F296463

General Info

Members Datasets Scaffolds Average Seq Length
193 121 386 203

Family's Representative Sequence

Representative Sequence 3300001904|JGI24736J21556_1010501|JGI24736J21556_10105012
Length 205
Sequence MTSKKPLFVTGIGTXIGKTIVSAILVEKLKADYWKPIQSGDLDKSDSVSVENLISNTITKIHPENYRLTQPFSPHKSAAIDGITIDPDTIHLPNTTNTLIVEGAGGLMVPLNNEFLIIDLIKKLGIEVVLVSQNYLGSINHTLLSIHALKYYDISIRGIIFNGIEDISSKDFILKNSGLKLLGHIPEYKLIDKEVIIGAGNYIDL

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
46 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
47 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
50 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
51 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
78 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
86 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
87 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
93 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
98 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
101 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
102 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
103 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
106 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
107 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
108 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
109 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
110 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
111 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
112 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
113 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
114 2738541302 Pedobacter sp. CF074 Isolate Unclassified
115 2738543023 Pedobacter sp. OK628 Isolate Unclassified
116 2739367651 Pedobacter sp. OK291 Isolate Unclassified
117 2818991437 Pedobacter terrae 518 Isolate Unclassified
118 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
119 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
120 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
121 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.34
Metatranscriptomes 0
Isolates 4.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.55
Nodule 0
Rhizoplane 0.52
Rhizosphere 88.08
Stem 0
Stem Tuber 0
Unclassified 5.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1010501 3300001904 Bacteria 1512
2 JGI24737J22298_10072511 3300001990 Unclassified 1028
3 JGI25157J39369_1005024 3300002741 Bacteria 2236
4 JGI25157J39369_1010341 3300002741 Bacteria 1230
5 rootH1_10045277 3300003316 Bacteria 2407
6 rootH2_10025473 3300003320 Bacteria 20163
7 rootH2_10057091 3300003320 Bacteria 2029
8 rootH1_10055144 3300003323 Bacteria 7652
9 Ga0065714_10002310 3300005288 Bacteria 37379
10 Ga0065714_10065129 3300005288 Bacteria 12658
11 Ga0070658_10000019 3300005327 Bacteria 194742
12 Ga0070676_10000165 3300005328 Bacteria 26705
13 Ga0070683_100006104 3300005329 Bacteria 10102
14 Ga0068869_100074875 3300005334 Unclassified 2514
15 Ga0068869_100933906 3300005334 Bacteria 752
16 Ga0068868_100035335 3300005338 Bacteria 3863
17 Ga0070660_100065188 3300005339 Bacteria 2835
18 Ga0070660_100495809 3300005339 Unclassified 1016
19 Ga0070671_100007630 3300005355 Bacteria 8653
20 Ga0070673_100026243 3300005364 Bacteria 4301
21 Ga0070659_100245066 3300005366 Bacteria 1484
22 Ga0070663_100472304 3300005455 Bacteria 1037
23 Ga0070662_100000185 3300005457 Bacteria 36147
24 Ga0068867_100001301 3300005459 Bacteria 17246
25 Ga0070665_100000003 3300005548 Bacteria 811857
26 Ga0068855_100000196 3300005563 Bacteria 78135
27 Ga0068855_100000519 3300005563 Bacteria 47297
28 Ga0068855_100084823 3300005563 Bacteria 3666
29 Ga0068855_100099457 3300005563 Bacteria 3350
30 Ga0068855_100247955 3300005563 Bacteria 1987
31 Ga0068855_100524175 3300005563 Bacteria 1285
32 Ga0068854_100177864 3300005578 Bacteria 1660
33 Ga0068856_100000092 3300005614 Bacteria 84781
34 Ga0068856_100002099 3300005614 Bacteria 20660
35 Ga0068856_100307822 3300005614 Unclassified 1602
