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
144 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
145 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
146 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
147 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
148 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
149 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
150 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
151 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
152 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
153 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
154 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
155 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
156 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
157 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
158 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
159 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
160 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
161 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
162 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
163 2996887358 Rhizobium sp. R711 Isolate Nodule
164 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
165 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
166 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
167 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
168 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
169 8005321885 Rhizobium sp. R72 Isolate Nodule
170 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
171 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
172 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
173 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
174 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 40.62
Metatranscriptomes 0
Isolates 59.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.9
Nodule 59.38
Rhizoplane 0.52
Rhizosphere 15.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10001144 3300003187 Bacteria 19232
2 JGI25153J46596_10000239 3300003215 Bacteria 46098
3 Ga0055526_1008128 3300003771 Bacteria 5288
4 Ga0055528_1000193 3300003790 Bacteria 51831
5 Ga0070670_100000133 3300005331 Bacteria 69691
6 Ga0068868_100000011 3300005338 Bacteria 117273
7 Ga0070675_100050717 3300005354 Bacteria 3408
8 Ga0070659_100000376 3300005366 Bacteria 33719
9 Ga0068859_100000269 3300005617 Bacteria 51775
10 Ga0068863_100002406 3300005841 Bacteria 18588
11 Ga0075434_100256020 3300006871 Bacteria 1769
12 Ga0097620_100000269 3300006931 Bacteria 51775
13 Ga0099826_10003232 3300006948 Bacteria 10984
14 Ga0123341_1000219 3300009765 Bacteria 29972
15 Ga0123341_1000269 3300009765 Bacteria 28468
16 Ga0123342_1005154 3300009766 Bacteria 19253
17 Ga0123342_1006738 3300009766 Bacteria 15725
18 Ga0123342_1007924 3300009766 Bacteria 13741
19 Ga0157373_10003723 3300013100 Bacteria 11532
20 Ga0157371_10000619 3300013102 Bacteria 42290
21 Ga0228711_1006958 3300022739 Bacteria 16593
22 Ga0228710_1007165 3300022740 Bacteria 16591
23 Ga0207425_1010450 3300025245 Bacteria 2258
24 Ga0209129_1000284 3300025258 Bacteria 48264
25 Ga0209673_1000025 3300025273 Bacteria 404572
26 Ga0209673_1031263 3300025273 Bacteria 1660
27 Ga0209025_1000058 3300025294 Bacteria 311398
28 Ga0209564_1000618 3300025295 Bacteria 54453
29 Ga0209758_1000565 3300025297 Bacteria 58312
30 Ga0209256_1000561 3300025299 Bacteria 53094
31 Ga0209256_1004002 3300025299 Bacteria 9653
32 Ga0207650_10000532 3300025925 Bacteria 31166
33 Ga0207659_10033326 3300025926 Bacteria 3544
34 Ga0207690_10000001 3300025932 Bacteria 807539
35 Ga0207690_10000002 3300025932 Bacteria 807473
36 Ga0207690_10000003 3300025932 Bacteria 783011
37 Ga0207690_10000004 3300025932 Bacteria 746138
38 Ga0207640_10474686 3300025981 Bacteria 1036
39 Ga0207641_10006395 3300026088 Bacteria 9932
