F296463
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 193 | 121 | 386 | 203 |
Family's Representative Sequence
| Representative Sequence | 3300001904|JGI24736J21556_1010501|JGI24736J21556_10105012 |
| Length | 205 |
| Sequence | MTSKKPLFVTGIGTXIGKTIVSAILVEKLKADYWKPIQSGDLDKSDSVSVENLISNTITKIHPENYRLTQPFSPHKSAAIDGITIDPDTIHLPNTTNTLIVEGAGGLMVPLNNEFLIIDLIKKLGIEVVLVSQNYLGSINHTLLSIHALKYYDISIRGIIFNGIEDISSKDFILKNSGLKLLGHIPEYKLIDKEVIIGAGNYIDL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 22 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 23 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 24 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 25 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 26 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 28 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 29 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 44 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 46 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 47 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 48 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 51 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 78 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 79 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 80 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 81 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 82 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 83 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 84 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 85 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 86 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 87 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 88 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 89 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 90 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 91 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 92 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 93 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 94 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 95 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 96 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 97 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 109 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 110 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 111 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 112 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 113 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 114 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 115 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 116 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 117 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 118 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 119 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 120 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 121 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.34 |
| Metatranscriptomes | 0 |
| Isolates | 4.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.55 |
| Nodule | 0 |
| Rhizoplane | 0.52 |
| Rhizosphere | 88.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1010501 | 3300001904 | Bacteria | 1512 |