36 Ga0068856_100545961 3300005614 Bacteria 1180
37 Ga0068852_100000372 3300005616 Bacteria 30292
38 Ga0068852_100648159 3300005616 Bacteria 1063
39 Ga0068866_10098331 3300005718 Bacteria 1609
40 Ga0097621_100000054 3300006237 Bacteria 59756
41 Ga0097621_100238200 3300006237 Bacteria 1590
42 Ga0068871_100000145 3300006358 Bacteria 46320
43 Ga0068871_100162549 3300006358 Bacteria 1910
44 Ga0068865_100000051 3300006881 Bacteria 65346
45 Ga0105240_10035851 3300009093 Bacteria 6388
46 Ga0105240_10036520 3300009093 Bacteria 6319
47 Ga0105240_10039015 3300009093 Bacteria 6086
48 Ga0105240_10241301 3300009093 Unclassified 2095
49 Ga0105240_10282455 3300009093 Bacteria 1906
50 Ga0105240_10356391 3300009093 Bacteria 1658
51 Ga0105240_10962451 3300009093 Bacteria 915
52 Ga0105241_10021131 3300009174 Bacteria 4812
53 Ga0105241_10023476 3300009174 Bacteria 4574
54 Ga0105241_10026541 3300009174 Bacteria 4310
55 Ga0105242_10019823 3300009176 Bacteria 5268
56 Ga0105237_10001447 3300009545 Bacteria 31365
57 Ga0105237_10002246 3300009545 Bacteria 24061
58 Ga0105237_10014277 3300009545 Bacteria 8317
59 Ga0105237_10036475 3300009545 Bacteria 4975
60 Ga0105237_11311820 3300009545 Bacteria 730
61 Ga0105238_10134383 3300009551 Bacteria 2451
62 Ga0105238_10587429 3300009551 Bacteria 1121
63 Ga0105239_10009550 3300010375 Bacteria 10916
64 Ga0105239_10011559 3300010375 Bacteria 9848
65 Ga0105239_10026857 3300010375 Bacteria 6336
66 Ga0105239_10043544 3300010375 Bacteria 4921
67 Ga0105239_10537545 3300010375 Unclassified 1330
68 Ga0105246_10031234 3300011119 Bacteria 3523
69 Ga0157373_10000161 3300013100 Bacteria 54194
70 Ga0157373_10022321 3300013100 Bacteria 4591
71 Ga0157373_10317502 3300013100 Bacteria 1108
72 Ga0157371_10000009 3300013102 Bacteria 392895
73 Ga0157371_10003015 3300013102 Bacteria 15633
74 Ga0157371_10032676 3300013102 Bacteria 3743
75 Ga0157369_10000006 3300013105 Bacteria 412230
76 Ga0157369_10000165 3300013105 Bacteria 93924
77 Ga0157369_10198778 3300013105 Bacteria 2105
78 Ga0157374_10001618 3300013296 Bacteria 18887
79 Ga0157374_10006545 3300013296 Bacteria 9895
80 Ga0157374_10157830 3300013296 Bacteria 2208
81 Ga0163162_10000064 3300013306 Bacteria 103542
82 Ga0157372_10000021 3300013307 Bacteria 207801
83 Ga0157372_10002309 3300013307 Bacteria 20685
84 Ga0157372_10013159 3300013307 Bacteria 8828
85 Ga0157372_10070389 3300013307 Bacteria 3936
86 Ga0157375_10032794 3300013308 Bacteria 4929
87 Ga0157375_11153758 3300013308 Bacteria 908
88 Ga0182008_10000968 3300014497 Bacteria 19953
89 Ga0157377_10008517 3300014745 Bacteria 5005
90 Ga0182006_1000322 3300015261 Bacteria 41718
91 Ga0182006_1000980 3300015261 Bacteria 18826
92 Ga0182007_10000001 3300015262 Bacteria 1127301
93 Ga0182007_10057343 3300015262 Bacteria 1278
94 Ga0183373_1010 3300015682 Bacteria 196982
95 Ga0163161_10000871 3300017792 Bacteria 23503
96 Ga0163161_10001231 3300017792 Bacteria 19197
97 Ga0209437_100024 3300025233 Bacteria 592878
98 Ga0209026_1000351 3300025250 Bacteria 43657
99 Ga0209026_1004155 3300025250 Bacteria 4433
100 Ga0207642_10013913 3300025899 Bacteria 2952
101 Ga0207647_10000093 3300025904 Bacteria 68094
102 Ga0207645_10000652 3300025907 Bacteria 28838
103 Ga0207705_10000069 3300025909 Bacteria 133094
104 Ga0207705_10089782 3300025909 Unclassified 2249
105 Ga0207654_10003795 3300025911 Bacteria 7619
106 Ga0207654_10038362 3300025911 Bacteria 2687
107 Ga0207654_10084923 3300025911 Bacteria 1915
108 Ga0207695_10003137 3300025913 Bacteria 23613
109 Ga0207695_10029276 3300025913 Bacteria 6090
110 Ga0207695_10088439 3300025913 Bacteria 3118
111 Ga0207695_10273224 3300025913 Unclassified 1585
112 Ga0207671_10001726 3300025914 Bacteria 24605
113 Ga0207671_10015797 3300025914 Bacteria 5892
114 Ga0207671_10027517 3300025914 Bacteria 4251
115 Ga0207671_10056473 3300025914 Bacteria 2909
116 Ga0207657_10073377 3300025919 Bacteria 2892
117 Ga0207694_10020911 3300025924 Bacteria 4955
118 Ga0207644_10008482 3300025931 Bacteria 6728