40 Ga0209282_1002233 3300027666 Bacteria 11089
41 Ga0315914_1011033 3300031967 Bacteria 10992
42 Ga0307411_10200231 3300032005 Bacteria 1533
43 Ga0315913_1010036 3300033430 Bacteria 10993
44 Ga0315915_1011583 3300033464 Bacteria 9499
45 Ga0400490_23392 3300038726 Bacteria 2957
46 Ga0439465_0000783 3300041413 Bacteria 9911
47 Ga0451847_0066666 3300041503 Bacteria 23813
48 Ga0451849_0198375 3300041505 Bacteria 4185
49 Ga0451851_1193460 3300041507 Bacteria 3515
50 Ga0451855_1502023 3300041511 Bacteria 8375
51 Ga0495638_0001339 3300046460 Bacteria 22617
52 Ga0495583_0010775 3300046506 Bacteria 5300
53 Ga0495606_0034920 3300046507 Bacteria 3444
54 Ga0496116_0000309 3300048919 Bacteria 81667
55 Ga0496116_0000649 3300048919 Bacteria 45467
56 Ga0496116_0052429 3300048919 Bacteria 2703
57 Ga0496116_0058308 3300048919 Bacteria 2518
58 Ga0496117_0001285 3300048920 Bacteria 37005
59 Ga0496121_0000115 3300048924 Bacteria 178411
60 Ga0496121_0197596 3300048924 Bacteria 1436
61 Ga0496122_0000996 3300048925 Bacteria 50450
62 Ga0496123_0000337 3300048926 Bacteria 88727
63 Ga0496123_0002621 3300048926 Bacteria 21796
64 Ga0496124_0000184 3300048927 Bacteria 123894
65 Ga0496124_0002108 3300048927 Bacteria 26827
66 Ga0496124_0002774 3300048927 Bacteria 22252
67 Ga0496125_0000053 3300048928 Bacteria 279909
68 Ga0496125_0112779 3300048928 Bacteria 1963
69 Ga0496126_0100865 3300048929 Bacteria 2526
70 Ga0501034_0071698 3300049571 Bacteria 3474
71 Ga0501067_0043793 3300049583 Bacteria 2486
72 Ga0501077_0052916 3300049593 Bacteria 2577
73 Ga0500641_0105380 3300053096 Bacteria 1211
74 Ga0500560_000534 3300053107 Bacteria 5398
75 Ga0500618_000098 3300053125 Bacteria 71763
76 Ga0500616_0000606 3300053153 Bacteria 43378
77 Ga0500638_001656 3300053162 Bacteria 7201
78 Ga0500636_0027883 3300053177 Bacteria 3336
79 2510315090 2510065059 Bacteria 6847884
80 2509112382 2508501122 Bacteria 6292184
81 2511132588 2510917022 Bacteria 6504556
82 2513573124 2513237084 Bacteria 7231967
83 2513597551 2513237088 Bacteria 6927906
84 2513871910 2513237138 Bacteria 7368160
85 2513908621 2513237144 Bacteria 7530820
86 2515639362 2515154113 Bacteria 7807172
87 2517098055 2517093000 Bacteria 7412387
88 2524462910 2524023209 Bacteria 6679728
89 2554249197 2554235003 Bacteria 5877155
90 2586004267 2585427634 Bacteria 6455027
91 2600197745 2599185352 Bacteria 7228948
92 2616312649 2615840626 Bacteria 7921970
93 2694638118 2693429784 Bacteria 7241525
94 2720613534 2718218232 Bacteria 6720332
95 2753463222 2751185821 Bacteria 6189929
96 2778177734 2775507266 Bacteria 7392367
97 2793318898 2791355259 Bacteria 7254731
98 2793338026 2791355262 Bacteria 6774204
99 2793345045 2791355263 Bacteria 6872478
100 2793351155 2791355264 Bacteria 6429314
101 2806055776 2802429634 Bacteria 7083200
102 2806063765 2802429635 Bacteria 7650140
103 2837683293 2837678835 Bacteria 5252418
104 2838026065 2838022645 Bacteria 6494267
105 2838035139 2838029111 Bacteria 6603031
106 2838690939 2838686498 Bacteria 7807632
107 2842083211 2842077413 Bacteria 6508645
108 2842117202 2842110456 Bacteria 7656360
109 2842204135 2842198810 Bacteria 6608673
110 2842211370 2842205361 Bacteria 6340321
111 2842275414 2842271015 Bacteria 7807131
112 2842284824 2842278818 Bacteria 6340002
113 2842313422 2842311132 Bacteria 6616990
114 2842324062 2842317721 Bacteria 6793725
115 2842363037 2842357229 Bacteria 6485165
116 2842481821 2842475841 Bacteria 6603183
117 2842488922 2842482326 Bacteria 7212537
118 2842508702 2842502639 Bacteria 6604161
119 2852392613 2852387548 Bacteria 8025568
120 2856320094 2856314179 Bacteria 6477897
121 2856322002 2856320880 Bacteria 7263508
122 2856330767 2856328259 Bacteria 6528202
123 2856371727 2856364286 Bacteria 6939991
124 2869274168 2869271264 Bacteria 6908218
125 2869289348 2869285874 Bacteria 6901219
126 2871431416 2871429161 Bacteria 6547891
