F297639

General Info

Members Datasets Scaffolds Average Seq Length
193 103 169 410

Family's Representative Sequence

Representative Sequence 3300046538|Ga0495609_0042795|Ga0495609_0042795_155_1576
Length 473
Sequence LKGFLFSATPNYSSGIIILVSNPVSQSKHLNYSPTILQLFDMQAVQCMNILRSSDEKINFVSLLILISMRTNVNLLFYLKKPKNYQSGPMPVYLRFTVDGKRSEATTGRTCEPSRWNNKAGRLTGTKEDVRALNNYLDGLQSKAFDCHRVMTLHDELITAEILRNKFIGKVDKVRTITAVFADHNQKMQNLVGQEFEKSTLQRYSTCLMHIKDFMQWQFNVSDLPVTKISFSFLNDFEYYLRSIRKCGNNSAIKYIKNFGKIVRICLGNGWLTIDPYLNYKPKTSKVNRIALTKDELKALSEKEMPMERLKLVKDIFLFSCYTGLAYVDVSKLKRSEVLRGIDGESWIYTNRKKTDTLSRIPLLPSALEIMERYHENPQCQCDDRVLPVLSNQKMNAYLKEIADLSGITKVLTFHIARHTFATTITLNNGVPIESVAKMMGHTSIKTTQIYAKVMDHKISEDMSLLKQKLAAS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
4 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
5 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
6 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
7 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
8 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
9 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
10 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
11 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
12 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
13 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
14 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
15 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
16 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
17 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
18 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
19 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
20 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
21 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
22 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
23 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
24 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
25 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
26 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
56 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
70 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
71 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
74 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
81 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
87 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
88 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
89 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
90 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
91 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
92 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
93 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
94 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
95 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
97 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
98 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
99 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
100 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
101 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
102 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
103 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.56
Metatranscriptomes 0
Isolates 12.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.77
Nodule 0
Rhizoplane 0.52
Rhizosphere 79.27
Stem 0
Stem Tuber 0
Unclassified 12.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_541579 2162886007 Bacteria 1579
2 SwRhRL2b_contig_577364 2162886007 Bacteria 146603
3 JGI24736J21556_1002518 3300001904 Bacteria 3237
4 JGI24739J22299_10015596 3300001989 Bacteria 2760
5 JGI24737J22298_10002853 3300001990 Bacteria 6122
6 JGI24744J21845_10005290 3300002077 Bacteria 2671
7 rootH1_10000582 3300003316 Bacteria 63397
8 rootH1_10002229 3300003316 Bacteria 23291