| 2 | JGI24737J22298_10072511 | 3300001990 | Unclassified | 1028 |
| 3 | JGI25157J39369_1005024 | 3300002741 | Bacteria | 2236 |
| 4 | JGI25157J39369_1010341 | 3300002741 | Bacteria | 1230 |
| 5 | rootH1_10045277 | 3300003316 | Bacteria | 2407 |
| 6 | rootH2_10025473 | 3300003320 | Bacteria | 20163 |
| 7 | rootH2_10057091 | 3300003320 | Bacteria | 2029 |
| 8 | rootH1_10055144 | 3300003323 | Bacteria | 7652 |
| 9 | Ga0065714_10002310 | 3300005288 | Bacteria | 37379 |
| 10 | Ga0065714_10065129 | 3300005288 | Bacteria | 12658 |
| 11 | Ga0070658_10000019 | 3300005327 | Bacteria | 194742 |
| 12 | Ga0070676_10000165 | 3300005328 | Bacteria | 26705 |
| 13 | Ga0070683_100006104 | 3300005329 | Bacteria | 10102 |
| 14 | Ga0068869_100074875 | 3300005334 | Unclassified | 2514 |
| 15 | Ga0068869_100933906 | 3300005334 | Bacteria | 752 |
| 16 | Ga0068868_100035335 | 3300005338 | Bacteria | 3863 |
| 17 | Ga0070660_100065188 | 3300005339 | Bacteria | 2835 |
| 18 | Ga0070660_100495809 | 3300005339 | Unclassified | 1016 |
| 19 | Ga0070671_100007630 | 3300005355 | Bacteria | 8653 |
| 20 | Ga0070673_100026243 | 3300005364 | Bacteria | 4301 |
| 21 | Ga0070659_100245066 | 3300005366 | Bacteria | 1484 |
| 22 | Ga0070663_100472304 | 3300005455 | Bacteria | 1037 |
| 23 | Ga0070662_100000185 | 3300005457 | Bacteria | 36147 |
| 24 | Ga0068867_100001301 | 3300005459 | Bacteria | 17246 |
| 25 | Ga0070665_100000003 | 3300005548 | Bacteria | 811857 |
| 26 | Ga0068855_100000196 | 3300005563 | Bacteria | 78135 |
| 27 | Ga0068855_100000519 | 3300005563 | Bacteria | 47297 |
| 28 | Ga0068855_100084823 | 3300005563 | Bacteria | 3666 |
| 29 | Ga0068855_100099457 | 3300005563 | Bacteria | 3350 |
| 30 | Ga0068855_100247955 | 3300005563 | Bacteria | 1987 |
| 31 | Ga0068855_100524175 | 3300005563 | Bacteria | 1285 |
| 32 | Ga0068854_100177864 | 3300005578 | Bacteria | 1660 |
| 33 | Ga0068856_100000092 | 3300005614 | Bacteria | 84781 |
| 34 | Ga0068856_100002099 | 3300005614 | Bacteria | 20660 |
| 35 | Ga0068856_100307822 | 3300005614 | Unclassified | 1602 |
| 36 | Ga0068856_100545961 | 3300005614 | Bacteria | 1180 |
| 37 | Ga0068852_100000372 | 3300005616 | Bacteria | 30292 |
| 38 | Ga0068852_100648159 | 3300005616 | Bacteria | 1063 |
| 39 | Ga0068866_10098331 | 3300005718 | Bacteria | 1609 |
| 40 | Ga0097621_100000054 | 3300006237 | Bacteria | 59756 |
| 41 | Ga0097621_100238200 | 3300006237 | Bacteria | 1590 |
| 42 | Ga0068871_100000145 | 3300006358 | Bacteria | 46320 |
| 43 | Ga0068871_100162549 | 3300006358 | Bacteria | 1910 |
| 44 | Ga0068865_100000051 | 3300006881 | Bacteria | 65346 |
| 45 | Ga0105240_10035851 | 3300009093 | Bacteria | 6388 |
| 46 | Ga0105240_10036520 | 3300009093 | Bacteria | 6319 |
| 47 | Ga0105240_10039015 | 3300009093 | Bacteria | 6086 |
| 48 | Ga0105240_10241301 | 3300009093 | Unclassified | 2095 |
| 49 | Ga0105240_10282455 | 3300009093 | Bacteria | 1906 |
| 50 | Ga0105240_10356391 | 3300009093 | Bacteria | 1658 |
| 51 | Ga0105240_10962451 | 3300009093 | Bacteria | 915 |
| 52 | Ga0105241_10021131 | 3300009174 | Bacteria | 4812 |
| 53 | Ga0105241_10023476 | 3300009174 | Bacteria | 4574 |
| 54 | Ga0105241_10026541 | 3300009174 | Bacteria | 4310 |
| 55 | Ga0105242_10019823 | 3300009176 | Bacteria | 5268 |
| 56 | Ga0105237_10001447 | 3300009545 | Bacteria | 31365 |
| 57 | Ga0105237_10002246 | 3300009545 | Bacteria | 24061 |
