F297342

General Info

Members Datasets Scaffolds Average Seq Length
193 120 193 475

Family's Representative Sequence

Representative Sequence 3300031238|Ga0265332_10001311|Ga0265332_100013118
Length 514
Sequence MSDAIEPKPKADFLRLATGADAALMRLAIGVVLGLTALRLVFAAMLPLAADEAYYWLWSKHLAGGYYDHPPAVAFVIRAGTLLVGDSELGVRLVSILLALPMTWAVVRTAQILFDNQRVAAWAAILLNLTLMAGVGTLIVTPDAPLLVASAFVLLFLARVLETGQGPWWLAVGAAVGVALLSKYTALFFGVSIVLWLALVPNLRRWLLTPWPYLGGLVALVVFSPVLGWNAQHDWVSLIKQLGRARGDELTLRYLIEVVPVQIGLATPPVFTLGAAGLIAMAYGHGGSRPVRILLGTMAWPLFVYFLWHSLHARVEGNWLGPIYPAFAIAAAVAVVEIPWRGIMRPLVDISRWSAIPFGVGLFGLIGLQAAFGILPVHRDPTARLLGVGWRGVAAEIEAVRTRLGARSVIVTNYGLASWLSFYLPPGIPVVQINERARWVNWPEPWPALFADKVLYVGDADVDNTAWLLTMYGRVEPEGTLSRRRGDLIESYRLDLAQGLKADPLDRTPPPELR

