F296622

General Info

Members Datasets Scaffolds Average Seq Length
193 147 190 168

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10284167|Ga0070658_102841672
Length 184
Sequence VSTVIDWFDNLPRRVLALVAVACVCLLAFGMYLQLVVGLNPCPMCIVQRYALIIVAVIAGVTAMFKSRRAWITGGVLAVLVGGFGAFVAARQSWLQWYPPEVASCGRDFYGMIENFPLKRAIPMIFKGSGDCTKVDWTFLGGSIANWSFLWFCFIVLVSLVLITRQMGTSRALRPNAVPTHRAA

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
3 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
49 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
50 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
51 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
52 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
53 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
54 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
79 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
80 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
81 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
82 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
83 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
84 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
91 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
92 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
100 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
101 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
102 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
109 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
115 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
116 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
117 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
120 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
121 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
122 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
123 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
135 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
136 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
137 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
138 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
139 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
140 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
141 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
142 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
143 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
144 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
145 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
146 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
147 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.45
Metatranscriptomes 0
Isolates 1.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.42
Nodule 0
Rhizoplane 0.52
Rhizosphere 65.8
Stem 0
Stem Tuber 0
Unclassified 7.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000095 3300002704 Bacteria 49917
2 JGI25156J39149_1000025 3300002705 Bacteria 136287
3 JGI25154J39366_1000045 3300002738 Bacteria 136302
4 JGI25157J39369_1000034 3300002741 Bacteria 136301
5 JGI25150J39212_1006697 3300002774 Bacteria 2360
6 JGI25150J39212_1010400 3300002774 Bacteria 1732