9 rootH2_10020120 3300003320 Bacteria 35846
10 rootL2_10022114 3300003322 Bacteria 7490
11 rootL2_10032871 3300003322 Bacteria 16143
12 rootL2_10035219 3300003322 Bacteria 16618
13 rootL2_10042509 3300003322 Viruses 4882
14 rootL2_10158102 3300003322 Bacteria 9744
15 rootL2_10167236 3300003322 Bacteria 2934
16 rootL2_10167950 3300003322 Bacteria 3370
17 rootH1_10000542 3300003323 Bacteria 145802
18 rootH1_10018816 3300003323 Bacteria 8685
19 rootH1_10126404 3300003323 Bacteria 1799
20 rootH1_10203759 3300003323 Bacteria 2849
21 rootH1_10212993 3300003323 Bacteria 2005
22 rootH1_10232609 3300003323 Bacteria 3321
23 Ga0065165_1000085 3300005262 Bacteria 154355
24 Ga0065165_1000478 3300005262 Bacteria 62182
25 Ga0065714_10005600 3300005288 Bacteria 3783
26 Ga0065714_10064580 3300005288 Bacteria 32462
27 Ga0065704_10070133 3300005289 Bacteria 1266035
28 Ga0065704_10071050 3300005289 Bacteria 13493
29 Ga0070683_100401034 3300005329 Bacteria 1308
30 Ga0070671_100006927 3300005355 Bacteria 9079
31 Ga0070659_100000325 3300005366 Bacteria 36617
32 Ga0070659_100000392 3300005366 Bacteria 33244
33 Ga0070659_100002347 3300005366 Bacteria 13452
34 Ga0070659_100010744 3300005366 Bacteria 6748
35 Ga0070659_100054674 3300005366 Bacteria 3145
36 Ga0070681_10247839 3300005458 Bacteria 1694
37 Ga0070679_100002385 3300005530 Bacteria 17027
38 Ga0068855_100028473 3300005563 Bacteria 6683
39 Ga0068857_100122342 3300005577 Unclassified 2344
40 Ga0068856_100000021 3300005614 Bacteria 145017
41 Ga0068856_100000100 3300005614 Bacteria 82857
42 Ga0068856_100183129 3300005614 Bacteria 2108
43 Ga0068863_100066300 3300005841 Bacteria 3415
44 Ga0068860_100000383 3300005843 Bacteria 57999
45 Ga0068865_100000321 3300006881 Bacteria 26510
46 Ga0105240_10002855 3300009093 Bacteria 27308
47 Ga0105241_10175777 3300009174 Bacteria 1772
48 Ga0105237_10000087 3300009545 Bacteria 124934
49 Ga0105237_10002946 3300009545 Bacteria 20609
50 Ga0105237_10003856 3300009545 Bacteria 17633
51 Ga0105237_10004196 3300009545 Bacteria 16774
52 Ga0105239_10004409 3300010375 Bacteria 16853
53 Ga0157373_10038037 3300013100 Bacteria 3449
54 Ga0157371_10000242 3300013102 Bacteria 78183
55 Ga0157371_10002794 3300013102 Bacteria 16370
56 Ga0157371_10013109 3300013102 Bacteria 6309
57 Ga0157371_10016459 3300013102 Bacteria 5518
58 Ga0157370_10014823 3300013104 Bacteria 7955
59 Ga0157370_10034856 3300013104 Bacteria 4897
60 Ga0157370_10047507 3300013104 Bacteria 4114
61 Ga0157370_10339852 3300013104 Bacteria 1384
62 Ga0157369_10001043 3300013105 Bacteria 35027
63 Ga0157369_10001501 3300013105 Bacteria 28633
64 Ga0157369_10002260 3300013105 Bacteria 23160
65 Ga0157369_10003040 3300013105 Bacteria 20019
66 Ga0157369_10004008 3300013105 Bacteria 17462
67 Ga0157369_10092518 3300013105 Bacteria 3227
68 Ga0157374_10159804 3300013296 Bacteria 2195
69 Ga0163162_10000062 3300013306 Bacteria 105579
70 Ga0163162_10000404 3300013306 Bacteria 39585
71 Ga0157372_10000001 3300013307 Bacteria 791349
72 Ga0157372_10000010 3300013307 Bacteria 300658
73 Ga0157372_10000115 3300013307 Bacteria 84815
74 Ga0157372_10004209 3300013307 Bacteria 15397
75 Ga0157372_10040021 3300013307 Bacteria 5176
76 Ga0157372_10051017 3300013307 Bacteria 4603
77 Ga0157372_10115372 3300013307 Bacteria 3079
78 Ga0157372_10215644 3300013307 Bacteria 2225
79 Ga0157372_10229564 3300013307 Bacteria 2152
80 Ga0157372_10369180 3300013307 Bacteria 1672
81 Ga0163163_10283232 3300014325 Bacteria 1709
82 Ga0157376_10057334 3300014969 Bacteria 3258
83 Ga0182006_1000100 3300015261 Bacteria 97114
84 Ga0209563_104449 3300025230 Bacteria 2677
85 Ga0209676_1000488 3300025292 Bacteria 64408
86 Ga0209676_1003955 3300025292 Bacteria 8569
87 Ga0207647_10000112 3300025904 Bacteria 62895
88 Ga0207695_10002500 3300025913 Bacteria 27026
89 Ga0207671_10000096 3300025914 Bacteria 135750