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
83 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
91 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
93 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
97 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
98 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
99 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
105 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
106 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
107 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
108 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
109 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
110 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
111 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
112 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
116 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
117 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
118 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
119 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
120 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.66
Nodule 0
Rhizoplane 0
Rhizosphere 92.75
Stem 0
Stem Tuber 0
Unclassified 2.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000253 3300003214 Bacteria 71909
2 Ga0070658_10009855 3300005327 Bacteria 7676
3 Ga0070658_10029727 3300005327 Unclassified 4391
4 Ga0070676_10022676 3300005328 Unclassified 3522
5 Ga0068869_100073592 3300005334 Unclassified 2534
6 Ga0070666_10000276 3300005335 Bacteria 33925
7 Ga0070666_10019112 3300005335 Bacteria 4419
8 Ga0068868_100066167 3300005338 Unclassified 2873
9 Ga0070660_100108185 3300005339 Bacteria 2209
10 Ga0070661_100056214 3300005344 Unclassified 2883
11 Ga0070675_100013157 3300005354 Bacteria 6502
12 Ga0070673_100025163 3300005364 Bacteria 4376
13 Ga0070667_100017644 3300005367 Bacteria 5914
14 Ga0070667_100026416 3300005367 Bacteria 4829
15 Ga0070713_100081597 3300005436 Bacteria 2760
16 Ga0070678_100013589 3300005456 Bacteria 5112
17 Ga0070678_100025179 3300005456 Bacteria 3998
18 Ga0070681_10000002 3300005458 Bacteria 821814
19 Ga0070681_10066083 3300005458 Bacteria 3585
20 Ga0068867_100006825 3300005459 Bacteria 8071
21 Ga0068867_100012809 3300005459 Bacteria 5934
22 Ga0070679_100003153 3300005530 Bacteria 15062
23 Ga0070679_100005852 3300005530 Bacteria 11410
24 Ga0068853_100019837 3300005539 Bacteria 5584
25 Ga0070665_100001485 3300005548 Bacteria 27386
26 Ga0070665_100007598 3300005548 Bacteria 11022
27 Ga0070665_100077557 3300005548 Bacteria 3329
28 Ga0068855_100000419 3300005563 Bacteria 52708
29 Ga0068855_100010386 3300005563 Bacteria 11231
30 Ga0068855_100014109 3300005563 Bacteria 9629
31 Ga0068855_100074357 3300005563 Bacteria 3947
32 Ga0068856_100050070 3300005614 Bacteria 4117
33 Ga0068852_100012919 3300005616 Bacteria 6368
34 Ga0068852_100117165 3300005616 Unclassified 2432
35 Ga0068852_100287458 3300005616 Bacteria 1587
36 Ga0068859_100331196 3300005617 Unclassified 1617
37 Ga0068858_100026029 3300005842 Bacteria 5441
38 Ga0068860_100281773 3300005843 Bacteria 1624
39 Ga0068862_100031752 3300005844 Bacteria 4461
40 Ga0070712_100071037 3300006175 Bacteria 2490
41 Ga0097621_100001072 3300006237 Bacteria 19118
42 Ga0097621_100012137 3300006237 Bacteria 6375
43 Ga0097621_100092997 3300006237 Bacteria 2526
44 Ga0068871_100001473 3300006358 Bacteria 15779
45 Ga0068865_100027837 3300006881 Bacteria 3738
46 Ga0097620_100331209 3300006931 Unclassified 1617