7 JGI25159J45721_1002245 3300002987 Bacteria 7462
8 JGI25151J46595_10006281 3300003187 Bacteria 5999
9 JGI25160J50197_1000321 3300003354 Bacteria 33340
10 JGI25161J50226_1000070 3300003374 Bacteria 89592
11 Ga0055526_1008277 3300003771 Bacteria 5217
12 Ga0055537_1007538 3300003773 Bacteria 2615
13 Ga0055530_10014596 3300003791 Bacteria 2607
14 Ga0055540_1003349 3300003792 Bacteria 7786
15 Ga0055531_10000280 3300003794 Bacteria 52101
16 Ga0055543_1000368 3300004625 Bacteria 29830
17 Ga0065165_1005130 3300005262 Bacteria 7583
18 Ga0065165_1011496 3300005262 Bacteria 3685
19 Ga0065165_1028985 3300005262 Bacteria 1779
20 Ga0065714_10124490 3300005288 Bacteria 1310
21 Ga0070658_10284167 3300005327 Bacteria 1409
22 Ga0070658_10400052 3300005327 Bacteria 1179
23 Ga0070670_100092746 3300005331 Bacteria 2597
24 Ga0070674_100015873 3300005356 Bacteria 4711
25 Ga0070659_100348081 3300005366 Bacteria 1243
26 Ga0070714_100152475 3300005435 Bacteria 2084
27 Ga0070681_10188892 3300005458 Bacteria 1980
28 Ga0068867_100642606 3300005459 Bacteria 930
29 Ga0070679_100165534 3300005530 Bacteria 2185
30 Ga0070672_100184604 3300005543 Bacteria 1739
31 Ga0068855_100774053 3300005563 Bacteria 1022
32 Ga0068856_100076766 3300005614 Bacteria 3310
33 Ga0068852_101837432 3300005616 Bacteria 628
34 Ga0068863_100196311 3300005841 Bacteria 1940
35 Ga0068862_100359750 3300005844 Bacteria 1352
36 Ga0075365_10022474 3300006038 Bacteria 3952
37 Ga0075368_10130160 3300006042 Bacteria 1046
38 Ga0075366_10018354 3300006195 Bacteria 4038
39 Ga0075370_10036776 3300006353 Bacteria 2751
40 Ga0105240_10012766 3300009093 Bacteria 11577
41 Ga0105240_10564770 3300009093 Bacteria 1257
42 Ga0105241_10079842 3300009174 Bacteria 2559
43 Ga0105248_10913880 3300009177 Bacteria 991
44 Ga0105238_10492367 3300009551 Bacteria 1226
45 Ga0105239_10671806 3300010375 Bacteria 1184
46 Ga0157326_1029528 3300012513 Bacteria 719
47 Ga0157374_10682089 3300013296 Bacteria 1040
48 Ga0157378_10206436 3300013297 Bacteria 1861
49 Ga0157378_11191325 3300013297 Unclassified 801
50 Ga0157376_10111120 3300014969 Bacteria 2412
51 Ga0157376_11252529 3300014969 Bacteria 771
52 Ga0209435_100001 3300025206 Bacteria 1424171
53 Ga0209436_111211 3300025208 Bacteria 1589
54 Ga0207425_1001345 3300025245 Bacteria 10522
55 Ga0209646_1000001 3300025246 Bacteria 3092932
56 Ga0209026_1000003 3300025250 Bacteria 1060571
57 Ga0209759_1000001 3300025256 Bacteria 2799452
58 Ga0209565_1001987 3300025263 Bacteria 7972
59 Ga0209130_1000166 3300025284 Bacteria 96473
60 Ga0209675_1002477 3300025291 Bacteria 9469
61 Ga0209025_1016301 3300025294 Bacteria 4400
62 Ga0209564_1008126 3300025295 Bacteria 5249
63 Ga0209050_1004306 3300025298 Bacteria 9722
64 Ga0207426_1000025 3300025302 Bacteria 532921
65 Ga0209051_1000406 3300025303 Bacteria 59626
66 Ga0209257_1000012 3300025304 Bacteria 1111138
67 Ga0207642_10376521 3300025899 Bacteria 844
68 Ga0207705_10243619 3300025909 Bacteria 1370
69 Ga0207705_10333680 3300025909 Bacteria 1166
70 Ga0207695_10268889 3300025913 Bacteria 1601
71 Ga0207652_10051453 3300025921 Bacteria 3531
72 Ga0207681_10024600 3300025923 Bacteria 3866
73 Ga0207650_10176830 3300025925 Bacteria 1699
