F297811
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 193 | 128 | 193 | 190 |
Family's Representative Sequence
| Representative Sequence | 3300050496|nmdc:mga07m45_181353_c1|nmdc:mga07m45_181353_c1_183_821 |
| Length | 212 |
| Sequence | MRSERLIPPARALGRVARVSEQTVHAPYGQLPRGGVVRPITRWGEPVMHRPQQPVTAYDDELERLAADMVETMYAADGVGLAACQIGVDRAIFVFDCPDDDGRRTLGVVCNPELTLPEGKDRKLDEGDEGCLSYPGAFVECARPDFATVTGTGLDGSPVEFSGTGMLARCLQHETDHTKGTVFGDRLATKQRKRLQKAMEKAADDYPLDWPT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 4 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 5 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 13 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 16 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 17 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 18 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 19 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 20 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 21 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 22 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 23 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 24 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 25 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 26 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 27 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 28 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 29 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 30 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 40 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 42 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 62 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 63 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 64 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 65 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 66 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 67 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 68 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 69 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 70 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 71 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 72 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 73 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 74 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 75 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 76 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 77 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 78 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 79 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 80 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 81 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 83 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 84 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 85 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 86 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 87 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 88 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 89 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 90 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 91 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 92 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 93 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 94 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 95 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 96 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 97 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 98 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 99 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 100 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 101 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 102 