| 58 | Ga0105237_10014277 | 3300009545 | Bacteria | 8317 |
| 59 | Ga0105237_10036475 | 3300009545 | Bacteria | 4975 |
| 60 | Ga0105237_11311820 | 3300009545 | Bacteria | 730 |
| 61 | Ga0105238_10134383 | 3300009551 | Bacteria | 2451 |
| 62 | Ga0105238_10587429 | 3300009551 | Bacteria | 1121 |
| 63 | Ga0105239_10009550 | 3300010375 | Bacteria | 10916 |
| 64 | Ga0105239_10011559 | 3300010375 | Bacteria | 9848 |
| 65 | Ga0105239_10026857 | 3300010375 | Bacteria | 6336 |
| 66 | Ga0105239_10043544 | 3300010375 | Bacteria | 4921 |
| 67 | Ga0105239_10537545 | 3300010375 | Unclassified | 1330 |
| 68 | Ga0105246_10031234 | 3300011119 | Bacteria | 3523 |
| 69 | Ga0157373_10000161 | 3300013100 | Bacteria | 54194 |
| 70 | Ga0157373_10022321 | 3300013100 | Bacteria | 4591 |
| 71 | Ga0157373_10317502 | 3300013100 | Bacteria | 1108 |
| 72 | Ga0157371_10000009 | 3300013102 | Bacteria | 392895 |
| 73 | Ga0157371_10003015 | 3300013102 | Bacteria | 15633 |
| 74 | Ga0157371_10032676 | 3300013102 | Bacteria | 3743 |
| 75 | Ga0157369_10000006 | 3300013105 | Bacteria | 412230 |
| 76 | Ga0157369_10000165 | 3300013105 | Bacteria | 93924 |
| 77 | Ga0157369_10198778 | 3300013105 | Bacteria | 2105 |
| 78 | Ga0157374_10001618 | 3300013296 | Bacteria | 18887 |
| 79 | Ga0157374_10006545 | 3300013296 | Bacteria | 9895 |
| 80 | Ga0157374_10157830 | 3300013296 | Bacteria | 2208 |
| 81 | Ga0163162_10000064 | 3300013306 | Bacteria | 103542 |
| 82 | Ga0157372_10000021 | 3300013307 | Bacteria | 207801 |
| 83 | Ga0157372_10002309 | 3300013307 | Bacteria | 20685 |
| 84 | Ga0157372_10013159 | 3300013307 | Bacteria | 8828 |
| 85 | Ga0157372_10070389 | 3300013307 | Bacteria | 3936 |
| 86 | Ga0157375_10032794 | 3300013308 | Bacteria | 4929 |
| 87 | Ga0157375_11153758 | 3300013308 | Bacteria | 908 |
| 88 | Ga0182008_10000968 | 3300014497 | Bacteria | 19953 |
| 89 | Ga0157377_10008517 | 3300014745 | Bacteria | 5005 |
| 90 | Ga0182006_1000322 | 3300015261 | Bacteria | 41718 |
| 91 | Ga0182006_1000980 | 3300015261 | Bacteria | 18826 |
| 92 | Ga0182007_10000001 | 3300015262 | Bacteria | 1127301 |
| 93 | Ga0182007_10057343 | 3300015262 | Bacteria | 1278 |
| 94 | Ga0183373_1010 | 3300015682 | Bacteria | 196982 |
| 95 | Ga0163161_10000871 | 3300017792 | Bacteria | 23503 |
| 96 | Ga0163161_10001231 | 3300017792 | Bacteria | 19197 |
| 97 | Ga0209437_100024 | 3300025233 | Bacteria | 592878 |
| 98 | Ga0209026_1000351 | 3300025250 | Bacteria | 43657 |
| 99 | Ga0209026_1004155 | 3300025250 | Bacteria | 4433 |
| 100 | Ga0207642_10013913 | 3300025899 | Bacteria | 2952 |
| 101 | Ga0207647_10000093 | 3300025904 | Bacteria | 68094 |
| 102 | Ga0207645_10000652 | 3300025907 | Bacteria | 28838 |
| 103 | Ga0207705_10000069 | 3300025909 | Bacteria | 133094 |
| 104 | Ga0207705_10089782 | 3300025909 | Unclassified | 2249 |
| 105 | Ga0207654_10003795 | 3300025911 | Bacteria | 7619 |
| 106 | Ga0207654_10038362 | 3300025911 | Bacteria | 2687 |
| 107 | Ga0207654_10084923 | 3300025911 | Bacteria | 1915 |
| 108 | Ga0207695_10003137 | 3300025913 | Bacteria | 23613 |
| 109 | Ga0207695_10029276 | 3300025913 | Bacteria | 6090 |
| 110 | Ga0207695_10088439 | 3300025913 | Bacteria | 3118 |
| 111 | Ga0207695_10273224 | 3300025913 | Unclassified | 1585 |
| 112 | Ga0207671_10001726 | 3300025914 | Bacteria | 24605 |
| 113 | Ga0207671_10015797 | 3300025914 | Bacteria | 5892 |