74 Ga0207687_10320763 3300025927 Bacteria 1254
75 Ga0207664_10041343 3300025929 Bacteria 3591
76 Ga0207690_10354922 3300025932 Bacteria 1160
77 Ga0207667_10118750 3300025949 Bacteria 2725
78 Ga0207667_10583279 3300025949 Bacteria 1128
79 Ga0207640_11580029 3300025981 Bacteria 591
80 Ga0207639_10119871 3300026041 Bacteria 2160
81 Ga0207702_10039516 3300026078 Bacteria 3954
82 Ga0207702_10511928 3300026078 Bacteria 1171
83 Ga0207641_10175502 3300026088 Bacteria 1959
84 Ga0207674_10681092 3300026116 Bacteria 993
85 Ga0265319_1077682 3300028563 Bacteria 1057
86 Ga0307515_10224674 3300028794 Bacteria 1686
87 Ga0265330_10020192 3300031235 Bacteria 3045
88 Ga0265332_10000128 3300031238 Bacteria 63543
89 Ga0265332_10035459 3300031238 Bacteria 2166
90 Ga0265329_10037565 3300031242 Bacteria 1560
91 Ga0265331_10033306 3300031250 Bacteria 2548
92 Ga0265316_10161517 3300031344 Bacteria 1675
93 Ga0265316_10685117 3300031344 Bacteria 723
94 Ga0307513_10000014 3300031456 Bacteria 303157
95 Ga0307513_10549891 3300031456 Bacteria 867
96 Ga0307408_100000177 3300031548 Bacteria 71449
97 Ga0307408_100958733 3300031548 Bacteria 786
98 Ga0265314_10053561 3300031711 Bacteria 2797
99 Ga0265342_10085748 3300031712 Bacteria 1812
100 Ga0307416_101499467 3300032002 Bacteria 780
101 Ga0373946_0249246 3300035171 Bacteria 866
102 Ga0373931_0542013 3300035691 Bacteria 755
103 Ga0373935_0334064 3300035692 Bacteria 1078
104 Ga0373937_1101616 3300036401 Bacteria 743
105 Ga0395899_0002226 3300037312 Bacteria 15895
106 Ga0395899_0003234 3300037312 Bacteria 12924
107 Ga0395899_0429139 3300037312 Bacteria 869
108 Ga0395900_0023488 3300037418 Bacteria 6310
109 Ga0395900_0089528 3300037418 Bacteria 3163
110 Ga0395900_0269689 3300037418 Bacteria 1697
111 Ga0395900_0490789 3300037418 Bacteria 1180
112 Ga0395900_1314241 3300037418 Bacteria 637
113 Ga0395898_0327984 3300037466 Bacteria 1460
114 Ga0395905_0000339 3300037471 Bacteria 66527
115 Ga0395905_0010004 3300037471 Bacteria 9243
116 Ga0395905_0019689 3300037471 Bacteria 6396
117 Ga0395905_0019696 3300037471 Bacteria 6395
118 Ga0395905_0022900 3300037471 Bacteria 5904
119 Ga0395905_0027546 3300037471 Bacteria 5359
120 Ga0395905_0046316 3300037471 Bacteria 4077
121 Ga0395905_0124974 3300037471 Bacteria 2419
122 Ga0395905_0147125 3300037471 Bacteria 2216
123 Ga0395905_0164094 3300037471 Bacteria 2087
124 Ga0395905_0379979 3300037471 Bacteria 1306
125 Ga0395905_0550643 3300037471 Bacteria 1055
126 Ga0395901_0281681 3300038443 Bacteria 1727
127 Ga0395901_0303416 3300038443 Bacteria 1655
128 Ga0395901_0431524 3300038443 Bacteria 1350
129 Ga0451791_0730515 3300041451 Bacteria 879
130 Ga0451833_0282584 3300041491 Bacteria 646
131 Ga0439445_0005773 3300042004 Bacteria 2828
132 Ga0450911_000121 3300042115 Bacteria 31301
133 Ga0451577_0045585 3300042876 Bacteria 3925
134 Ga0451577_0046903 3300042876 Bacteria 3864
135 Ga0466972_0301642 3300044658 Bacteria 748
136 Ga0453683_0003282 3300044673 Bacteria 12011
137 Ga0466965_0041786 3300044683 Bacteria 2260
138 Ga0466966_0053549 3300044684 Bacteria 2560
139 Ga0466966_0140119 3300044684 Bacteria 1478
140 Ga0453684_1596217 3300044712 Bacteria 670
141 Ga0466971_0197522 3300044719 Bacteria 949