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 103 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 104 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 105 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 106 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 107 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 108 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 109 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 110 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 111 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 112 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 113 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 114 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 115 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 116 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 117 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 118 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 119 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 120 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 121 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 122 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 123 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 124 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 125 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 127 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 128 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.48 |
| Metatranscriptomes | 0.52 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.13 |
| Nodule | 0 |
| Rhizoplane | 13.99 |
| Rhizosphere | 66.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10581562 | 3300005327 | Bacteria | 970 |
| 2 | Ga0070683_100019433 | 3300005329 | Bacteria | 6034 |
| 3 | Ga0068868_100063111 | 3300005338 | Bacteria | 2938 |
| 4 | Ga0070692_10001392 | 3300005345 | Bacteria | 8752 |
| 5 | Ga0070671_100293728 | 3300005355 | Bacteria | 1383 |
| 6 | Ga0070673_100212698 | 3300005364 | Bacteria | 1671 |
| 7 | Ga0070659_100227108 | 3300005366 | Bacteria | 1542 |
| 8 | Ga0070667_100012931 | 3300005367 | Bacteria | 6900 |
| 9 | Ga0070667_100059835 | 3300005367 | Bacteria | 3223 |
| 10 | Ga0070700_100004347 | 3300005441 | Bacteria | 7395 |
| 11 | Ga0070700_100659441 | 3300005441 | Bacteria | 827 |
| 12 | Ga0070685_10026895 | 3300005466 | Bacteria | 3175 |
| 13 | Ga0070684_100389867 | 3300005535 | Bacteria | 1283 |
| 14 | Ga0070684_100490385 | 3300005535 | Bacteria | 1138 |
| 15 | Ga0068853_100046253 | 3300005539 | Bacteria | 3731 |
| 16 | Ga0070672_100171497 | 3300005543 | Bacteria | 1805 |
| 17 | Ga0070693_100137229 | 3300005547 | Bacteria | 1535 |
| 18 | Ga0068854_100071452 | 3300005578 | Bacteria | 2539 |
| 19 | Ga0068856_100562036 | 3300005614 | Bacteria | 1162 |
| 20 | Ga0068852_100026197 | 3300005616 | Bacteria | 4735 |
| 21 | Ga0068866_10008276 | 3300005718 | Bacteria | 4377 |
| 22 | Ga0068866_10264655 | 3300005718 | Bacteria | 1058 |
| 23 | Ga0068861_100502280 | 3300005719 | Bacteria | 1096 |
| 24 | Ga0068860_100620027 | 3300005843 | Bacteria | 1088 |
| 25 | Ga0081539_10083045 | 3300005985 | Bacteria | 1678 |
| 26 | Ga0075365_10027536 | 3300006038 | Bacteria | 3618 |
| 27 | Ga0075365_10052420 | 3300006038 | Bacteria | 2698 |
| 28 | Ga0075365_10252103 | 3300006038 | Bacteria | 1240 |
| 29 | Ga0075365_10317338 | 3300006038 | Bacteria | 1097 |
| 30 | Ga0075368_10004089 | 3300006042 | Bacteria | 4909 |
| 31 | Ga0075363_100006491 | 3300006048 | Bacteria | 5318 |
| 32 | Ga0075363_100049121 | 3300006048 | Bacteria | 2245 |
| 33 | Ga0075363_100094873 | 3300006048 | Bacteria | 1645 |
| 34 | Ga0075363_100204999 | 3300006048 | Bacteria | 1127 |
| 35 | Ga0075364_10008289 | 3300006051 | Bacteria | 6207 |
| 36 | Ga0075364_10024972 | 3300006051 | Bacteria | 3800 |
| 37 | Ga0075364_10103576 | 3300006051 | Bacteria | 1895 |