47 Ga0105240_10000528 3300009093 Bacteria 70421
48 Ga0105240_10002870 3300009093 Bacteria 27247
49 Ga0105240_10012870 3300009093 Bacteria 11526
50 Ga0105245_10033786 3300009098 Bacteria 4533
51 Ga0105247_10003497 3300009101 Bacteria 10220
52 Ga0105243_10005421 3300009148 Bacteria 9955
53 Ga0105241_10014922 3300009174 Bacteria 5688
54 Ga0105241_10080132 3300009174 Bacteria 2555
55 Ga0105242_10016770 3300009176 Bacteria 5700
56 Ga0105242_10029091 3300009176 Bacteria 4404
57 Ga0105248_10000001 3300009177 Bacteria 1881304
58 Ga0105237_10026173 3300009545 Bacteria 5962
59 Ga0105237_10051538 3300009545 Bacteria 4134
60 Ga0105237_10137046 3300009545 Unclassified 2442
61 Ga0105238_10011509 3300009551 Bacteria 8914
62 Ga0105238_10157067 3300009551 Bacteria 2249
63 Ga0105249_10009477 3300009553 Bacteria 8527
64 Ga0105239_10003326 3300010375 Bacteria 19785
65 Ga0105239_10007612 3300010375 Bacteria 12411
66 Ga0105239_10010135 3300010375 Bacteria 10561
67 Ga0105246_10018275 3300011119 Bacteria 4467
68 Ga0157370_10017723 3300013104 Bacteria 7180
69 Ga0157369_10006467 3300013105 Bacteria 13578
70 Ga0157374_10114199 3300013296 Bacteria 2600
71 Ga0157374_10209910 3300013296 Unclassified 1909
72 Ga0163162_10018357 3300013306 Bacteria 6853
73 Ga0157372_10059412 3300013307 Unclassified 4276
74 Ga0157380_10010615 3300014326 Bacteria 6628
75 Ga0157379_10034525 3300014968 Bacteria 4509
76 Ga0157379_10168728 3300014968 Unclassified 1976
77 Ga0213876_10000194 3300021384 Bacteria 63125
78 Ga0209233_1000006 3300025261 Bacteria 1473685
79 Ga0209233_1002426 3300025261 Bacteria 6882
80 Ga0207680_10001634 3300025903 Bacteria 10595
81 Ga0207645_10036023 3300025907 Unclassified 3177
82 Ga0207705_10007908 3300025909 Bacteria 7804
83 Ga0207707_10000002 3300025912 Bacteria 1142054
84 Ga0207707_10025199 3300025912 Bacteria 5202
85 Ga0207695_10000012 3300025913 Bacteria 840961
86 Ga0207695_10001649 3300025913 Bacteria 35962
87 Ga0207695_10053198 3300025913 Bacteria 4235
88 Ga0207695_10252368 3300025913 Unclassified 1663
89 Ga0207693_10039571 3300025915 Bacteria 3713
90 Ga0207660_10040464 3300025917 Bacteria 3263
91 Ga0207657_10032143 3300025919 Bacteria 4745
92 Ga0207649_10069377 3300025920 Bacteria 2244
93 Ga0207652_10000543 3300025921 Bacteria 38199
94 Ga0207652_10008722 3300025921 Bacteria 8160
95 Ga0207694_10000006 3300025924 Bacteria 631109
96 Ga0207687_10024393 3300025927 Bacteria 4041
97 Ga0207700_10108166 3300025928 Unclassified 2232
98 Ga0207686_10077139 3300025934 Bacteria 2163
99 Ga0207711_10000001 3300025941 Bacteria 1325674
100 Ga0207711_10007680 3300025941 Bacteria 9017
101 Ga0207711_10018432 3300025941 Bacteria 5803
102 Ga0207689_10088263 3300025942 Unclassified 2547
103 Ga0207667_10000484 3300025949 Bacteria 52691
104 Ga0207651_10021574 3300025960 Bacteria 3918
105 Ga0207712_10031693 3300025961 Unclassified 3563
106 Ga0207658_10015500 3300025986 Bacteria 5228
107 Ga0207677_10001342 3300026023 Bacteria 13196
108 Ga0207703_10015967 3300026035 Bacteria 5856
109 Ga0207648_10012252 3300026089 Bacteria 8028
110 Ga0207648_10016790 3300026089 Bacteria 6676
111 Ga0207675_100070697 3300026118 Bacteria 3262
112 Ga0207675_100290037 3300026118 Unclassified 1592
113 Ga0207683_10025129 3300026121 Bacteria 5136
114 Ga0207683_10039259 3300026121 Bacteria 4130
115 Ga0207698_10019609 3300026142 Bacteria 4634
116 Ga0207698_10040146 3300026142 Bacteria 3474
117 Ga0268266_10000551 3300028379 Bacteria 52218
118 Ga0268266_10018351 3300028379 Bacteria 5962
119 Ga0268266_10024757 3300028379 Bacteria 5107