142 Ga0466957_0247260 3300044842 Bacteria 1185
143 Ga0466960_0242505 3300044901 Bacteria 998
144 Ga0466959_0268208 3300045049 Bacteria 1174
145 Ga0466959_0384463 3300045049 Bacteria 955
146 Ga0451576_0535678 3300045051 Bacteria 1230
147 Ga0451576_0572931 3300045051 Bacteria 1186
148 Ga0451576_0601810 3300045051 Bacteria 1155
149 Ga0451576_0980832 3300045051 Bacteria 886
150 Ga0495650_0070838 3300046471 Bacteria 1368
151 Ga0495643_0028093 3300046522 Bacteria 3156
152 Ga0495642_0062502 3300046528 Bacteria 1546
153 Ga0495656_0450119 3300046615 Bacteria 678
154 Ga0495657_0244925 3300046675 Bacteria 1081
155 Ga0495669_0070061 3300046684 Bacteria 1597
156 Ga0495602_0957908 3300048088 Bacteria 567
157 Ga0496124_0023567 3300048927 Bacteria 5618
158 Ga0496125_0004501 3300048928 Bacteria 16030
159 Ga0501032_0210142 3300049569 Bacteria 1269
160 Ga0501036_0945960 3300049572 Bacteria 706
161 Ga0501037_0354832 3300049573 Bacteria 1011
162 Ga0501043_0649861 3300049579 Bacteria 775
163 Ga0501046_0395694 3300049580 Bacteria 998
164 Ga0501047_0408454 3300049581 Bacteria 1190
165 Ga0501048_0234272 3300049582 Bacteria 1303
166 Ga0501080_0023279 3300049742 Bacteria 5743
167 Ga0501044_0270730 3300049823 Bacteria 1634
168 Ga0501044_0390541 3300049823 Bacteria 1305
169 nmdc:mga03n38_67688_c1 3300050490 Bacteria 1644
170 nmdc:mga0yw44_104533_c1 3300050492 Bacteria 1808
171 nmdc:mga0k408_21249_c1 3300050493 Bacteria 3644
172 nmdc:mga0k408_295671_c1 3300050493 Bacteria 966
173 Ga0500643_082812 3300053087 Bacteria 880
174 Ga0500651_0018365 3300053093 Bacteria 4328
175 Ga0500650_0004219 3300053098 Bacteria 5162
176 Ga0500562_027704 3300053108 Bacteria 1487
177 Ga0500593_000429 3300053117 Bacteria 16647
178 Ga0500608_111963 3300053122 Bacteria 1250
179 Ga0500618_120070 3300053125 Bacteria 595
180 Ga0500559_0026918 3300053136 Bacteria 2452
181 Ga0500559_0030235 3300053136 Bacteria 2321
182 Ga0500573_0058008 3300053140 Bacteria 2220
183 Ga0500604_0093674 3300053151 Bacteria 984
184 Ga0500645_000059 3300053730 Bacteria 91141
185 Ga0500645_003754 3300053730 Bacteria 6054
186 Ga0500645_010792 3300053730 Bacteria 3005
187 Ga0500645_054906 3300053730 Bacteria 1158
188 Ga0500661_023014 3300055283 Bacteria 1103
189 Ga0500661_073547 3300055283 Bacteria 627
190 Ga0466962_0113747 3300061719 Bacteria 1304

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_1314241 Ga0395900_1314241_159_623 140
2 3300037418 Ga0395900_0269689 Ga0395900_0269689_1059_1601 144
3 3300037471 Ga0395905_0046316 Ga0395905_0046316_246_788 144
4 3300038443 Ga0395901_0431524 Ga0395901_0431524_569_1111 144
5 3300005841 Ga0068863_100196311 Ga0068863_1001963112 145
6 3300005844 Ga0068862_100359750 Ga0068862_1003597502 145
7 3300009177 Ga0105248_10913880 Ga0105248_109138802 145
8 3300025925 Ga0207650_10176830 Ga0207650_101768302 145
9 3300026088 Ga0207641_10175502 Ga0207641_101755022 145
10 3300005614 Ga0068856_100076766 Ga0068856_1000767664 146
11 3300026078 Ga0207702_10039516 Ga0207702_100395164 146
12 3300003187 JGI25151J46595_10006281 JGI25151J46595_100062813 147
13 3300005262 Ga0065165_1028985 Ga0065165_10289853 147
14 3300009174 Ga0105241_10079842 Ga0105241_100798422 147