119 Ga0207690_10528610 3300025932 Bacteria 957
120 Ga0207706_10000243 3300025933 Bacteria 59842
121 Ga0207686_10034475 3300025934 Bacteria 3030
122 Ga0207704_10000046 3300025938 Bacteria 86187
123 Ga0207689_10887337 3300025942 Bacteria 752
124 Ga0207661_10013224 3300025944 Bacteria 6027
125 Ga0207667_10000037 3300025949 Bacteria 297252
126 Ga0207667_10009468 3300025949 Bacteria 11471
127 Ga0207667_10009667 3300025949 Bacteria 11342
128 Ga0207651_10204612 3300025960 Bacteria 1584
129 Ga0207640_10092963 3300025981 Bacteria 2094
130 Ga0207677_10063171 3300026023 Bacteria 2573
131 Ga0207677_10216854 3300026023 Unclassified 1532
132 Ga0207703_10030189 3300026035 Bacteria 4282
133 Ga0207678_10059222 3300026067 Bacteria 3295
134 Ga0207702_10001849 3300026078 Bacteria 20848
135 Ga0207702_10050709 3300026078 Bacteria 3504
136 Ga0207702_10303377 3300026078 Unclassified 1516
137 Ga0207702_10443063 3300026078 Bacteria 1259
138 Ga0207648_10000257 3300026089 Bacteria 57438
139 Ga0207698_10089483 3300026142 Bacteria 2514
140 Ga0207698_10282019 3300026142 Bacteria 1537
141 Ga0268266_10000078 3300028379 Bacteria 213632
142 Ga0307517_10010505 3300028786 Bacteria 12953
143 Ga0307515_10000778 3300028794 Bacteria 73451
144 Ga0307515_10003029 3300028794 Bacteria 35637
145 Ga0265338_10009944 3300028800 Bacteria 11246
146 Ga0307405_10000010 3300031731 Bacteria 250978
147 Ga0307407_10000009 3300031903 Bacteria 188746
148 Ga0307409_100228071 3300031995 Bacteria 1686
149 Ga0307416_100000019 3300032002 Bacteria 199706
150 Ga0307414_10015067 3300032004 Bacteria 4658
151 Ga0307414_10125168 3300032004 Bacteria 1984
152 Ga0307507_10002030 3300033179 Bacteria 43887
153 Ga0307510_10001211 3300033180 Bacteria 27977
154 Ga0373941_0048633 3300035115 Bacteria 1340
155 Ga0395899_0000950 3300037312 Bacteria 27103
156 Ga0395899_0001041 3300037312 Bacteria 25172
157 Ga0395900_0000014 3300037418 Bacteria 386513
158 Ga0395900_0002099 3300037418 Bacteria 22311
159 Ga0395905_0000037 3300037471 Bacteria 261808
160 Ga0395901_0000117 3300038443 Bacteria 105071
161 Ga0436361_0191006 3300039447 Bacteria 14062
162 Ga0439448_0015050 3300042005 Bacteria 2340
163 Ga0466966_0022747 3300044684 Bacteria 4109
164 Ga0466961_0011441 3300044693 Bacteria 5675
165 Ga0466958_0122508 3300045836 Bacteria 1629
166 Ga0495585_0002645 3300046492 Bacteria 12593
167 Ga0495596_0045613 3300046500 Bacteria 1723
168 Ga0495610_0000028 3300046512 Bacteria 272572
169 Ga0495610_0000740 3300046512 Bacteria 30997
170 Ga0495631_0014272 3300046518 Bacteria 3838
171 Ga0495644_0012803 3300046523 Bacteria 3225
172 Ga0495609_0197214 3300046538 Bacteria 843
173 Ga0495668_0000003 3300046616 Bacteria 695023
174 Ga0495625_0000846 3300046660 Bacteria 41815
175 Ga0495625_0152124 3300046660 Bacteria 1555
176 Ga0495625_0273650 3300046660 Bacteria 1089
177 Ga0495658_0024033 3300046683 Bacteria 3241
178 Ga0495687_001036 3300047443 Bacteria 27592
179 Ga0495614_0017370 3300048089 Bacteria 3126
180 Ga0496115_0309439 3300048918 Bacteria 1294
181 Ga0501240_000262 3300049673 Bacteria 3994
182 Ga0501243_015402 3300049675 Bacteria 1229
183 Ga0500608_000329 3300053122 Bacteria 18275
184 Ga0500624_001540 3300053157 Bacteria 3598
185 2586207499 2585427687 Bacteria 5544917
186 2738853945 2738541302 Bacteria 5944758
187 2739305485 2738543023 Bacteria 6767879
188 2739588442 2739367651 Bacteria 6359826
189 2819548169 2818991437 Bacteria 5805520
190 2842723588 2842722452 Bacteria 6263924
191 2842910094 2842909656 Bacteria 6185908
192 2946000579 2945997725 Bacteria 6404843
193 2954017315 2954016120 Bacteria 6446024
194 JGI24736J21556_1010501
195 JGI24737J22298_10072511
196 JGI25157J39369_1005024
197 JGI25157J39369_1010341
198 rootH1_10045277
199 rootH2_10025473
200 rootH2_10057091
201 rootH1_10055144
202 Ga0065714_10002310
203 Ga0065714_10065129
204 Ga0070658_10000019
205 Ga0070676_10000165
206 Ga0070683_100006104
207 Ga0068869_100074875
208 Ga0068869_100933906
209 Ga0068868_100035335