120 Ga0268266_10077341 3300028379 Bacteria 2893
121 Ga0268264_10120165 3300028381 Bacteria 2315
122 Ga0265318_10000072 3300028577 Bacteria 96797
123 Ga0265338_10000043 3300028800 Bacteria 226293
124 Ga0265338_10005705 3300028800 Bacteria 16099
125 Ga0265332_10001311 3300031238 Bacteria 14161
126 Ga0265332_10007739 3300031238 Bacteria 4854
127 Ga0265332_10018532 3300031238 Bacteria 3071
128 Ga0265325_10000002 3300031241 Bacteria 396758
129 Ga0265325_10002107 3300031241 Bacteria 13595
130 Ga0265340_10003441 3300031247 Bacteria 8935
131 Ga0265340_10004349 3300031247 Bacteria 7937
132 Ga0265340_10024842 3300031247 Bacteria 3039
133 Ga0265339_10000264 3300031249 Bacteria 42131
134 Ga0265339_10015781 3300031249 Bacteria 4518
135 Ga0265339_10076264 3300031249 Bacteria 1778
136 Ga0265316_10026856 3300031344 Bacteria 4780
137 Ga0265313_10002015 3300031595 Bacteria 18228
138 Ga0265313_10019640 3300031595 Bacteria 3754
139 Ga0265313_10033570 3300031595 Bacteria 2606
140 Ga0265314_10001050 3300031711 Bacteria 32195
141 Ga0265314_10021267 3300031711 Bacteria 4993
142 Ga0265314_10029166 3300031711 Bacteria 4105
143 Ga0265314_10035625 3300031711 Bacteria 3626
144 Ga0265342_10000287 3300031712 Bacteria 57222
145 Ga0265342_10003598 3300031712 Bacteria 12646
146 Ga0265342_10007093 3300031712 Bacteria 8253
147 Ga0307516_10009112 3300031730 Bacteria 11115
148 Ga0307516_10136369 3300031730 Bacteria 2228
149 Ga0373923_0049799 3300035111 Bacteria 1753
150 Ga0373955_0044330 3300035172 Bacteria 2395
151 Ga0373933_0006354 3300035724 Bacteria 6431
152 Ga0436365_0287552 3300039437 Bacteria 53561
153 Ga0466967_0121841 3300045976 Bacteria 2411
154 Ga0495622_0005814 3300046557 Bacteria 5722
155 Ga0496121_0001941 3300048924 Bacteria 32965
156 Ga0495682_0001307 3300049460 Bacteria 13867
157 Ga0501032_0200094 3300049569 Unclassified 1304
158 Ga0501033_0025782 3300049570 Bacteria 4428
159 Ga0501033_0100151 3300049570 Bacteria 2115
160 Ga0501034_0013412 3300049571 Bacteria 8434
161 Ga0501038_0044975 3300049574 Bacteria 3834
162 Ga0501047_0000815 3300049581 Bacteria 32451
163 Ga0501047_0018923 3300049581 Bacteria 6605
164 Ga0501047_0037926 3300049581 Bacteria 4661
165 Ga0501067_0003991 3300049583 Bacteria 8145
166 Ga0501069_0002345 3300049585 Bacteria 9586
167 Ga0501070_0052312 3300049586 Bacteria 3390
168 Ga0501072_0000739 3300049588 Bacteria 23844
169 Ga0501073_0019152 3300049589 Bacteria 4946
170 Ga0501073_0069576 3300049589 Bacteria 2452
171 Ga0501074_0051947 3300049590 Bacteria 2958
172 Ga0501079_0006355 3300049741 Bacteria 8870
173 Ga0501080_0001868 3300049742 Bacteria 18108
174 Ga0501080_0061824 3300049742 Bacteria 3485
175 Ga0501083_0011198 3300049744 Bacteria 6294
176 Ga0501035_0006504 3300049822 Bacteria 10977
177 Ga0501035_0021094 3300049822 Bacteria 5990
178 Ga0501035_0044546 3300049822 Bacteria 3995
179 Ga0501035_0085561 3300049822 Bacteria 2779
180 Ga0501044_0003511 3300049823 Bacteria 17648
181 Ga0501044_0005128 3300049823 Bacteria 14609
182 Ga0501044_0020506 3300049823 Bacteria 7059
183 Ga0501044_0086758 3300049823 Bacteria 3161
184 Ga0501044_0375182 3300049823 Unclassified 1338
185 Ga0500643_000017 3300053087 Bacteria 305781
186 Ga0500655_004777 3300053133 Bacteria 2438
187 Ga0500559_0010364 3300053136 Bacteria 4005
188 Ga0500568_0033732 3300053139 Bacteria 2099
189 Ga0500568_0041614 3300053139 Bacteria 1846
190 Ga0500573_0000026 3300053140 Bacteria 144363
191 Ga0501084_0000033 3300054114 Bacteria 114778
192 Ga0501084_0006676 3300054114 Bacteria 9488
193 Ga0501084_0023653 3300054114 Bacteria 5124