90 Ga0207671_10002659 3300025914 Bacteria 18762
91 Ga0207671_10003100 3300025914 Bacteria 16916
92 Ga0207671_10003148 3300025914 Bacteria 16726
93 Ga0207652_10072549 3300025921 Bacteria 2994
94 Ga0207690_10000123 3300025932 Bacteria 64409
95 Ga0207690_10001766 3300025932 Bacteria 13287
96 Ga0207690_10002480 3300025932 Bacteria 11141
97 Ga0207690_10007238 3300025932 Bacteria 6589
98 Ga0207704_10000182 3300025938 Bacteria 33103
99 Ga0207667_10018288 3300025949 Bacteria 7865
100 Ga0207667_10029220 3300025949 Bacteria 5979
101 Ga0207702_10000288 3300026078 Bacteria 58420
102 Ga0207702_10000515 3300026078 Bacteria 43571
103 Ga0207641_10039435 3300026088 Bacteria 3950
104 Ga0207674_10013601 3300026116 Bacteria 9016
105 Ga0207674_10042239 3300026116 Bacteria 4711
106 Ga0268264_10000041 3300028381 Bacteria 372501
107 Ga0307517_10001130 3300028786 Bacteria 45094
108 Ga0307515_10001204 3300028794 Bacteria 59136
109 Ga0265327_10019332 3300031251 Bacteria 4192
110 Ga0307414_10000001 3300032004 Bacteria 1352954
111 Ga0307414_10000291 3300032004 Bacteria 29355
112 Ga0307414_10065911 3300032004 Bacteria 2586
113 Ga0307411_10000007 3300032005 Bacteria 332057
114 Ga0307507_10000159 3300033179 Bacteria 120125
115 Ga0395899_0000001 3300037312 Bacteria 1750322
116 Ga0395899_0000136 3300037312 Bacteria 112112
117 Ga0395899_0000696 3300037312 Bacteria 33847
118 Ga0395899_0002701 3300037312 Bacteria 14309
119 Ga0395899_0116218 3300037312 Bacteria 1919
120 Ga0395900_0000382 3300037418 Bacteria 63898
121 Ga0395900_0003804 3300037418 Bacteria 16143
122 Ga0395898_0078916 3300037466 Unclassified 3176
123 Ga0395905_0000186 3300037471 Bacteria 99159
124 Ga0395901_0003907 3300038443 Bacteria 14995
125 Ga0451577_0254551 3300042876 Bacteria 1589
126 Ga0451577_0286283 3300042876 Unclassified 1493
127 Ga0453683_0019032 3300044673 Bacteria 4402
128 Ga0466966_0009083 3300044684 Bacteria 6587
129 Ga0453684_0072536 3300044712 Bacteria 4346
130 Ga0453684_0137018 3300044712 Bacteria 2929
131 Ga0466959_0004493 3300045049 Bacteria 9346
132 Ga0451576_0008689 3300045051 Bacteria 11890
133 Ga0451576_0033661 3300045051 Bacteria 5447
134 Ga0451576_0045906 3300045051 Bacteria 4600
135 Ga0451576_0069949 3300045051 Bacteria 3653
136 Ga0495596_0003303 3300046500 Bacteria 8218
137 Ga0495606_0000010 3300046507 Bacteria 299893
138 Ga0495606_0006345 3300046507 Bacteria 10940
139 Ga0495606_0089994 3300046507 Bacteria 1890
140 Ga0495610_0005656 3300046512 Bacteria 8813
141 Ga0495609_0005235 3300046538 Bacteria 6901
142 Ga0495609_0022320 3300046538 Bacteria 2915
143 Ga0495609_0042795 3300046538 Bacteria 2034
144 Ga0495633_0000012 3300046558 Bacteria 267875
145 Ga0495633_0000814 3300046558 Bacteria 27616
146 Ga0495633_0043866 3300046558 Bacteria 2120
147 Ga0495625_0004324 3300046660 Bacteria 13488
148 Ga0495625_0012825 3300046660 Bacteria 6776
149 Ga0495625_0030517 3300046660 Bacteria 4020
150 Ga0495661_0000645 3300046665 Bacteria 35309
151 Ga0495661_0016058 3300046665 Bacteria 4974
152 Ga0495687_000435 3300047443 Bacteria 51653
153 Ga0495687_000900 3300047443 Bacteria 31120
154 Ga0495687_029528 3300047443 Bacteria 2536
155 Ga0495686_0000355 3300047472 Bacteria 74939
156 Ga0495686_0001953 3300047472 Bacteria 20514
157 Ga0495686_0010469 3300047472 Bacteria 6593
158 Ga0501034_0272058 3300049571 Viruses 1635
159 Ga0501241_011015 3300049758 Bacteria 1642
160 Ga0500651_0009393 3300053093 Bacteria 5807
161 Ga0500641_0000757 3300053096 Bacteria 11741
162 Ga0500608_006597 3300053122 Bacteria 4736
163 Ga0500608_012935 3300053122 Bacteria 3681
164 Ga0500608_105328 3300053122 Bacteria 1300
165 Ga0500618_018346 3300053125 Bacteria 1731
166 Ga0500604_0007883 3300053151 Bacteria 2824
167 Ga0500622_0000126 3300053156 Bacteria 80480
168 Ga0500622_0002720 3300053156 Bacteria 12490
169 Ga0500624_000230 3300053157 Bacteria 20306