210 Ga0070660_100065188
211 Ga0070660_100495809
212 Ga0070671_100007630
213 Ga0070673_100026243
214 Ga0070659_100245066
215 Ga0070663_100472304
216 Ga0070662_100000185
217 Ga0068867_100001301
218 Ga0070665_100000003
219 Ga0068855_100000196
220 Ga0068855_100000519
221 Ga0068855_100084823
222 Ga0068855_100099457
223 Ga0068855_100247955
224 Ga0068855_100524175
225 Ga0068854_100177864
226 Ga0068856_100000092
227 Ga0068856_100002099
228 Ga0068856_100307822
229 Ga0068856_100545961
230 Ga0068852_100000372
231 Ga0068852_100648159
232 Ga0068866_10098331
233 Ga0097621_100000054
234 Ga0097621_100238200
235 Ga0068871_100000145
236 Ga0068871_100162549
237 Ga0068865_100000051
238 Ga0105240_10035851
239 Ga0105240_10036520
240 Ga0105240_10039015
241 Ga0105240_10241301
242 Ga0105240_10282455
243 Ga0105240_10356391
244 Ga0105240_10962451
245 Ga0105241_10021131
246 Ga0105241_10023476
247 Ga0105241_10026541
248 Ga0105242_10019823
249 Ga0105237_10001447
250 Ga0105237_10002246
251 Ga0105237_10014277
252 Ga0105237_10036475
253 Ga0105237_11311820
254 Ga0105238_10134383
255 Ga0105238_10587429
256 Ga0105239_10009550
257 Ga0105239_10011559
258 Ga0105239_10026857
259 Ga0105239_10043544
260 Ga0105239_10537545
261 Ga0105246_10031234
262 Ga0157373_10000161
263 Ga0157373_10022321
264 Ga0157373_10317502
265 Ga0157371_10000009
266 Ga0157371_10003015
267 Ga0157371_10032676
268 Ga0157369_10000006
269 Ga0157369_10000165
270 Ga0157369_10198778
271 Ga0157374_10001618
272 Ga0157374_10006545
273 Ga0157374_10157830
274 Ga0163162_10000064
275 Ga0157372_10000021
276 Ga0157372_10002309
277 Ga0157372_10013159
278 Ga0157372_10070389
279 Ga0157375_10032794
280 Ga0157375_11153758
281 Ga0182008_10000968
282 Ga0157377_10008517
283 Ga0182006_1000322
284 Ga0182006_1000980
285 Ga0182007_10000001
286 Ga0182007_10057343
287 Ga0183373_1010
288 Ga0163161_10000871
289 Ga0163161_10001231
290 Ga0209437_100024
291 Ga0209026_1000351
292 Ga0209026_1004155
293 Ga0207642_10013913
294 Ga0207647_10000093
295 Ga0207645_10000652
296 Ga0207705_10000069
297 Ga0207705_10089782
298 Ga0207654_10003795
299 Ga0207654_10038362
300 Ga0207654_10084923
301 Ga0207695_10003137
302 Ga0207695_10029276
303 Ga0207695_10088439
304 Ga0207695_10273224
305 Ga0207671_10001726
306 Ga0207671_10015797
307 Ga0207671_10027517
308 Ga0207671_10056473
309 Ga0207657_10073377
310 Ga0207694_10020911
311 Ga0207644_10008482
312 Ga0207690_10528610
313 Ga0207706_10000243
314 Ga0207686_10034475
315 Ga0207704_10000046
316 Ga0207689_10887337
317 Ga0207661_10013224
318 Ga0207667_10000037
319 Ga0207667_10009468
320 Ga0207667_10009667
321 Ga0207651_10204612
322 Ga0207640_10092963
323 Ga0207677_10063171
324 Ga0207677_10216854
325 Ga0207703_10030189
326 Ga0207678_10059222
327 Ga0207702_10001849
328 Ga0207702_10050709
329 Ga0207702_10303377
330 Ga0207702_10443063
331 Ga0207648_10000257
332 Ga0207698_10089483
333 Ga0207698_10282019
334 Ga0268266_10000078
335 Ga0307517_10010505
336 Ga0307515_10000778
337 Ga0307515_10003029
338 Ga0265338_10009944
339 Ga0307405_10000010
340 Ga0307407_10000009
341 Ga0307409_100228071
342 Ga0307416_100000019
343 Ga0307414_10015067
344 Ga0307414_10125168
345 Ga0307507_10002030
346 Ga0307510_10001211
347 Ga0373941_0048633
348 Ga0395899_0000950
349 Ga0395899_0001041
350 Ga0395900_0000014
351 Ga0395900_0002099
352 Ga0395905_0000037
353 Ga0395901_0000117
354 Ga0436361_0191006
355 Ga0439448_0015050
356 Ga0466966_0022747
357 Ga0466961_0011441
358 Ga0466958_0122508
359 Ga0495585_0002645
360 Ga0495596_0045613
361 Ga0495610_0000028
362 Ga0495610_0000740
363 Ga0495631_0014272
364 Ga0495644_0012803
365 Ga0495609_0197214
366 Ga0495668_0000003
367 Ga0495625_0000846
368 Ga0495625_0152124
369 Ga0495625_0273650
370 Ga0495658_0024033
371 Ga0495687_001036
372 Ga0495614_0017370
373 Ga0496115_0309439
374 Ga0501240_000262
375 Ga0501243_015402
376 Ga0500608_000329
377 Ga0500624_001540
378 2586207499
379 2738853945
380 2739305485
381 2739588442
382 2819548169
383 2842723588
384 2842910094
385 2946000579
386 2954017315