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_0375182 Ga0501044_0375182_12_1322 412
2 3300054114 Ga0501084_0000033 Ga0501084_0000033_61833_63092 413
3 3300049581 Ga0501047_0018923 Ga0501047_0018923_3081_4520 414
4 3300021384 Ga0213876_10000194 Ga0213876_1000019441 417
5 3300039437 Ga0436365_0287552 Ga0436365_0287552_2099_3397 419
6 3300028577 Ga0265318_10000072 Ga0265318_100000726 420
7 3300049569 Ga0501032_0200094 Ga0501032_0200094_19_1290 422
8 3300009176 Ga0105242_10029091 Ga0105242_100290913 426
9 3300025934 Ga0207686_10077139 Ga0207686_100771392 426
10 3300035111 Ga0373923_0049799 Ga0373923_0049799_245_1717 438
11 3300035724 Ga0373933_0006354 Ga0373933_0006354_1645_3117 438
12 3300049822 Ga0501035_0021094 Ga0501035_0021094_3309_4700 448
13 3300049823 Ga0501044_0003511 Ga0501044_0003511_5474_6865 448
14 3300005328 Ga0070676_10022676 Ga0070676_100226765 452
15 3300005334 Ga0068869_100073592 Ga0068869_1000735923 452
16 3300005338 Ga0068868_100066167 Ga0068868_1000661672 452
17 3300005354 Ga0070675_100013157 Ga0070675_1000131572 452
18 3300005364 Ga0070673_100025163 Ga0070673_1000251633 452
19 3300005456 Ga0070678_100013589 Ga0070678_1000135896 452
20 3300005459 Ga0068867_100012809 Ga0068867_1000128098 452
21 3300006881 Ga0068865_100027837 Ga0068865_1000278372 452
22 3300025907 Ga0207645_10036023 Ga0207645_100360232 452
23 3300025927 Ga0207687_10024393 Ga0207687_100243932 452
24 3300025941 Ga0207711_10007680 Ga0207711_1000768010 452
25 3300025942 Ga0207689_10088263 Ga0207689_100882632 452
26 3300025960 Ga0207651_10021574 Ga0207651_100215746 452
27 3300026023 Ga0207677_10001342 Ga0207677_100013428 452
28 3300026089 Ga0207648_10016790 Ga0207648_100167905 452
29 3300026121 Ga0207683_10025129 Ga0207683_100251296 452
30 3300031730 Ga0307516_10009112 Ga0307516_1000911210 454
31 3300031711 Ga0265314_10035625 Ga0265314_100356252 455
32 3300028800 Ga0265338_10000043 Ga0265338_10000043119 456
33 3300031241 Ga0265325_10000002 Ga0265325_10000002268 456
34 3300031249 Ga0265339_10000264 Ga0265339_1000026436 456
35 3300031595 Ga0265313_10002015 Ga0265313_1000201514 456
36 3300031711 Ga0265314_10021267 Ga0265314_100212673 456
37 3300031712 Ga0265342_10003598 Ga0265342_100035986 456
38 3300049571 Ga0501034_0013412 Ga0501034_0013412_2161_3564 456
39 3300049583 Ga0501067_0003991 Ga0501067_0003991_4176_5579 456
40 3300049585 Ga0501069_0002345 Ga0501069_0002345_7273_8676 456
41 3300049590 Ga0501074_0051947 Ga0501074_0051947_251_1654 456
42 3300049742 Ga0501080_0061824 Ga0501080_0061824_1849_3252 456
43 3300049822 Ga0501035_0006504 Ga0501035_0006504_2307_3710 456
44 3300049823 Ga0501044_0005128 Ga0501044_0005128_3367_4770 456
45 3300054114 Ga0501084_0006676 Ga0501084_0006676_7615_9018 456
46 3300005563 Ga0068855_100014109 Ga0068855_1000141098 457
47 3300005842 Ga0068858_100026029 Ga0068858_1000260298 457
48 3300026035 Ga0207703_10015967 Ga0207703_100159674 457
49 3300031730 Ga0307516_10136369 Ga0307516_101363692 457
50 3300035172 Ga0373955_0044330 Ga0373955_0044330_172_1644 457
51 3300005616 Ga0068852_100287458 Ga0068852_1002874581 458
52 3300009177 Ga0105248_10000001 Ga0105248_100000011242 458
53 3300025941 Ga0207711_10000001 Ga0207711_10000001630 458
54 3300026142 Ga0207698_10040146 Ga0207698_100401463 458
55 3300049586 Ga0501070_0052312 Ga0501070_0052312_1273_2688 458
56 3300005458 Ga0070681_10000002 Ga0070681_10000002409 459
57 3300005530 Ga0070679_100003153 Ga0070679_10000315316 459
58 3300010375 Ga0105239_10010135 Ga0105239_100101357 459
59 3300025912 Ga0207707_10000002 Ga0207707_10000002548 459
60 3300025917 Ga0207660_10040464 Ga0207660_100404642 459
61 3300025921 Ga0207652_10000543 Ga0207652_1000054335 459
62 3300031595 Ga0265313_10019640 Ga0265313_100196402 459
63 3300005616 Ga0068852_100012919 Ga0068852_1000129195 460
64 3300009551 Ga0105238_10157067 Ga0105238_101570672 460