| 38 | Ga0075367_10008972 | 3300006178 | Bacteria | 5206 |
| 39 | Ga0075370_10000475 | 3300006353 | Bacteria | 15085 |
| 40 | Ga0075370_10000774 | 3300006353 | Bacteria | 12812 |
| 41 | Ga0075370_10162255 | 3300006353 | Bacteria | 1312 |
| 42 | Ga0075428_100302053 | 3300006844 | Bacteria | 1721 |
| 43 | Ga0068865_100150779 | 3300006881 | Bacteria | 1764 |
| 44 | Ga0068865_100727909 | 3300006881 | Bacteria | 850 |
| 45 | Ga0111539_12132142 | 3300009094 | Bacteria | 650 |
| 46 | Ga0105245_10025609 | 3300009098 | Bacteria | 5188 |
| 47 | Ga0105245_10060124 | 3300009098 | Bacteria | 3422 |
| 48 | Ga0105245_10256397 | 3300009098 | Bacteria | 1701 |
| 49 | Ga0105243_10106815 | 3300009148 | Bacteria | 2334 |
| 50 | Ga0105249_10105751 | 3300009553 | Bacteria | 2654 |
| 51 | Ga0157369_10194420 | 3300013105 | Bacteria | 2131 |
| 52 | Ga0157369_10388303 | 3300013105 | Bacteria | 1449 |
| 53 | Ga0157372_10031509 | 3300013307 | Bacteria | 5805 |
| 54 | Ga0157372_10305884 | 3300013307 | Bacteria | 1850 |
| 55 | Ga0157372_11018202 | 3300013307 | Bacteria | 959 |
| 56 | Ga0157372_12198279 | 3300013307 | Bacteria | 634 |
| 57 | Ga0157375_10222134 | 3300013308 | Bacteria | 2047 |
| 58 | Ga0157375_10242984 | 3300013308 | Bacteria | 1960 |
| 59 | Ga0157375_10695508 | 3300013308 | Bacteria | 1171 |
| 60 | Ga0157375_10718593 | 3300013308 | Bacteria | 1152 |
| 61 | Ga0163163_10916925 | 3300014325 | Bacteria | 939 |
| 62 | Ga0157380_12578589 | 3300014326 | Bacteria | 574 |
| 63 | Ga0182008_10039018 | 3300014497 | Bacteria | 2374 |
| 64 | Ga0157377_10005008 | 3300014745 | Bacteria | 6181 |
| 65 | Ga0206353_10156710 | 3300020082 | Bacteria | 2453 |
| 66 | Ga0207688_10033832 | 3300025901 | Bacteria | 2828 |
| 67 | Ga0207643_10105457 | 3300025908 | Bacteria | 1656 |
| 68 | Ga0207659_10470771 | 3300025926 | Bacteria | 1060 |
| 69 | Ga0207687_10045877 | 3300025927 | Bacteria | 3023 |
| 70 | Ga0207687_10066722 | 3300025927 | Bacteria | 2558 |
| 71 | Ga0207669_10736400 | 3300025937 | Bacteria | 813 |
| 72 | Ga0207691_10006151 | 3300025940 | Bacteria | 11606 |
| 73 | Ga0207661_10135535 | 3300025944 | Bacteria | 2114 |
| 74 | Ga0207651_10256804 | 3300025960 | Bacteria | 1433 |
| 75 | Ga0207668_10103895 | 3300025972 | Bacteria | 2117 |
| 76 | Ga0207658_10043562 | 3300025986 | Bacteria | 3263 |
| 77 | Ga0207677_10302623 | 3300026023 | Bacteria | 1321 |
| 78 | Ga0207639_10123029 | 3300026041 | Bacteria | 2135 |
| 79 | Ga0207708_10000379 | 3300026075 | Bacteria | 34728 |
| 80 | Ga0207708_10721889 | 3300026075 | Bacteria | 853 |
| 81 | Ga0207648_10002445 | 3300026089 | Bacteria | 19971 |
| 82 | Ga0207675_100022928 | 3300026118 | Bacteria | 5807 |
| 83 | Ga0207683_10093282 | 3300026121 | Bacteria | 2683 |
| 84 | Ga0207698_10195045 | 3300026142 | Bacteria | 1808 |
| 85 | Ga0209813_10198475 | 3300027866 | Bacteria | 742 |
| 86 | Ga0268264_10000320 | 3300028381 | Bacteria | 75931 |
| 87 | Ga0307410_10139770 | 3300031852 | Bacteria | 1790 |
| 88 | Ga0307406_10340504 | 3300031901 | Bacteria | 1168 |
| 89 | Ga0307407_10116692 | 3300031903 | Bacteria | 1685 |
| 90 | Ga0307409_100010434 | 3300031995 | Bacteria | 5779 |
| 91 | Ga0307409_100509116 | 3300031995 | Bacteria | 1174 |
| 92 | Ga0307416_100072687 | 3300032002 | Bacteria | 2864 |
| 93 | Ga0307414_10231725 | 3300032004 | Bacteria | 1523 |
| 94 | Ga0307411_10021417 | 3300032005 | Bacteria | 3783 |
| 95 | Ga0307411_10327717 | 3300032005 | Bacteria | 1239 |
| 96 | Ga0307415_100169924 | 3300032126 | Bacteria | 1699 |
| 97 | Ga0395900_0081917 | 3300037418 | Bacteria | 3315 |
| 98 | Ga0436364_0459928 | 3300037853 | Bacteria | 1691 |
| 99 | Ga0395901_0352340 | 3300038443 | Bacteria | 1519 |
| 100 | Ga0451841_0315187 | 3300041498 | Bacteria | 645 |
| 101 | Ga0466965_0033876 | 3300044683 | Bacteria | 2498 |
| 102 | Ga0466961_0149681 | 3300044693 | Bacteria | 1458 |
| 103 | Ga0466963_0336397 | 3300044694 | Bacteria | 1063 |