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13500

AAA_26

AAA domain

5

195

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6e06-assembly2.cif.gz_D crystal structure of mycobacterium tuberculosis dethiobiotin synthetase in complex with cytidine triphosphate solved by precipitant-ligand exchange (crystals grown in citrate precipitant) 0.8458 5 203
3fmf-assembly2.cif.gz_C crystal structure of mycobacterium tuberculosis dethiobiotin synthetase complexed with 7,8 diaminopelargonic acid carbamate 0.8376 1 203
3fmf-assembly2.cif.gz_C crystal structure of mycobacterium tuberculosis dethiobiotin synthetase complexed with 7,8 diaminopelargonic acid carbamate 0.83 1 203
6e06-assembly2.cif.gz_D crystal structure of mycobacterium tuberculosis dethiobiotin synthetase in complex with cytidine triphosphate solved by precipitant-ligand exchange (crystals grown in citrate precipitant) 0.823 5 203
1a82-assembly1.cif.gz_A dethiobiotin synthetase from escherichia coli, complex with substrates atp and diaminopelargonic acid 0.8144 5 202
ID Description Score Start End Superfamily
af_A0A1D8PS31_1_209_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9036 5 202 3.40.50.300
af_P53630_6_233_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8857 1 202 3.40.50.300
af_A0A1D8PS31_1_209_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8739 5 202 3.40.50.300
af_P53630_6_233_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8735 1 202 3.40.50.300
3fmfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8413 1 203 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A520B828-F1-model_v4 Dethiobiotin synthase (EC 6.3.3.3) 0.9858 24 204 GO:0000287
GO:0004141
GO:0005524
GO:0005829
GO:0009102
AF-A0A800F242-F1-model_v4 ATP-dependent dethiobiotin synthetase BioD 0.9822 98 200 GO:0000287
GO:0004141
GO:0005524
GO:0005829
GO:0009102
AF-A0A369QGQ2-F1-model_v4 ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) 0.9805 5 200 GO:0000287
GO:0004141
GO:0005524
GO:0005829
GO:0009102
AF-R9GVC4-F1-model_v4 ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) 0.9789 5 204 GO:0000287
GO:0004141
GO:0005524
GO:0005829
GO:0009102
AF-A0A3D5KKC3-F1-model_v4 ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) 0.9789 6 200 GO:0000287
GO:0004141
GO:0005524
GO:0005829
GO:0009102

Map