| 114 | Ga0207671_10027517 | 3300025914 | Bacteria | 4251 |
| 115 | Ga0207671_10056473 | 3300025914 | Bacteria | 2909 |
| 116 | Ga0207657_10073377 | 3300025919 | Bacteria | 2892 |
| 117 | Ga0207694_10020911 | 3300025924 | Bacteria | 4955 |
| 118 | Ga0207644_10008482 | 3300025931 | Bacteria | 6728 |
| 119 | Ga0207690_10528610 | 3300025932 | Bacteria | 957 |
| 120 | Ga0207706_10000243 | 3300025933 | Bacteria | 59842 |
| 121 | Ga0207686_10034475 | 3300025934 | Bacteria | 3030 |
| 122 | Ga0207704_10000046 | 3300025938 | Bacteria | 86187 |
| 123 | Ga0207689_10887337 | 3300025942 | Bacteria | 752 |
| 124 | Ga0207661_10013224 | 3300025944 | Bacteria | 6027 |
| 125 | Ga0207667_10000037 | 3300025949 | Bacteria | 297252 |
| 126 | Ga0207667_10009468 | 3300025949 | Bacteria | 11471 |
| 127 | Ga0207667_10009667 | 3300025949 | Bacteria | 11342 |
| 128 | Ga0207651_10204612 | 3300025960 | Bacteria | 1584 |
| 129 | Ga0207640_10092963 | 3300025981 | Bacteria | 2094 |
| 130 | Ga0207677_10063171 | 3300026023 | Bacteria | 2573 |
| 131 | Ga0207677_10216854 | 3300026023 | Unclassified | 1532 |
| 132 | Ga0207703_10030189 | 3300026035 | Bacteria | 4282 |
| 133 | Ga0207678_10059222 | 3300026067 | Bacteria | 3295 |
| 134 | Ga0207702_10001849 | 3300026078 | Bacteria | 20848 |
| 135 | Ga0207702_10050709 | 3300026078 | Bacteria | 3504 |
| 136 | Ga0207702_10303377 | 3300026078 | Unclassified | 1516 |
| 137 | Ga0207702_10443063 | 3300026078 | Bacteria | 1259 |
| 138 | Ga0207648_10000257 | 3300026089 | Bacteria | 57438 |
| 139 | Ga0207698_10089483 | 3300026142 | Bacteria | 2514 |
| 140 | Ga0207698_10282019 | 3300026142 | Bacteria | 1537 |
| 141 | Ga0268266_10000078 | 3300028379 | Bacteria | 213632 |
| 142 | Ga0307517_10010505 | 3300028786 | Bacteria | 12953 |
| 143 | Ga0307515_10000778 | 3300028794 | Bacteria | 73451 |
| 144 | Ga0307515_10003029 | 3300028794 | Bacteria | 35637 |
| 145 | Ga0265338_10009944 | 3300028800 | Bacteria | 11246 |
| 146 | Ga0307405_10000010 | 3300031731 | Bacteria | 250978 |
| 147 | Ga0307407_10000009 | 3300031903 | Bacteria | 188746 |
| 148 | Ga0307409_100228071 | 3300031995 | Bacteria | 1686 |
| 149 | Ga0307416_100000019 | 3300032002 | Bacteria | 199706 |
| 150 | Ga0307414_10015067 | 3300032004 | Bacteria | 4658 |
| 151 | Ga0307414_10125168 | 3300032004 | Bacteria | 1984 |
| 152 | Ga0307507_10002030 | 3300033179 | Bacteria | 43887 |
| 153 | Ga0307510_10001211 | 3300033180 | Bacteria | 27977 |
| 154 | Ga0373941_0048633 | 3300035115 | Bacteria | 1340 |
| 155 | Ga0395899_0000950 | 3300037312 | Bacteria | 27103 |
| 156 | Ga0395899_0001041 | 3300037312 | Bacteria | 25172 |
| 157 | Ga0395900_0000014 | 3300037418 | Bacteria | 386513 |
| 158 | Ga0395900_0002099 | 3300037418 | Bacteria | 22311 |
| 159 | Ga0395905_0000037 | 3300037471 | Bacteria | 261808 |
| 160 | Ga0395901_0000117 | 3300038443 | Bacteria | 105071 |
| 161 | Ga0436361_0191006 | 3300039447 | Bacteria | 14062 |
| 162 | Ga0439448_0015050 | 3300042005 | Bacteria | 2340 |
| 163 | Ga0466966_0022747 | 3300044684 | Bacteria | 4109 |
| 164 | Ga0466961_0011441 | 3300044693 | Bacteria | 5675 |
| 165 | Ga0466958_0122508 | 3300045836 | Bacteria | 1629 |
| 166 | Ga0495585_0002645 | 3300046492 | Bacteria | 12593 |
| 167 | Ga0495596_0045613 | 3300046500 | Bacteria | 1723 |
| 168 | Ga0495610_0000028 | 3300046512 | Bacteria | 272572 |
| 169 | Ga0495610_0000740 | 3300046512 | Bacteria | 30997 |