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_10339852 Ga0157370_103398521 323
2 3300009545 Ga0105237_10003856 Ga0105237_1000385613 374
3 3300013100 Ga0157373_10038037 Ga0157373_100380374 374
4 3300013105 Ga0157369_10092518 Ga0157369_100925183 374
5 3300013307 Ga0157372_10115372 Ga0157372_101153724 374
6 3300001904 JGI24736J21556_1002518 JGI24736J21556_10025183 378
7 3300013307 Ga0157372_10369180 Ga0157372_103691802 378
8 3300025904 Ga0207647_10000112 Ga0207647_100001128 378
9 3300026116 Ga0207674_10013601 Ga0207674_100136014 378
10 3300049758 Ga0501241_011015 Ga0501241_011015_393_1595 378
11 3300053122 Ga0500608_012935 Ga0500608_012935_1479_2633 382
12 3300046500 Ga0495596_0003303 Ga0495596_0003303_6906_8180 383
13 3300047472 Ga0495686_0000355 Ga0495686_0000355_61659_62960 383
14 3300053156 Ga0500622_0000126 Ga0500622_0000126_41613_42884 385
15 iso_pu_bacteria 2887375801 2887378154 389
16 3300045051 Ga0451576_0045906 Ga0451576_0045906_3058_4266 390
17 3300002077 JGI24744J21845_10005290 JGI24744J21845_100052903 393
18 3300006881 Ga0068865_100000321 Ga0068865_1000003213 393
19 3300013105 Ga0157369_10004008 Ga0157369_1000400813 393
20 3300025938 Ga0207704_10000182 Ga0207704_100001826 393
21 3300032005 Ga0307411_10000007 Ga0307411_10000007167 393
22 3300013104 Ga0157370_10034856 Ga0157370_100348567 395
23 3300015261 Ga0182006_1000100 Ga0182006_10001004 395
24 3300003323 rootH1_10126404 rootH1_101264042 396
25 iso_pu_bacteria 2932082852 2932083103 396
26 3300003316 rootH1_10000582 rootH1_1000058260 398
27 3300003316 rootH1_10002229 rootH1_1000222923 398
28 3300003320 rootH2_10020120 rootH2_1002012041 398
29 3300003322 rootL2_10022114 rootL2_100221142 398
30 3300003322 rootL2_10032871 rootL2_100328715 398
31 3300003322 rootL2_10035219 rootL2_100352191 398
32 3300003322 rootL2_10042509 rootL2_100425093 398
33 3300003323 rootH1_10000542 rootH1_1000054245 398
34 3300005366 Ga0070659_100000325 Ga0070659_10000032530 398
35 3300013102 Ga0157371_10000242 Ga0157371_1000024218 398
36 3300013307 Ga0157372_10000115 Ga0157372_1000011551 398
37 3300025914 Ga0207671_10003148 Ga0207671_100031484 398
38 3300025932 Ga0207690_10001766 Ga0207690_100017668 398
39 3300037312 Ga0395899_0000136 Ga0395899_0000136_61481_62701 398
40 3300037312 Ga0395899_0000696 Ga0395899_0000696_19197_20426 398
41 3300037418 Ga0395900_0000382 Ga0395900_0000382_431_1660 398
42 3300037466 Ga0395898_0078916 Ga0395898_0078916_1314_2543 398
43 3300037471 Ga0395905_0000186 Ga0395905_0000186_5353_6582 398
44 3300038443 Ga0395901_0003907 Ga0395901_0003907_2709_3938 398
45 3300044673 Ga0453683_0019032 Ga0453683_0019032_3020_4291 398
46 3300044684 Ga0466966_0009083 Ga0466966_0009083_267_1487 398
47 3300045051 Ga0451576_0033661 Ga0451576_0033661_2786_4042 398
48 iso_pu_bacteria 2977232053 2977234770 398