65 3300025924 Ga0207694_10000006 Ga0207694_10000006187 460
66 3300026142 Ga0207698_10019609 Ga0207698_100196095 460
67 3300049742 Ga0501080_0001868 Ga0501080_0001868_13429_14850 460
68 3300048924 Ga0496121_0001941 Ga0496121_0001941_9816_11276 461
69 3300005563 Ga0068855_100000419 Ga0068855_10000041934 462
70 3300009093 Ga0105240_10000528 Ga0105240_1000052833 462
71 3300009093 Ga0105240_10002870 Ga0105240_1000287027 462
72 3300009545 Ga0105237_10051538 Ga0105237_100515382 462
73 3300010375 Ga0105239_10003326 Ga0105239_100033266 462
74 3300025913 Ga0207695_10000012 Ga0207695_10000012481 462
75 3300025913 Ga0207695_10001649 Ga0207695_1000164930 462
76 3300025949 Ga0207667_10000484 Ga0207667_1000048433 462
77 3300049460 Ga0495682_0001307 Ga0495682_0001307_2164_3618 462
78 3300049822 Ga0501035_0044546 Ga0501035_0044546_1227_2696 462
79 3300049823 Ga0501044_0086758 Ga0501044_0086758_1678_3147 462
80 3300053133 Ga0500655_004777 Ga0500655_004777_907_2367 464
81 3300025261 Ga0209233_1002426 Ga0209233_10024263 465
82 3300049741 Ga0501079_0006355 Ga0501079_0006355_3011_4456 465
83 3300053087 Ga0500643_000017 Ga0500643_000017_141958_143355 465
84 3300009101 Ga0105247_10003497 Ga0105247_100034971 466
85 3300013105 Ga0157369_10006467 Ga0157369_100064678 466
86 3300031241 Ga0265325_10002107 Ga0265325_1000210713 466
87 3300031247 Ga0265340_10024842 Ga0265340_100248421 466
88 3300031595 Ga0265313_10033570 Ga0265313_100335702 466
89 3300031711 Ga0265314_10001050 Ga0265314_1000105025 466
90 3300031712 Ga0265342_10007093 Ga0265342_100070934 466
91 3300005614 Ga0068856_100050070 Ga0068856_1000500706 467
92 3300013104 Ga0157370_10017723 Ga0157370_100177236 467
93 3300005367 Ga0070667_100026416 Ga0070667_1000264163 469
94 3300005563 Ga0068855_100074357 Ga0068855_1000743572 469
95 3300005843 Ga0068860_100281773 Ga0068860_1002817732 469
96 3300009174 Ga0105241_10014922 Ga0105241_100149224 469
97 3300028381 Ga0268264_10120165 Ga0268264_101201652 469
98 3300031238 Ga0265332_10018532 Ga0265332_100185322 469
99 3300031249 Ga0265339_10076264 Ga0265339_100762642 469
100 3300031344 Ga0265316_10026856 Ga0265316_100268562 469
101 3300049581 Ga0501047_0000815 Ga0501047_0000815_14886_16352 469
102 3300049588 Ga0501072_0000739 Ga0501072_0000739_2017_3483 469
103 3300049589 Ga0501073_0069576 Ga0501073_0069576_624_2090 469
104 3300006175 Ga0070712_100071037 Ga0070712_1000710372 470
105 3300010375 Ga0105239_10007612 Ga0105239_1000761210 470
106 3300025915 Ga0207693_10039571 Ga0207693_100395714 470
107 3300005436 Ga0070713_100081597 Ga0070713_1000815972 471
108 3300014326 Ga0157380_10010615 Ga0157380_100106152 471
109 3300025928 Ga0207700_10108166 Ga0207700_101081662 471
110 3300045976 Ga0466967_0121841 Ga0466967_0121841_115_1656 471
111 3300005327 Ga0070658_10009855 Ga0070658_1000985510 472
112 3300005327 Ga0070658_10029727 Ga0070658_100297277 472
113 3300005335 Ga0070666_10000276 Ga0070666_1000027628 472
114 3300005335 Ga0070666_10019112 Ga0070666_100191125 472
115 3300005339 Ga0070660_100108185 Ga0070660_1001081851 472
116 3300005344 Ga0070661_100056214 Ga0070661_1000562145 472
117 3300005367 Ga0070667_100017644 Ga0070667_1000176449 472
118 3300005456 Ga0070678_100025179 Ga0070678_1000251792 472
119 3300005458 Ga0070681_10066083 Ga0070681_100660833 472
120 3300005459 Ga0068867_100006825 Ga0068867_10000682510 472
121 3300005530 Ga0070679_100005852 Ga0070679_1000058526 472
122 3300005539 Ga0068853_100019837 Ga0068853_1000198374 472
123 3300005548 Ga0070665_100001485 Ga0070665_10000148518 472
124 3300005548 Ga0070665_100007598 Ga0070665_10000759812 472
125 3300005548 Ga0070665_100077557 Ga0070665_1000775574 472
126 3300005563 Ga0068855_100010386 Ga0068855_1000103869 472
127 3300005616 Ga0068852_100117165 Ga0068852_1001171652 472
128 3300005617 Ga0068859_100331196 Ga0068859_1003311961 472
129 3300005844 Ga0068862_100031752 Ga0068862_1000317525 472