| 170 | Ga0495631_0014272 | 3300046518 | Bacteria | 3838 |
| 171 | Ga0495644_0012803 | 3300046523 | Bacteria | 3225 |
| 172 | Ga0495609_0197214 | 3300046538 | Bacteria | 843 |
| 173 | Ga0495668_0000003 | 3300046616 | Bacteria | 695023 |
| 174 | Ga0495625_0000846 | 3300046660 | Bacteria | 41815 |
| 175 | Ga0495625_0152124 | 3300046660 | Bacteria | 1555 |
| 176 | Ga0495625_0273650 | 3300046660 | Bacteria | 1089 |
| 177 | Ga0495658_0024033 | 3300046683 | Bacteria | 3241 |
| 178 | Ga0495687_001036 | 3300047443 | Bacteria | 27592 |
| 179 | Ga0495614_0017370 | 3300048089 | Bacteria | 3126 |
| 180 | Ga0496115_0309439 | 3300048918 | Bacteria | 1294 |
| 181 | Ga0501240_000262 | 3300049673 | Bacteria | 3994 |
| 182 | Ga0501243_015402 | 3300049675 | Bacteria | 1229 |
| 183 | Ga0500608_000329 | 3300053122 | Bacteria | 18275 |
| 184 | Ga0500624_001540 | 3300053157 | Bacteria | 3598 |
| 185 | 2586207499 | 2585427687 | Bacteria | 5544917 |
| 186 | 2738853945 | 2738541302 | Bacteria | 5944758 |
| 187 | 2739305485 | 2738543023 | Bacteria | 6767879 |
| 188 | 2739588442 | 2739367651 | Bacteria | 6359826 |
| 189 | 2819548169 | 2818991437 | Bacteria | 5805520 |
| 190 | 2842723588 | 2842722452 | Bacteria | 6263924 |
| 191 | 2842910094 | 2842909656 | Bacteria | 6185908 |
| 192 | 2946000579 | 2945997725 | Bacteria | 6404843 |
| 193 | 2954017315 | 2954016120 | Bacteria | 6446024 |
| 194 | JGI24736J21556_1010501 | |||
| 195 | JGI24737J22298_10072511 | |||
| 196 | JGI25157J39369_1005024 | |||
| 197 | JGI25157J39369_1010341 | |||
| 198 | rootH1_10045277 | |||
| 199 | rootH2_10025473 | |||
| 200 | rootH2_10057091 | |||
| 201 | rootH1_10055144 | |||
| 202 | Ga0065714_10002310 | |||
| 203 | Ga0065714_10065129 | |||
| 204 | Ga0070658_10000019 | |||
| 205 | Ga0070676_10000165 | |||
| 206 | Ga0070683_100006104 | |||
| 207 | Ga0068869_100074875 | |||
| 208 | Ga0068869_100933906 | |||
| 209 | Ga0068868_100035335 | |||
| 210 | Ga0070660_100065188 | |||
| 211 | Ga0070660_100495809 | |||
| 212 | Ga0070671_100007630 | |||
| 213 | Ga0070673_100026243 | |||
| 214 | Ga0070659_100245066 | |||
| 215 | Ga0070663_100472304 | |||
| 216 | Ga0070662_100000185 | |||
| 217 | Ga0068867_100001301 | |||
| 218 | Ga0070665_100000003 | |||
| 219 | Ga0068855_100000196 | |||
| 220 | Ga0068855_100000519 | |||
| 221 | Ga0068855_100084823 | |||
| 222 | Ga0068855_100099457 | |||
| 223 | Ga0068855_100247955 | |||
| 224 | Ga0068855_100524175 | |||
| 225 | Ga0068854_100177864 | |||
| 226 | Ga0068856_100000092 | |||
| 227 | Ga0068856_100002099 | |||
| 228 | Ga0068856_100307822 | |||
| 229 | Ga0068856_100545961 | |||
| 230 | Ga0068852_100000372 | |||
| 231 | Ga0068852_100648159 | |||
| 232 | Ga0068866_10098331 | |||
| 233 | Ga0097621_100000054 | |||
| 234 | Ga0097621_100238200 | |||
| 235 | Ga0068871_100000145 | |||
| 236 | Ga0068871_100162549 | |||
| 237 | Ga0068865_100000051 | |||
| 238 | Ga0105240_10035851 | |||
| 239 | Ga0105240_10036520 | |||
| 240 | Ga0105240_10039015 | |||
| 241 | Ga0105240_10241301 | |||
| 242 | Ga0105240_10282455 | |||
| 243 | Ga0105240_10356391 | |||
| 244 | Ga0105240_10962451 | |||
| 245 | Ga0105241_10021131 | |||
| 246 | Ga0105241_10023476 | |||
| 247 | Ga0105241_10026541 | |||
| 248 | Ga0105242_10019823 | |||
| 249 | Ga0105237_10001447 | |||
| 250 | Ga0105237_10002246 | |||
| 251 | Ga0105237_10014277 | |||