15 3300013296 Ga0157374_10682089 Ga0157374_106820891 147
16 3300014969 Ga0157376_10111120 Ga0157376_101111202 147
17 3300025927 Ga0207687_10320763 Ga0207687_103207632 147
18 3300037418 Ga0395900_0490789 Ga0395900_0490789_614_1141 147
19 3300049580 Ga0501046_0395694 Ga0501046_0395694_152_679 148
20 3300049742 Ga0501080_0023279 Ga0501080_0023279_2490_3017 148
21 3300005563 Ga0068855_100774053 Ga0068855_1007740533 150
22 3300010375 Ga0105239_10671806 Ga0105239_106718061 150
23 3300013297 Ga0157378_10206436 Ga0157378_102064362 150
24 3300014969 Ga0157376_11252529 Ga0157376_112525292 150
25 3300025949 Ga0207667_10583279 Ga0207667_105832792 150
26 3300005366 Ga0070659_100348081 Ga0070659_1003480812 151
27 3300025932 Ga0207690_10354922 Ga0207690_103549222 151
28 3300045049 Ga0466959_0268208 Ga0466959_0268208_278_814 151
29 3300005435 Ga0070714_100152475 Ga0070714_1001524752 152
30 3300005458 Ga0070681_10188892 Ga0070681_101888922 152
31 3300005530 Ga0070679_100165534 Ga0070679_1001655342 152
32 3300009093 Ga0105240_10012766 Ga0105240_1001276612 152
33 3300009551 Ga0105238_10492367 Ga0105238_104923672 152
34 3300025913 Ga0207695_10268889 Ga0207695_102688892 152
35 3300025921 Ga0207652_10051453 Ga0207652_100514534 152
36 3300025929 Ga0207664_10041343 Ga0207664_100413434 152
37 3300025949 Ga0207667_10118750 Ga0207667_101187502 152
38 3300026078 Ga0207702_10511928 Ga0207702_105119282 152
39 3300031235 Ga0265330_10020192 Ga0265330_100201922 152
40 3300031238 Ga0265332_10035459 Ga0265332_100354592 152
41 3300031242 Ga0265329_10037565 Ga0265329_100375652 152
42 3300031250 Ga0265331_10033306 Ga0265331_100333062 152
43 3300031344 Ga0265316_10161517 Ga0265316_101615172 152
44 3300031711 Ga0265314_10053561 Ga0265314_100535612 152
45 3300032002 Ga0307416_101499467 Ga0307416_1014994672 152
46 3300026041 Ga0207639_10119871 Ga0207639_101198712 153
47 3300031548 Ga0307408_100000177 Ga0307408_10000017751 153
48 3300049579 Ga0501043_0649861 Ga0501043_0649861_222_749 153
49 3300049581 Ga0501047_0408454 Ga0501047_0408454_321_848 153
50 3300049823 Ga0501044_0270730 Ga0501044_0270730_881_1408 153
51 3300050492 nmdc:mga0yw44_104533_c1 nmdc:mga0yw44_104533_c1_90_617 153
52 3300006042 Ga0075368_10130160 Ga0075368_101301602 154
53 3300044658 Ga0466972_0301642 Ga0466972_0301642_86_610 154
54 3300044683 Ga0466965_0041786 Ga0466965_0041786_1536_2060 154
55 3300044901 Ga0466960_0242505 Ga0466960_0242505_341_865 154
56 3300050490 nmdc:mga03n38_67688_c1 nmdc:mga03n38_67688_c1_419_949 154
57 3300053122 Ga0500608_111963 Ga0500608_111963_385_888 155
58 3300053125 Ga0500618_120070 Ga0500618_120070_12_515 155
59 3300053136 Ga0500559_0026918 Ga0500559_0026918_1005_1508 155
60 3300053730 Ga0500645_003754 Ga0500645_003754_2526_3032 159
61 3300028563 Ga0265319_1077682 Ga0265319_10776822 161
62 3300031344 Ga0265316_10685117 Ga0265316_106851172 161
63 3300037466 Ga0395898_0327984 Ga0395898_0327984_185_706 161
64 3300013297 Ga0157378_11191325 Ga0157378_111913252 162
65 iso_pu_bacteria 2881101125 2881101891 163
66 iso_pu_bacteria 2511231002 2511243748 164
67 3300005356 Ga0070674_100015873 Ga0070674_1000158733 165
68 3300005459 Ga0068867_100642606 Ga0068867_1006426062 165