127 2874139732 2874139085 Bacteria 7021506
128 2874154552 2874146452 Bacteria 7533118
129 2874161939 2874155637 Bacteria 6724144
130 2876400403 2876399893 Bacteria 6927900
131 2876420122 2876413966 Bacteria 6831344
132 2878748020 2878745973 Bacteria 6867388
133 2878756143 2878753008 Bacteria 6922523
134 2881863875 2881861095 Bacteria 7128710
135 2881864600 2881861095 Bacteria 7128710
136 2888346232 2888343758 Bacteria 6611049
137 2899846837 2899845264 Bacteria 5672268
138 2903493551 2903492973 Bacteria 13473544
139 2906311638 2906308376 Bacteria 6841989
140 2906323378 2906321335 Bacteria 6579571
141 2906421127 2906414383 Bacteria 6580790
142 2921262701 2921257292 Bacteria 6808382
143 2924784804 2924784321 Bacteria 7416538
144 2933590117 2933586486 Bacteria 7667493
145 2933598456 2933594066 Bacteria 5594265
146 2937027835 2937023124 Bacteria 6815156
147 2937053180 2937049772 Bacteria 6757901
148 2937125343 2937119839 Bacteria 6597547
149 2937818544 2937813078 Bacteria 7783518
150 2937972601 2937972304 Bacteria 7532020
151 2957383923 2957382221 Bacteria 6737050
152 2957400984 2957395598 Bacteria 6822399
153 2957405264 2957402308 Bacteria 6741770
154 2958038566 2958034702 Bacteria 6989922
155 2958133724 2958130278 Bacteria 6897202
156 2958149445 2958144490 Bacteria 6677056
157 2958183368 2958179912 Bacteria 6874908
158 2960604955 2960603979 Bacteria 6898737
159 2961081335 2961077736 Bacteria 7079850
160 2961138630 2961136820 Bacteria 6775228
161 2964620827 2964615318 Bacteria 6809089
162 2965028069 2965025482 Bacteria 6532201
163 2965055243 2965047637 Bacteria 6623551
164 2965103518 2965102966 Bacteria 6800987
165 2967696798 2967693043 Bacteria 6804451
166 2967760988 2967755722 Bacteria 6814706
167 2968023834 2968016561 Bacteria 7022047
168 2970044204 2970040964 Bacteria 6731123
169 2970107363 2970102677 Bacteria 6812532
170 2970119461 2970116247 Bacteria 6501857
171 2970133096 2970129317 Bacteria 6806560
172 2970469875 2970469710 Bacteria 6969209
173 2970554943 2970547951 Bacteria 6931819
174 2977583128 2977579622 Bacteria 6772100
175 2977826086 2977821940 Bacteria 6906439
176 2977850708 2977843712 Bacteria 6753583
177 2977868269 2977864932 Bacteria 7534097
178 2977949456 2977942078 Bacteria 7570577
179 2996355058 2996348954 Bacteria 7239054
180 2996891077 2996887358 Bacteria 5795980
181 3004281592 3004275668 Bacteria 7114440
182 8004377733 8004374579 Bacteria 6898112
183 8004391226 8004387939 Bacteria 7049250
184 8004640379 8004640170 Bacteria 6723001
185 8004716598 8004714634 Bacteria 6776161
186 8005325604 8005321885 Bacteria 5795980
187 8005435471 8005430974 Bacteria 6689030
188 8005436536 8005430974 Bacteria 6689030
189 8005687997 8005682033 Bacteria 6726518
190 8005699046 8005695170 Bacteria 6912330
191 8057533578 8057529695 Bacteria 6306553
192 8057579187 8057575449 Bacteria 7367519
193 JGI25151J46595_10001144
194 JGI25153J46596_10000239
195 Ga0055526_1008128
196 Ga0055528_1000193
197 Ga0070670_100000133
198 Ga0068868_100000011
199 Ga0070675_100050717
200 Ga0070659_100000376
201 Ga0068859_100000269
202 Ga0068863_100002406
203 Ga0075434_100256020
204 Ga0097620_100000269
205 Ga0099826_10003232
206 Ga0123341_1000219
207 Ga0123341_1000269
208 Ga0123342_1005154
209 Ga0123342_1006738
210 Ga0123342_1007924
211 Ga0157373_10003723
212 Ga0157371_10000619
213 Ga0228711_1006958
214 Ga0228710_1007165
215 Ga0207425_1010450
216 Ga0209129_1000284
217 Ga0209673_1000025
218 Ga0209673_1031263
219 Ga0209025_1000058
220 Ga0209564_1000618
221 Ga0209758_1000565
222 Ga0209256_1000561
223 Ga0209256_1004002
224 Ga0207650_10000532
225 Ga0207659_10033326
226 Ga0207690_10000001
227 Ga0207690_10000002
228 Ga0207690_10000003
229 Ga0207690_10000004
230 Ga0207640_10474686
231 Ga0207641_10006395
232 Ga0209282_1002233
233 Ga0315914_1011033
234 Ga0307411_10200231
235 Ga0315913_1010036
236 Ga0315915_1011583
237 Ga0400490_23392