| 252 | Ga0105237_10036475 | |||
| 253 | Ga0105237_11311820 | |||
| 254 | Ga0105238_10134383 | |||
| 255 | Ga0105238_10587429 | |||
| 256 | Ga0105239_10009550 | |||
| 257 | Ga0105239_10011559 | |||
| 258 | Ga0105239_10026857 | |||
| 259 | Ga0105239_10043544 | |||
| 260 | Ga0105239_10537545 | |||
| 261 | Ga0105246_10031234 | |||
| 262 | Ga0157373_10000161 | |||
| 263 | Ga0157373_10022321 | |||
| 264 | Ga0157373_10317502 | |||
| 265 | Ga0157371_10000009 | |||
| 266 | Ga0157371_10003015 | |||
| 267 | Ga0157371_10032676 | |||
| 268 | Ga0157369_10000006 | |||
| 269 | Ga0157369_10000165 | |||
| 270 | Ga0157369_10198778 | |||
| 271 | Ga0157374_10001618 | |||
| 272 | Ga0157374_10006545 | |||
| 273 | Ga0157374_10157830 | |||
| 274 | Ga0163162_10000064 | |||
| 275 | Ga0157372_10000021 | |||
| 276 | Ga0157372_10002309 | |||
| 277 | Ga0157372_10013159 | |||
| 278 | Ga0157372_10070389 | |||
| 279 | Ga0157375_10032794 | |||
| 280 | Ga0157375_11153758 | |||
| 281 | Ga0182008_10000968 | |||
| 282 | Ga0157377_10008517 | |||
| 283 | Ga0182006_1000322 | |||
| 284 | Ga0182006_1000980 | |||
| 285 | Ga0182007_10000001 | |||
| 286 | Ga0182007_10057343 | |||
| 287 | Ga0183373_1010 | |||
| 288 | Ga0163161_10000871 | |||
| 289 | Ga0163161_10001231 | |||
| 290 | Ga0209437_100024 | |||
| 291 | Ga0209026_1000351 | |||
| 292 | Ga0209026_1004155 | |||
| 293 | Ga0207642_10013913 | |||
| 294 | Ga0207647_10000093 | |||
| 295 | Ga0207645_10000652 | |||
| 296 | Ga0207705_10000069 | |||
| 297 | Ga0207705_10089782 | |||
| 298 | Ga0207654_10003795 | |||
| 299 | Ga0207654_10038362 | |||
| 300 | Ga0207654_10084923 | |||
| 301 | Ga0207695_10003137 | |||
| 302 | Ga0207695_10029276 | |||
| 303 | Ga0207695_10088439 | |||
| 304 | Ga0207695_10273224 | |||
| 305 | Ga0207671_10001726 | |||
| 306 | Ga0207671_10015797 | |||
| 307 | Ga0207671_10027517 | |||
| 308 | Ga0207671_10056473 | |||
| 309 | Ga0207657_10073377 | |||
| 310 | Ga0207694_10020911 | |||
| 311 | Ga0207644_10008482 | |||
| 312 | Ga0207690_10528610 | |||
| 313 | Ga0207706_10000243 | |||
| 314 | Ga0207686_10034475 | |||
| 315 | Ga0207704_10000046 | |||
| 316 | Ga0207689_10887337 | |||
| 317 | Ga0207661_10013224 | |||
| 318 | Ga0207667_10000037 | |||
| 319 | Ga0207667_10009468 | |||
| 320 | Ga0207667_10009667 | |||
| 321 | Ga0207651_10204612 | |||
| 322 | Ga0207640_10092963 | |||
| 323 | Ga0207677_10063171 | |||
| 324 | Ga0207677_10216854 | |||
| 325 | Ga0207703_10030189 | |||
| 326 | Ga0207678_10059222 | |||
| 327 | Ga0207702_10001849 | |||
| 328 | Ga0207702_10050709 | |||
| 329 | Ga0207702_10303377 | |||
| 330 | Ga0207702_10443063 | |||
| 331 | Ga0207648_10000257 | |||
| 332 | Ga0207698_10089483 | |||
| 333 | Ga0207698_10282019 | |||
| 334 | Ga0268266_10000078 | |||
| 335 | Ga0307517_10010505 | |||
| 336 | Ga0307515_10000778 | |||
| 337 | Ga0307515_10003029 | |||
| 338 | Ga0265338_10009944 | |||
| 339 | Ga0307405_10000010 | |||
| 340 | Ga0307407_10000009 | |||
| 341 | Ga0307409_100228071 | |||
| 342 | Ga0307416_100000019 | |||
| 343 | Ga0307414_10015067 | |||
| 344 | Ga0307414_10125168 | |||
| 345 | Ga0307507_10002030 | |||
| 346 | Ga0307510_10001211 | |||
| 347 | Ga0373941_0048633 | |||
| 348 | Ga0395899_0000950 | |||
| 349 | Ga0395899_0001041 | |||
| 350 | Ga0395900_0000014 | |||
| 351 | Ga0395900_0002099 | |||
| 352 | Ga0395905_0000037 | |||
| 353 | Ga0395901_0000117 | |||