69 3300005543 Ga0070672_100184604 Ga0070672_1001846042 165
70 3300025981 Ga0207640_11580029 Ga0207640_115800291 165
71 3300046471 Ga0495650_0070838 Ga0495650_0070838_526_1023 165
72 3300046522 Ga0495643_0028093 Ga0495643_0028093_1996_2493 165
73 3300037471 Ga0395905_0027546 Ga0395905_0027546_4388_4930 166
74 3300042876 Ga0451577_0046903 Ga0451577_0046903_546_1055 166
75 3300045051 Ga0451576_0980832 Ga0451576_0980832_326_847 166
76 3300006195 Ga0075366_10018354 Ga0075366_100183543 167
77 3300025923 Ga0207681_10024600 Ga0207681_100246002 167
78 3300035171 Ga0373946_0249246 Ga0373946_0249246_143_646 167
79 3300035691 Ga0373931_0542013 Ga0373931_0542013_228_740 167
80 3300035692 Ga0373935_0334064 Ga0373935_0334064_216_719 167
81 3300036401 Ga0373937_1101616 Ga0373937_1101616_165_668 167
82 3300037471 Ga0395905_0019689 Ga0395905_0019689_1433_1954 167
83 3300037471 Ga0395905_0022900 Ga0395905_0022900_2496_3020 167
84 3300038443 Ga0395901_0281681 Ga0395901_0281681_740_1261 167
85 3300041491 Ga0451833_0282584 Ga0451833_0282584_102_605 167
86 3300045051 Ga0451576_0572931 Ga0451576_0572931_312_839 167
87 3300046528 Ga0495642_0062502 Ga0495642_0062502_708_1238 167
88 3300046615 Ga0495656_0450119 Ga0495656_0450119_44_574 167
89 3300046684 Ga0495669_0070061 Ga0495669_0070061_741_1271 167
90 3300048088 Ga0495602_0957908 Ga0495602_0957908_24_527 167
91 3300050493 nmdc:mga0k408_21249_c1 nmdc:mga0k408_21249_c1_319_822 167
92 3300053136 Ga0500559_0030235 Ga0500559_0030235_601_1104 167
93 3300053140 Ga0500573_0058008 Ga0500573_0058008_642_1145 167
94 iso_pu_bacteria 2939631187 2939632018 167
95 3300002704 JGI25155J39150_1000095 JGI25155J39150_100009510 168
96 3300002705 JGI25156J39149_1000025 JGI25156J39149_1000025114 168
97 3300002738 JGI25154J39366_1000045 JGI25154J39366_1000045114 168
98 3300002741 JGI25157J39369_1000034 JGI25157J39369_1000034114 168
99 3300002774 JGI25150J39212_1006697 JGI25150J39212_10066974 168
100 3300002774 JGI25150J39212_1010400 JGI25150J39212_10104002 168
101 3300002987 JGI25159J45721_1002245 JGI25159J45721_10022458 168
102 3300003354 JGI25160J50197_1000321 JGI25160J50197_100032111 168
103 3300003374 JGI25161J50226_1000070 JGI25161J50226_100007078 168
104 3300003771 Ga0055526_1008277 Ga0055526_10082773 168
105 3300003773 Ga0055537_1007538 Ga0055537_10075382 168
106 3300003791 Ga0055530_10014596 Ga0055530_100145962 168
107 3300003792 Ga0055540_1003349 Ga0055540_10033493 168
108 3300003794 Ga0055531_10000280 Ga0055531_100002802 168
109 3300004625 Ga0055543_1000368 Ga0055543_100036811 168
110 3300005262 Ga0065165_1005130 Ga0065165_10051305 168
111 3300005262 Ga0065165_1011496 Ga0065165_10114963 168
112 3300005288 Ga0065714_10124490 Ga0065714_101244901 168
113 3300005327 Ga0070658_10284167 Ga0070658_102841672 168
114 3300005327 Ga0070658_10400052 Ga0070658_104000521 168
115 3300005331 Ga0070670_100092746 Ga0070670_1000927462 168
116 3300005616 Ga0068852_101837432 Ga0068852_1018374321 168
117 3300006038 Ga0075365_10022474 Ga0075365_100224742 168
118 3300006353 Ga0075370_10036776 Ga0075370_100367763 168
119 3300009093 Ga0105240_10564770 Ga0105240_105647702 168
120 3300012513 Ga0157326_1029528 Ga0157326_10295282 168