| 104 | Ga0466970_0021681 | 3300044765 | Bacteria | 3348 |
| 105 | Ga0466970_0028495 | 3300044765 | Bacteria | 2935 |
| 106 | Ga0466970_0098567 | 3300044765 | Bacteria | 1590 |
| 107 | Ga0466970_0945017 | 3300044765 | Bacteria | 508 |
| 108 | Ga0466957_0258795 | 3300044842 | Bacteria | 1159 |
| 109 | Ga0466957_0292975 | 3300044842 | Bacteria | 1092 |
| 110 | Ga0466959_0102357 | 3300045049 | Bacteria | 2050 |
| 111 | Ga0466958_0341823 | 3300045836 | Bacteria | 963 |
| 112 | Ga0466967_0047423 | 3300045976 | Bacteria | 3745 |
| 113 | Ga0466967_0446792 | 3300045976 | Bacteria | 1263 |
| 114 | Ga0495652_0670970 | 3300046529 | Bacteria | 700 |
| 115 | Ga0496100_0427171 | 3300048903 | Bacteria | 1013 |
| 116 | Ga0496101_0060842 | 3300048904 | Bacteria | 2741 |
| 117 | Ga0496102_0054815 | 3300048905 | Bacteria | 3636 |
| 118 | Ga0496103_0224246 | 3300048906 | Bacteria | 1209 |
| 119 | Ga0496104_0532570 | 3300048907 | Bacteria | 1086 |
| 120 | Ga0496105_0155967 | 3300048908 | Bacteria | 1875 |
| 121 | Ga0496105_0302730 | 3300048908 | Bacteria | 1285 |
| 122 | Ga0496105_0339352 | 3300048908 | Bacteria | 1202 |
| 123 | Ga0496106_0210660 | 3300048909 | Bacteria | 1548 |
| 124 | Ga0496107_0090314 | 3300048910 | Bacteria | 2237 |
| 125 | Ga0496107_0154619 | 3300048910 | Bacteria | 1698 |
| 126 | Ga0496107_0312516 | 3300048910 | Bacteria | 1169 |
| 127 | Ga0496108_0087771 | 3300048911 | Bacteria | 2642 |
| 128 | Ga0496108_0108011 | 3300048911 | Bacteria | 2377 |
| 129 | Ga0496108_0256884 | 3300048911 | Bacteria | 1520 |
| 130 | Ga0496109_0035443 | 3300048912 | Bacteria | 4501 |
| 131 | Ga0496109_0089463 | 3300048912 | Bacteria | 2846 |
| 132 | Ga0496109_0100798 | 3300048912 | Bacteria | 2679 |
| 133 | Ga0496109_0109592 | 3300048912 | Bacteria | 2567 |
| 134 | Ga0496110_0160043 | 3300048913 | Bacteria | 2041 |
| 135 | Ga0496110_0235112 | 3300048913 | Bacteria | 1667 |
| 136 | Ga0496110_0293492 | 3300048913 | Bacteria | 1481 |
| 137 | Ga0496111_0308454 | 3300048914 | Bacteria | 1173 |
| 138 | Ga0496113_0192508 | 3300048916 | Bacteria | 1619 |
| 139 | Ga0496114_0045004 | 3300048917 | Bacteria | 3664 |
| 140 | Ga0496114_0052576 | 3300048917 | Bacteria | 3394 |
| 141 | Ga0496114_0088654 | 3300048917 | Bacteria | 2624 |
| 142 | Ga0501031_0008225 | 3300049568 | Bacteria | 6786 |
| 143 | Ga0501036_0026263 | 3300049572 | Bacteria | 4914 |
| 144 | Ga0501037_0317347 | 3300049573 | Bacteria | 1079 |
| 145 | Ga0501039_0361205 | 3300049575 | Bacteria | 1141 |
| 146 | Ga0501040_0015443 | 3300049576 | Bacteria | 5048 |
| 147 | Ga0501040_0171178 | 3300049576 | Bacteria | 1538 |
| 148 | Ga0501041_0006202 | 3300049577 | Bacteria | 6990 |
| 149 | Ga0501042_0033213 | 3300049578 | Bacteria | 3657 |
| 150 | Ga0501043_0643848 | 3300049579 | Bacteria | 779 |
| 151 | Ga0501046_0249183 | 3300049580 | Bacteria | 1308 |
| 152 | Ga0501048_0034871 | 3300049582 | Bacteria | 3626 |
| 153 | Ga0501048_0059712 | 3300049582 | Bacteria | 2703 |
| 154 | Ga0501067_0033621 | 3300049583 | Bacteria | 2844 |
| 155 | Ga0501068_0127008 | 3300049584 | Bacteria | 1593 |
| 156 | Ga0501069_0030369 | 3300049585 | Bacteria | 2967 |
| 157 | Ga0501070_0030971 | 3300049586 | Bacteria | 4481 |
| 158 | Ga0501070_0038787 | 3300049586 | Bacteria | 3975 |
| 159 | Ga0501071_0010499 | 3300049587 | Bacteria | 6209 |
| 160 | Ga0501071_0431250 | 3300049587 | Bacteria | 1008 |
| 161 | Ga0501072_0008263 | 3300049588 | Bacteria | 7908 |
| 162 | Ga0501072_0224785 | 3300049588 | Bacteria | 1496 |
| 163 | Ga0501075_0027862 | 3300049591 | Bacteria | 4166 |
| 164 | Ga0501075_0136499 | 3300049591 | Bacteria | 1869 |
| 165 | Ga0501076_0592789 | 3300049592 | Bacteria | 914 |
| 166 | Ga0501243_019051 | 3300049675 | Bacteria | 1123 |
| 167 | Ga0501080_0019678 | 3300049742 | Bacteria | 6252 |
| 168 | Ga0501081_0042312 | 3300049743 | Bacteria | 3121 |
| 169 | Ga0501081_0363564 | 3300049743 | Bacteria | 1068 |