| 354 | Ga0436361_0191006 | |||
| 355 | Ga0439448_0015050 | |||
| 356 | Ga0466966_0022747 | |||
| 357 | Ga0466961_0011441 | |||
| 358 | Ga0466958_0122508 | |||
| 359 | Ga0495585_0002645 | |||
| 360 | Ga0495596_0045613 | |||
| 361 | Ga0495610_0000028 | |||
| 362 | Ga0495610_0000740 | |||
| 363 | Ga0495631_0014272 | |||
| 364 | Ga0495644_0012803 | |||
| 365 | Ga0495609_0197214 | |||
| 366 | Ga0495668_0000003 | |||
| 367 | Ga0495625_0000846 | |||
| 368 | Ga0495625_0152124 | |||
| 369 | Ga0495625_0273650 | |||
| 370 | Ga0495658_0024033 | |||
| 371 | Ga0495687_001036 | |||
| 372 | Ga0495614_0017370 | |||
| 373 | Ga0496115_0309439 | |||
| 374 | Ga0501240_000262 | |||
| 375 | Ga0501243_015402 | |||
| 376 | Ga0500608_000329 | |||
| 377 | Ga0500624_001540 | |||
| 378 | 2586207499 | |||
| 379 | 2738853945 | |||
| 380 | 2739305485 | |||
| 381 | 2739588442 | |||
| 382 | 2819548169 | |||
| 383 | 2842723588 | |||
| 384 | 2842910094 | |||
| 385 | 2946000579 | |||
| 386 | 2954017315 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6e06-assembly2.cif.gz_D | crystal structure of mycobacterium tuberculosis dethiobiotin synthetase in complex with cytidine triphosphate solved by precipitant-ligand exchange (crystals grown in citrate precipitant) | 0.8458 | 5 | 203 |
| 3fmf-assembly2.cif.gz_C | crystal structure of mycobacterium tuberculosis dethiobiotin synthetase complexed with 7,8 diaminopelargonic acid carbamate | 0.8376 | 1 | 203 |
| 3fmf-assembly2.cif.gz_C | crystal structure of mycobacterium tuberculosis dethiobiotin synthetase complexed with 7,8 diaminopelargonic acid carbamate | 0.83 | 1 | 203 |
| 6e06-assembly2.cif.gz_D | crystal structure of mycobacterium tuberculosis dethiobiotin synthetase in complex with cytidine triphosphate solved by precipitant-ligand exchange (crystals grown in citrate precipitant) | 0.823 | 5 | 203 |
| 1a82-assembly1.cif.gz_A | dethiobiotin synthetase from escherichia coli, complex with substrates atp and diaminopelargonic acid | 0.8144 | 5 | 202 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D8PS31_1_209_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9036 | 5 | 202 | 3.40.50.300 |
| af_P53630_6_233_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8857 | 1 | 202 | 3.40.50.300 |
| af_A0A1D8PS31_1_209_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8739 | 5 | 202 | 3.40.50.300 |
| af_P53630_6_233_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8735 | 1 | 202 | 3.40.50.300 |
| 3fmfB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8413 | 1 | 203 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520B828-F1-model_v4 | Dethiobiotin synthase (EC 6.3.3.3) | 0.9858 | 24 | 204 |
GO:0000287
GO:0004141 GO:0005524 GO:0005829 GO:0009102 |
| AF-A0A800F242-F1-model_v4 | ATP-dependent dethiobiotin synthetase BioD | 0.9822 | 98 | 200 |
GO:0000287
GO:0004141 GO:0005524 GO:0005829 GO:0009102 |
| AF-A0A369QGQ2-F1-model_v4 | ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) | 0.9805 | 5 | 200 |
GO:0000287
GO:0004141 GO:0005524 GO:0005829 GO:0009102 |
| AF-R9GVC4-F1-model_v4 | ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) | 0.9789 | 5 | 204 |
GO:0000287
GO:0004141 GO:0005524 GO:0005829 GO:0009102 |
| AF-A0A3D5KKC3-F1-model_v4 | ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) | 0.9789 | 6 | 200 |
GO:0000287
GO:0004141 GO:0005524 GO:0005829 GO:0009102 |