121 3300025206 Ga0209435_100001 Ga0209435_100001868 168
122 3300025208 Ga0209436_111211 Ga0209436_1112112 168
123 3300025245 Ga0207425_1001345 Ga0207425_10013457 168
124 3300025246 Ga0209646_1000001 Ga0209646_10000011237 168
125 3300025250 Ga0209026_1000003 Ga0209026_1000003868 168
126 3300025256 Ga0209759_1000001 Ga0209759_1000001868 168
127 3300025263 Ga0209565_1001987 Ga0209565_10019874 168
128 3300025284 Ga0209130_1000166 Ga0209130_100016611 168
129 3300025291 Ga0209675_1002477 Ga0209675_10024774 168
130 3300025294 Ga0209025_1016301 Ga0209025_10163016 168
131 3300025295 Ga0209564_1008126 Ga0209564_10081263 168
132 3300025298 Ga0209050_1004306 Ga0209050_10043066 168
133 3300025302 Ga0207426_1000025 Ga0207426_1000025333 168
134 3300025303 Ga0209051_1000406 Ga0209051_100040618 168
135 3300025304 Ga0209257_1000012 Ga0209257_1000012484 168
136 3300025899 Ga0207642_10376521 Ga0207642_103765212 168
137 3300025909 Ga0207705_10243619 Ga0207705_102436192 168
138 3300025909 Ga0207705_10333680 Ga0207705_103336802 168
139 3300026116 Ga0207674_10681092 Ga0207674_106810922 168
140 3300028794 Ga0307515_10224674 Ga0307515_102246742 168
141 3300031238 Ga0265332_10000128 Ga0265332_1000012811 168
142 3300031456 Ga0307513_10000014 Ga0307513_10000014271 168
143 3300031456 Ga0307513_10549891 Ga0307513_105498911 168
144 3300031548 Ga0307408_100958733 Ga0307408_1009587332 168
145 3300031712 Ga0265342_10085748 Ga0265342_100857482 168
146 3300037312 Ga0395899_0002226 Ga0395899_0002226_6197_6727 168
147 3300037312 Ga0395899_0003234 Ga0395899_0003234_175_720 168
148 3300037312 Ga0395899_0429139 Ga0395899_0429139_176_721 168
149 3300037418 Ga0395900_0023488 Ga0395900_0023488_709_1239 168
150 3300037418 Ga0395900_0089528 Ga0395900_0089528_711_1256 168
151 3300037471 Ga0395905_0000339 Ga0395905_0000339_32048_32578 168
152 3300037471 Ga0395905_0010004 Ga0395905_0010004_50_580 168
153 3300037471 Ga0395905_0019696 Ga0395905_0019696_5036_5563 168
154 3300037471 Ga0395905_0124974 Ga0395905_0124974_373_900 168
155 3300037471 Ga0395905_0147125 Ga0395905_0147125_1113_1658 168
156 3300037471 Ga0395905_0164094 Ga0395905_0164094_95_625 168
157 3300037471 Ga0395905_0379979 Ga0395905_0379979_344_883 168
158 3300037471 Ga0395905_0550643 Ga0395905_0550643_145_672 168
159 3300038443 Ga0395901_0303416 Ga0395901_0303416_300_830 168
160 3300041451 Ga0451791_0730515 Ga0451791_0730515_187_693 168
161 3300042004 Ga0439445_0005773 Ga0439445_0005773_591_1097 168
162 3300042115 Ga0450911_000121 Ga0450911_000121_8035_8541 168
163 3300042876 Ga0451577_0045585 Ga0451577_0045585_1310_1837 168
164 3300044673 Ga0453683_0003282 Ga0453683_0003282_7260_7808 168
165 3300044684 Ga0466966_0053549 Ga0466966_0053549_402_947 168
166 3300044684 Ga0466966_0140119 Ga0466966_0140119_441_986 168
167 3300044712 Ga0453684_1596217 Ga0453684_1596217_108_635 168
168 3300044719 Ga0466971_0197522 Ga0466971_0197522_383_928 168
169 3300044842 Ga0466957_0247260 Ga0466957_0247260_118_654 168
170 3300045049 Ga0466959_0384463 Ga0466959_0384463_87_632 168
171 3300045051 Ga0451576_0535678 Ga0451576_0535678_636_1163 168
172 3300045051 Ga0451576_0601810 Ga0451576_0601810_31_579 168
173 3300046675 Ga0495657_0244925 Ga0495657_0244925_439_987 168