49 3300032004 Ga0307414_10065911 Ga0307414_100659112 399
50 iso_pu_bacteria 2588253712 2588445262 399
51 iso_pu_bacteria 2599185184 2599480067 399
52 iso_pu_bacteria 2842083920 2842087672 399
53 iso_pu_bacteria 2849281842 2849284268 399
54 iso_pu_bacteria 2881247448 2881248391 399
55 iso_pu_bacteria 2890737413 2890739107 399
56 iso_pu_bacteria 2896344016 2896346384 399
57 iso_pu_bacteria 2904780799 2904782394 399
58 iso_pu_bacteria 2904780799 2904782446 399
59 iso_pu_bacteria 2919177583 2919178408 399
60 iso_pu_bacteria 2919437846 2919439033 399
61 iso_pu_bacteria 2928078545 2928079773 399
62 iso_pu_bacteria 2928147474 2928150649 399
63 iso_pu_bacteria 2932082852 2932085892 399
64 iso_pu_bacteria 2932082852 2932085930 399
65 iso_pu_bacteria 2945924605 2945926393 399
66 iso_pu_bacteria 2993372514 2993372635 399
67 3300042876 Ga0451577_0286283 Ga0451577_0286283_97_1302 400
68 3300045051 Ga0451576_0069949 Ga0451576_0069949_15_1220 400
69 iso_pu_bacteria 2522125168 2522553235 400
70 3300005288 Ga0065714_10064580 Ga0065714_100645802 401
71 3300031251 Ga0265327_10019332 Ga0265327_100193325 401
72 iso_pu_bacteria 2919437846 2919439384 401
73 iso_pu_bacteria 2977232053 2977234905 401
74 iso_pu_bacteria 2977232053 2977234957 401
75 3300013307 Ga0157372_10040021 Ga0157372_100400212 402
76 3300032004 Ga0307414_10000001 Ga0307414_1000000191 402
77 3300032004 Ga0307414_10000291 Ga0307414_1000029125 402
78 3300042876 Ga0451577_0254551 Ga0451577_0254551_215_1429 402
79 3300044712 Ga0453684_0072536 Ga0453684_0072536_2685_3899 402
80 3300044712 Ga0453684_0137018 Ga0453684_0137018_589_1806 402
81 3300045051 Ga0451576_0008689 Ga0451576_0008689_5044_6258 402
82 3300046660 Ga0495625_0030517 Ga0495625_0030517_2291_3595 402
83 3300053096 Ga0500641_0000757 Ga0500641_0000757_9100_10398 402
84 2162886007 SwRhRL2b_contig_541579 SwRhRL2b_0972.00000880 403
85 2162886007 SwRhRL2b_contig_577364 SwRhRL2b_0794.00000470 403
86 3300001989 JGI24739J22299_10015596 JGI24739J22299_100155963 403
87 3300001990 JGI24737J22298_10002853 JGI24737J22298_100028535 403
88 3300003322 rootL2_10158102 rootL2_101581029 403
89 3300003322 rootL2_10167236 rootL2_101672361 403
90 3300003322 rootL2_10167950 rootL2_101679503 403
91 3300003323 rootH1_10018816 rootH1_100188162 403
92 3300003323 rootH1_10203759 rootH1_102037592 403
93 3300003323 rootH1_10212993 rootH1_102129932 403
94 3300003323 rootH1_10232609 rootH1_102326091 403
95 3300005262 Ga0065165_1000085 Ga0065165_100008533 403
96 3300005262 Ga0065165_1000478 Ga0065165_100047850 403
97 3300005288 Ga0065714_10005600 Ga0065714_100056003 403
98 3300005289 Ga0065704_10070133 Ga0065704_10070133601 403
99 3300005289 Ga0065704_10071050 Ga0065704_1007105010 403
100 3300005329 Ga0070683_100401034 Ga0070683_1004010341 403
101 3300005355 Ga0070671_100006927 Ga0070671_1000069272 403