130 3300006237 Ga0097621_100001072 Ga0097621_10000107215 472
131 3300006237 Ga0097621_100012137 Ga0097621_1000121375 472
132 3300006237 Ga0097621_100092997 Ga0097621_1000929972 472
133 3300006358 Ga0068871_100001473 Ga0068871_10000147315 472
134 3300006931 Ga0097620_100331209 Ga0097620_1003312091 472
135 3300009093 Ga0105240_10012870 Ga0105240_1001287011 472
136 3300009098 Ga0105245_10033786 Ga0105245_100337862 472
137 3300009148 Ga0105243_10005421 Ga0105243_100054218 472
138 3300009174 Ga0105241_10080132 Ga0105241_100801322 472
139 3300009176 Ga0105242_10016770 Ga0105242_100167709 472
140 3300009545 Ga0105237_10026173 Ga0105237_100261733 472
141 3300009545 Ga0105237_10137046 Ga0105237_101370464 472
142 3300009551 Ga0105238_10011509 Ga0105238_100115096 472
143 3300009553 Ga0105249_10009477 Ga0105249_100094778 472
144 3300011119 Ga0105246_10018275 Ga0105246_100182752 472
145 3300013296 Ga0157374_10114199 Ga0157374_101141994 472
146 3300013296 Ga0157374_10209910 Ga0157374_102099101 472
147 3300013306 Ga0163162_10018357 Ga0163162_100183579 472
148 3300013307 Ga0157372_10059412 Ga0157372_100594122 472
149 3300014968 Ga0157379_10034525 Ga0157379_100345257 472
150 3300014968 Ga0157379_10168728 Ga0157379_101687282 472
151 3300025903 Ga0207680_10001634 Ga0207680_1000163410 472
152 3300025909 Ga0207705_10007908 Ga0207705_100079089 472
153 3300025912 Ga0207707_10025199 Ga0207707_100251993 472
154 3300025913 Ga0207695_10053198 Ga0207695_100531983 472
155 3300025913 Ga0207695_10252368 Ga0207695_102523682 472
156 3300025919 Ga0207657_10032143 Ga0207657_100321437 472
157 3300025920 Ga0207649_10069377 Ga0207649_100693774 472
158 3300025921 Ga0207652_10008722 Ga0207652_1000872210 472
159 3300025941 Ga0207711_10018432 Ga0207711_100184322 472
160 3300025961 Ga0207712_10031693 Ga0207712_100316931 472
161 3300025986 Ga0207658_10015500 Ga0207658_100155002 472
162 3300026089 Ga0207648_10012252 Ga0207648_100122522 472
163 3300026118 Ga0207675_100070697 Ga0207675_1000706974 472
164 3300026118 Ga0207675_100290037 Ga0207675_1002900371 472
165 3300026121 Ga0207683_10039259 Ga0207683_100392592 472
166 3300028379 Ga0268266_10000551 Ga0268266_1000055116 472
167 3300028379 Ga0268266_10018351 Ga0268266_100183512 472
168 3300028379 Ga0268266_10024757 Ga0268266_100247576 472
169 3300028379 Ga0268266_10077341 Ga0268266_100773414 472
170 3300028800 Ga0265338_10005705 Ga0265338_100057056 472
171 3300031238 Ga0265332_10001311 Ga0265332_100013118 472
172 3300031238 Ga0265332_10007739 Ga0265332_100077395 472
173 3300031247 Ga0265340_10003441 Ga0265340_100034416 472
174 3300031247 Ga0265340_10004349 Ga0265340_100043495 472
175 3300031249 Ga0265339_10015781 Ga0265339_100157813 472
176 3300031711 Ga0265314_10029166 Ga0265314_100291663 472
177 3300031712 Ga0265342_10000287 Ga0265342_100002874 472
178 3300046557 Ga0495622_0005814 Ga0495622_0005814_1998_3461 472
179 3300049570 Ga0501033_0025782 Ga0501033_0025782_1105_2622 472
180 3300049570 Ga0501033_0100151 Ga0501033_0100151_399_1910 472
181 3300049574 Ga0501038_0044975 Ga0501038_0044975_1811_3271 472
182 3300049581 Ga0501047_0037926 Ga0501047_0037926_254_1714 472
183 3300049589 Ga0501073_0019152 Ga0501073_0019152_1585_3042 472
184 3300049744 Ga0501083_0011198 Ga0501083_0011198_4348_5811 472
185 3300049822 Ga0501035_0085561 Ga0501035_0085561_42_1502 472
186 3300049823 Ga0501044_0020506 Ga0501044_0020506_364_1824 472
187 3300053136 Ga0500559_0010364 Ga0500559_0010364_2307_3728 472
188 3300053139 Ga0500568_0033732 Ga0500568_0033732_495_1925 472
189 3300053139 Ga0500568_0041614 Ga0500568_0041614_143_1576 472
190 3300053140 Ga0500573_0000026 Ga0500573_0000026_32469_33944 472
191 3300054114 Ga0501084_0023653 Ga0501084_0023653_738_2201 472
192 3300003214 JGI25165J46597_1000253 JGI25165J46597_100025339 481
193 3300025261 Ga0209233_1000006 Ga0209233_1000006458 481