174 3300048927 Ga0496124_0023567 Ga0496124_0023567_987_1493 168
175 3300048928 Ga0496125_0004501 Ga0496125_0004501_13437_13943 168
176 3300049569 Ga0501032_0210142 Ga0501032_0210142_248_784 168
177 3300049572 Ga0501036_0945960 Ga0501036_0945960_64_600 168
178 3300049573 Ga0501037_0354832 Ga0501037_0354832_329_865 168
179 3300049582 Ga0501048_0234272 Ga0501048_0234272_59_592 168
180 3300049823 Ga0501044_0390541 Ga0501044_0390541_756_1292 168
181 3300050493 nmdc:mga0k408_295671_c1 nmdc:mga0k408_295671_c1_363_920 168
182 3300053087 Ga0500643_082812 Ga0500643_082812_99_605 168
183 3300053093 Ga0500651_0018365 Ga0500651_0018365_2602_3111 168
184 3300053098 Ga0500650_0004219 Ga0500650_0004219_654_1160 168
185 3300053108 Ga0500562_027704 Ga0500562_027704_56_562 168
186 3300053117 Ga0500593_000429 Ga0500593_000429_12196_12702 168
187 3300053151 Ga0500604_0093674 Ga0500604_0093674_249_755 168
188 3300053730 Ga0500645_000059 Ga0500645_000059_60972_61478 168
189 3300053730 Ga0500645_010792 Ga0500645_010792_602_1108 168
190 3300053730 Ga0500645_054906 Ga0500645_054906_29_535 168
191 3300055283 Ga0500661_023014 Ga0500661_023014_32_538 168
192 3300055283 Ga0500661_073547 Ga0500661_073547_55_603 168
193 3300061719 Ga0466962_0113747 Ga0466962_0113747_665_1207 168

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02600

DsbB

Disulfide bond formation protein DsbB

12

162

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wvf-assembly1.cif.gz_A e.coli dsbb c104s with ubiquinone 0.7265 11 167
5kk2-assembly1.cif.gz_F architecture of fully occupied glua2 ampa receptor - tarp complex elucidated by single particle cryo-electron microscopy 0.7039 42 167
2ltq-assembly1.cif.gz_A high resolution structure of dsbb c41s by joint calculation with solid-state nmr and x-ray data 0.6946 11 159
4p1n-assembly1.cif.gz_A crystal structure of atg1-atg13 complex 0.6924 44 168
7qhb-assembly1.cif.gz_I active state of glua1/2 in complex with tarp gamma 8, l-glutamate and ctz 0.6924 41 167
ID Description Score Start End Superfamily
2zuqA00 Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like 0.7987 11 159 1.20.1550.10
2zuqD00 Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like 0.7974 11 159 1.20.1550.10
2zuqA00 Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like 0.7689 11 159 1.20.1550.10
2zuqD00 Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like 0.7678 11 159 1.20.1550.10
af_Q9SKX2_35_174_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.7214 10 164 1.20.140.40
ID Description Score Start End GO Terms
AF-A0A1F4HSG2-F1-model_v4 Disulfide bond formation protein DsbB 0.9045 9 107 GO:0005886
GO:0006457
GO:0015035
AF-F0GJ53-F1-model_v4 Disulfide bond formation protein B 0.8971 4 106 GO:0005886
GO:0006457
GO:0015035
AF-A0A379XTJ9-F1-model_v4 Disulfide bond formation protein 0.8586 7 162 GO:0006457
GO:0015035
GO:0016020
AF-A0A419GWT5-F1-model_v4 Disulfide bond formation protein B 0.8585 7 96 GO:0006457
GO:0015035
GO:0016020
AF-A0A1G3ZJY5-F1-model_v4 Disulfide bond formation protein DsbB 0.8513 10 168 GO:0006457
GO:0015035
GO:0016020

Feature Viewer

pLDDT pTM Quality
72.32 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map