102 3300005366 Ga0070659_100000392 Ga0070659_1000003922 403
103 3300005366 Ga0070659_100002347 Ga0070659_1000023472 403
104 3300005366 Ga0070659_100010744 Ga0070659_1000107443 403
105 3300005366 Ga0070659_100054674 Ga0070659_1000546744 403
106 3300005458 Ga0070681_10247839 Ga0070681_102478391 403
107 3300005530 Ga0070679_100002385 Ga0070679_10000238515 403
108 3300005563 Ga0068855_100028473 Ga0068855_10002847310 403
109 3300005577 Ga0068857_100122342 Ga0068857_1001223421 403
110 3300005614 Ga0068856_100000021 Ga0068856_10000002197 403
111 3300005614 Ga0068856_100000100 Ga0068856_10000010051 403
112 3300005614 Ga0068856_100183129 Ga0068856_1001831293 403
113 3300005841 Ga0068863_100066300 Ga0068863_1000663003 403
114 3300005843 Ga0068860_100000383 Ga0068860_10000038328 403
115 3300009093 Ga0105240_10002855 Ga0105240_1000285522 403
116 3300009174 Ga0105241_10175777 Ga0105241_101757771 403
117 3300009545 Ga0105237_10000087 Ga0105237_100000872 403
118 3300009545 Ga0105237_10002946 Ga0105237_100029464 403
119 3300009545 Ga0105237_10004196 Ga0105237_1000419621 403
120 3300010375 Ga0105239_10004409 Ga0105239_100044092 403
121 3300013102 Ga0157371_10002794 Ga0157371_100027941 403
122 3300013102 Ga0157371_10013109 Ga0157371_100131097 403
123 3300013102 Ga0157371_10016459 Ga0157371_100164595 403
124 3300013104 Ga0157370_10014823 Ga0157370_100148236 403
125 3300013104 Ga0157370_10047507 Ga0157370_100475077 403
126 3300013105 Ga0157369_10001043 Ga0157369_1000104346 403
127 3300013105 Ga0157369_10001501 Ga0157369_1000150131 403
128 3300013105 Ga0157369_10002260 Ga0157369_100022601 403
129 3300013105 Ga0157369_10003040 Ga0157369_100030403 403
130 3300013296 Ga0157374_10159804 Ga0157374_101598041 403
131 3300013306 Ga0163162_10000062 Ga0163162_100000629 403
132 3300013306 Ga0163162_10000404 Ga0163162_1000040432 403
133 3300013307 Ga0157372_10000001 Ga0157372_10000001513 403
134 3300013307 Ga0157372_10000010 Ga0157372_100000106 403
135 3300013307 Ga0157372_10004209 Ga0157372_100042091 403
136 3300013307 Ga0157372_10051017 Ga0157372_100510171 403
137 3300013307 Ga0157372_10215644 Ga0157372_102156442 403
138 3300013307 Ga0157372_10229564 Ga0157372_102295641 403
139 3300014325 Ga0163163_10283232 Ga0163163_102832323 403
140 3300014969 Ga0157376_10057334 Ga0157376_100573342 403
141 3300025230 Ga0209563_104449 Ga0209563_1044493 403
142 3300025292 Ga0209676_1000488 Ga0209676_100048852 403
143 3300025292 Ga0209676_1003955 Ga0209676_10039554 403
144 3300025913 Ga0207695_10002500 Ga0207695_1000250018 403
145 3300025914 Ga0207671_10000096 Ga0207671_100000967 403
146 3300025914 Ga0207671_10002659 Ga0207671_1000265922 403
147 3300025914 Ga0207671_10003100 Ga0207671_100031003 403
148 3300025921 Ga0207652_10072549 Ga0207652_100725493 403