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13231

PMT_2

Dolichyl-phosphate-mannose-protein mannosyltransferase

68

229

0.99

PF02366

PMT

Dolichyl-phosphate-mannose-protein mannosyltransferase

53

237

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p2r-assembly1.cif.gz_B structure of s. cerevisiae protein o-mannosyltransferase pmt1-pmt2 complex bound to the sugar donor 0.7114 12 212
6p25-assembly1.cif.gz_A structure of s. cerevisiae protein o-mannosyltransferase pmt1-pmt2 complex bound to the sugar donor and a peptide acceptor 0.7064 4 222
5f15-assembly1.cif.gz_A crystal structure of arnt from cupriavidus metallidurans bound to undecaprenyl phosphate 0.7053 5 463
5ezm-assembly1.cif.gz_A crystal structure of arnt from cupriavidus metallidurans in the apo state 0.6919 5 463
5f15-assembly1.cif.gz_A crystal structure of arnt from cupriavidus metallidurans bound to undecaprenyl phosphate 0.6794 5 463
ID Description Score Start End Superfamily
af_O06152_111_270_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.7786 48 212 1.20.1250.20
af_O06152_111_270_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.7579 48 212 1.20.1250.20
af_Q55B20_2_174_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.5817 426 471 3.40.630.30
af_I1L667_35_144_2.80.10.50 Mainly Beta;Trefoil;Trefoil (Acidic Fibroblast Growth Factor, subunit A); 0.5679 430 476 2.80.10.50
af_Q54RD2_128_353_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.4608 425 468 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2E3K8S4-F1-model_v4 Glycosyltransferase RgtA/B/C/D-like domain-containing protein 0.9231 50 313 GO:0005886
GO:0009103
GO:0016763
AF-A0A840AKZ5-F1-model_v4 4-amino-4-deoxy-L-arabinose transferase-like glycosyltransferase 0.906 1 471 GO:0005886
GO:0009103
GO:0016763
AF-A0A7Y8H6M5-F1-model_v4 Glycosyltransferase family 39 protein 0.905 4 226 GO:0005886
GO:0009103
GO:0016763
AF-A0A4Q5SGA4-F1-model_v4 Glycosyltransferase family 39 protein 0.8935 4 173 GO:0005886
GO:0009103
GO:0016763
AF-A0A2V7RI50-F1-model_v4 Glycosyltransferase RgtA/B/C/D-like domain-containing protein 0.8918 4 399 GO:0005886
GO:0009103
GO:0016763

Feature Viewer

pLDDT pTM Quality
90.93 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map