238 Ga0439465_0000783
239 Ga0451847_0066666
240 Ga0451849_0198375
241 Ga0451851_1193460
242 Ga0451855_1502023
243 Ga0495638_0001339
244 Ga0495583_0010775
245 Ga0495606_0034920
246 Ga0496116_0000309
247 Ga0496116_0000649
248 Ga0496116_0052429
249 Ga0496116_0058308
250 Ga0496117_0001285
251 Ga0496121_0000115
252 Ga0496121_0197596
253 Ga0496122_0000996
254 Ga0496123_0000337
255 Ga0496123_0002621
256 Ga0496124_0000184
257 Ga0496124_0002108
258 Ga0496124_0002774
259 Ga0496125_0000053
260 Ga0496125_0112779
261 Ga0496126_0100865
262 Ga0501034_0071698
263 Ga0501067_0043793
264 Ga0501077_0052916
265 Ga0500641_0105380
266 Ga0500560_000534
267 Ga0500618_000098
268 Ga0500616_0000606
269 Ga0500638_001656
270 Ga0500636_0027883
271 2510315090
272 2509112382
273 2511132588
274 2513573124
275 2513597551
276 2513871910
277 2513908621
278 2515639362
279 2517098055
280 2524462910
281 2554249197
282 2586004267
283 2600197745
284 2616312649
285 2694638118
286 2720613534
287 2753463222
288 2778177734
289 2793318898
290 2793338026
291 2793345045
292 2793351155
293 2806055776
294 2806063765
295 2837683293
296 2838026065
297 2838035139
298 2838690939
299 2842083211
300 2842117202
301 2842204135
302 2842211370
303 2842275414
304 2842284824
305 2842313422
306 2842324062
307 2842363037
308 2842481821
309 2842488922
310 2842508702
311 2852392613
312 2856320094
313 2856322002
314 2856330767
315 2856371727
316 2869274168
317 2869289348
318 2871431416
319 2874139732
320 2874154552
321 2874161939
322 2876400403
323 2876420122
324 2878748020
325 2878756143
326 2881863875
327 2881864600
328 2888346232
329 2899846837
330 2903493551
331 2906311638
332 2906323378
333 2906421127
334 2921262701
335 2924784804
336 2933590117
337 2933598456
338 2937027835
339 2937053180
340 2937125343
341 2937818544
342 2937972601
343 2957383923
344 2957400984
345 2957405264
346 2958038566
347 2958133724
348 2958149445
349 2958183368
350 2960604955
351 2961081335
352 2961138630
353 2964620827
354 2965028069
355 2965055243
356 2965103518
357 2967696798
358 2967760988
359 2968023834
360 2970044204
361 2970107363
362 2970119461
363 2970133096
364 2970469875
365 2970554943
366 2977583128
367 2977826086
368 2977850708
369 2977868269
370 2977949456
371 2996355058
372 2996891077
373 3004281592
374 8004377733
375 8004391226
376 8004640379
377 8004716598
378 8005325604
379 8005435471
380 8005436536
381 8005687997
382 8005699046
383 8057533578
384 8057579187

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

106

264

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v1q-assembly1.cif.gz_A crystal structure of streptococcus suis suib 0.7979 83 303
5vsm-assembly1.cif.gz_A crystal structure of viperin with bound [4fe-4s] cluster, 5'-deoxyadenosine, and l-methionine 0.7713 87 304
6b4c-assembly9.cif.gz_I structure of viperin from trichoderma virens 0.7704 85 307
6b4c-assembly5.cif.gz_E structure of viperin from trichoderma virens 0.7697 85 307
5v1s-assembly2.cif.gz_B crystal structure of streptococcus suis suib bound to s-adenosylmethionine 0.7693 83 304
ID Description Score Start End Superfamily
af_P9WJ79_7_303_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7828 82 302 3.20.20.70
af_B9FW77_1_53_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7674 34 60 3.30.160.20
af_P9WJS1_27_360_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7647 85 296 3.20.20.70
af_Q2FXH0_48_255_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.7647 126 275 3.80.30.20
af_Q2FX16_20_293_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7606 82 308 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A4S0I5I4-F1-model_v4 deleted 0.9797 208 307
AF-A0A2N8N5J8-F1-model_v4 His-Xaa-Ser system radical SAM maturase HxsC 0.9772 156 362
AF-A0A4V3GTM9-F1-model_v4 deleted 0.9724 1 362
AF-A0A4S0I5I4-F1-model_v4 deleted 0.9702 208 307
AF-A0A4V3GTM9-F1-model_v4 deleted 0.9698 1 362

Map