149 3300025932 Ga0207690_10000123 Ga0207690_1000012316 403
150 3300025932 Ga0207690_10002480 Ga0207690_100024804 403
151 3300025932 Ga0207690_10007238 Ga0207690_100072383 403
152 3300025949 Ga0207667_10018288 Ga0207667_100182885 403
153 3300025949 Ga0207667_10029220 Ga0207667_100292204 403
154 3300026078 Ga0207702_10000288 Ga0207702_1000028828 403
155 3300026078 Ga0207702_10000515 Ga0207702_1000051518 403
156 3300026088 Ga0207641_10039435 Ga0207641_100394354 403
157 3300026116 Ga0207674_10042239 Ga0207674_100422393 403
158 3300028381 Ga0268264_10000041 Ga0268264_10000041112 403
159 3300028786 Ga0307517_10001130 Ga0307517_1000113042 403
160 3300028794 Ga0307515_10001204 Ga0307515_1000120433 403
161 3300033179 Ga0307507_10000159 Ga0307507_1000015980 403
162 3300037312 Ga0395899_0000001 Ga0395899_0000001_906853_908076 403
163 3300037312 Ga0395899_0002701 Ga0395899_0002701_3964_5181 403
164 3300037312 Ga0395899_0116218 Ga0395899_0116218_464_1681 403
165 3300037418 Ga0395900_0003804 Ga0395900_0003804_6616_7827 403
166 3300045049 Ga0466959_0004493 Ga0466959_0004493_4802_6109 403
167 3300046507 Ga0495606_0000010 Ga0495606_0000010_6419_7636 403
168 3300046507 Ga0495606_0006345 Ga0495606_0006345_6841_8124 403
169 3300046507 Ga0495606_0089994 Ga0495606_0089994_565_1785 403
170 3300046512 Ga0495610_0005656 Ga0495610_0005656_7045_8286 403
171 3300046538 Ga0495609_0005235 Ga0495609_0005235_5512_6732 403
172 3300046538 Ga0495609_0022320 Ga0495609_0022320_1348_2595 403
173 3300046538 Ga0495609_0042795 Ga0495609_0042795_155_1576 403
174 3300046558 Ga0495633_0000012 Ga0495633_0000012_183399_184616 403
175 3300046558 Ga0495633_0000814 Ga0495633_0000814_6982_8196 403
176 3300046558 Ga0495633_0043866 Ga0495633_0043866_864_2084 403
177 3300046660 Ga0495625_0004324 Ga0495625_0004324_6203_7420 403
178 3300046660 Ga0495625_0012825 Ga0495625_0012825_457_1764 403
179 3300046665 Ga0495661_0000645 Ga0495661_0000645_6091_7326 403
180 3300046665 Ga0495661_0016058 Ga0495661_0016058_3382_4617 403
181 3300047443 Ga0495687_000435 Ga0495687_000435_15681_16904 403
182 3300047443 Ga0495687_000900 Ga0495687_000900_29527_30891 403
183 3300047443 Ga0495687_029528 Ga0495687_029528_892_2109 403
184 3300047472 Ga0495686_0001953 Ga0495686_0001953_18206_19453 403
185 3300047472 Ga0495686_0010469 Ga0495686_0010469_3322_4557 403
186 3300049571 Ga0501034_0272058 Ga0501034_0272058_351_1565 403
187 3300053093 Ga0500651_0009393 Ga0500651_0009393_2232_3449 403
188 3300053122 Ga0500608_006597 Ga0500608_006597_745_1962 403
189 3300053122 Ga0500608_105328 Ga0500608_105328_20_1237 403
190 3300053125 Ga0500618_018346 Ga0500618_018346_205_1488 403
191 3300053151 Ga0500604_0007883 Ga0500604_0007883_732_1958 403
192 3300053156 Ga0500622_0002720 Ga0500622_0002720_469_1692 403
193 3300053157 Ga0500624_000230 Ga0500624_000230_1128_2345 403

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17293

Arm-DNA-bind_5

Arm DNA-binding domain

77

164

0.97

PF13102

Phage_int_SAM_5

Phage integrase SAM-like domain

176

282

0.91

PF00589

Phage_integrase

Phage integrase family

290

458

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z19-assembly1.cif.gz_B-2 crystal structure of a lambda integrase(75-356) dimer bound to a coc' core site 0.8034 107 383
1z19-assembly1.cif.gz_A-2 crystal structure of a lambda integrase(75-356) dimer bound to a coc' core site 0.7854 107 379
1p7d-assembly2.cif.gz_B crystal structure of the lambda integrase (residues 75-356) bound to dna 0.7748 107 377
1z19-assembly1.cif.gz_B-2 crystal structure of a lambda integrase(75-356) dimer bound to a coc' core site 0.7646 107 383
1z19-assembly1.cif.gz_A-2 crystal structure of a lambda integrase(75-356) dimer bound to a coc' core site 0.762 107 379
ID Description Score Start End Superfamily
af_P0A8P6_5_99_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.863 111 208 1.10.150.130
af_P0A8P6_5_99_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.8302 111 208 1.10.150.130
af_P76168_47_165_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.8222 103 217 1.10.150.130
af_P76056_81_199_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.8099 107 222 1.10.150.130
af_Q2FY74_109_289_1.10.443.10 Mainly Alpha;Orthogonal Bundle;hpI Integrase; Chain A;Intergrase catalytic core 0.8052 222 395 1.10.443.10
ID Description Score Start End GO Terms
AF-A0A133YNV8-F1-model_v4 Arm DNA-binding domain-containing protein 0.9851 1 70
AF-A0A5S5DQI0-F1-model_v4 Phage integrase family protein 0.9832 234 320 GO:0003677
GO:0006310
GO:0015074
AF-A0A413GKF4-F1-model_v4 deleted 0.9821 225 350
AF-A0A7Y9L9U6-F1-model_v4 Site-specific recombinase XerD 0.9793 264 354 GO:0003677
GO:0006310
GO:0015074
AF-A0A316HDK9-F1-model_v4 Site-specific recombinase XerD 0.9766 109 364 GO:0003677
GO:0006310
GO:0015074

Feature Viewer

pLDDT pTM Quality
91.87 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map