| 170 | Ga0501045_0095468 | 3300049824 | Bacteria | 2199 |
| 171 | Ga0501045_0383717 | 3300049824 | Bacteria | 1046 |
| 172 | nmdc:mga03n38_166806_c1 | 3300050490 | Bacteria | 1119 |
| 173 | nmdc:mga03n38_64895_c1 | 3300050490 | Bacteria | 1673 |
| 174 | nmdc:mga00v17_341374_c1 | 3300050491 | Bacteria | 974 |
| 175 | nmdc:mga00v17_8441_c1 | 3300050491 | Bacteria | 5544 |
| 176 | nmdc:mga0yw44_164530_c1 | 3300050492 | Bacteria | 1454 |
| 177 | nmdc:mga0yw44_375876_c1 | 3300050492 | Bacteria | 959 |
| 178 | nmdc:mga0yw44_4224_c1 | 3300050492 | Bacteria | 6542 |
| 179 | nmdc:mga0yw44_441394_c1 | 3300050492 | Bacteria | 882 |
| 180 | nmdc:mga0yw44_537804_c1 | 3300050492 | Bacteria | 793 |
| 181 | nmdc:mga06z11_14036_c1 | 3300050494 | Bacteria | 3536 |
| 182 | nmdc:mga06z11_452617_c1 | 3300050494 | Bacteria | 776 |
| 183 | nmdc:mga06z11_640406_c1 | 3300050494 | Bacteria | 647 |
| 184 | nmdc:mga04h51_228510_c1 | 3300050495 | Bacteria | 740 |
| 185 | nmdc:mga04h51_808_c1 | 3300050495 | Bacteria | 7281 |
| 186 | nmdc:mga07m45_13133_c1 | 3300050496 | Bacteria | 4386 |
| 187 | nmdc:mga07m45_181353_c1 | 3300050496 | Bacteria | 1224 |
| 188 | nmdc:mga07m45_91438_c1 | 3300050496 | Bacteria | 1743 |
| 189 | nmdc:mga08y16_72204_c1 | 3300050511 | Bacteria | 3597 |
| 190 | Ga0495619_0368083 | 3300053085 | Bacteria | 994 |
| 191 | Ga0500644_0000541 | 3300053088 | Bacteria | 15557 |
| 192 | Ga0501084_0067964 | 3300054114 | Bacteria | 2983 |
| 193 | Ga0466962_0056431 | 3300061719 | Bacteria | 1876 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044765 | Ga0466970_0945017 | Ga0466970_0945017_22_486 | 131 |
| 2 | 3300049582 | Ga0501048_0059712 | Ga0501048_0059712_1242_1739 | 138 |
| 3 | 3300037418 | Ga0395900_0081917 | Ga0395900_0081917_434_934 | 139 |
| 4 | 3300009094 | Ga0111539_12132142 | Ga0111539_121321421 | 146 |
| 5 | 3300009553 | Ga0105249_10105751 | Ga0105249_101057514 | 146 |
| 6 | 3300013307 | Ga0157372_12198279 | Ga0157372_121982791 | 146 |
| 7 | 3300014326 | Ga0157380_12578589 | Ga0157380_125785891 | 146 |
| 8 | 3300025937 | Ga0207669_10736400 | Ga0207669_107364002 | 146 |
| 9 | 3300048911 | Ga0496108_0108011 | Ga0496108_0108011_15_536 | 146 |
| 10 | 3300049583 | Ga0501067_0033621 | Ga0501067_0033621_2278_2799 | 146 |
| 11 | 3300025908 | Ga0207643_10105457 | Ga0207643_101054571 | 148 |
| 12 | 3300046529 | Ga0495652_0670970 | Ga0495652_0670970_114_650 | 150 |
| 13 | 3300005367 | Ga0070667_100059835 | Ga0070667_1000598354 | 152 |
| 14 | 3300025986 | Ga0207658_10043562 | Ga0207658_100435623 | 152 |
| 15 | 3300048913 | Ga0496110_0235112 | Ga0496110_0235112_940_1533 | 152 |
| 16 | 3300009098 | Ga0105245_10060124 | Ga0105245_100601243 | 154 |
| 17 | 3300013307 | Ga0157372_11018202 | Ga0157372_110182022 | 154 |
| 18 | 3300025927 | Ga0207687_10066722 | Ga0207687_100667221 | 154 |
| 19 | 3300037853 | Ga0436364_0459928 | Ga0436364_0459928_535_1074 | 154 |
| 20 | 3300005985 | Ga0081539_10083045 | Ga0081539_100830452 | 160 |
| 21 | 3300006048 | Ga0075363_100094873 | Ga0075363_1000948732 | 161 |
| 22 | 3300006051 | Ga0075364_10008289 | Ga0075364_100082892 | 161 |
| 23 | 3300006353 | Ga0075370_10000774 | Ga0075370_100007742 | 161 |
| 24 | 3300031852 | Ga0307410_10139770 | Ga0307410_101397702 | 161 |
| 25 | 3300031901 | Ga0307406_10340504 | Ga0307406_103405042 | 161 |
| 26 | 3300031903 | Ga0307407_10116692 | Ga0307407_101166922 | 161 |
| 27 | 3300032002 | Ga0307416_100072687 | Ga0307416_1000726872 | 161 |
| 28 | 3300032004 | Ga0307414_10231725 | Ga0307414_102317252 | 161 |
| 29 | 3300032005 | Ga0307411_10327717 | Ga0307411_103277172 | 161 |
| 30 | 3300032126 | Ga0307415_100169924 | Ga0307415_1001699242 | 161 |
| 31 | 3300048910 | Ga0496107_0312516 | Ga0496107_0312516_175_759 | 161 |
| 32 | 3300048914 | Ga0496111_0308454 | Ga0496111_0308454_514_1098 | 161 |
| 33 | 3300049584 | Ga0501068_0127008 | Ga0501068_0127008_418_1005 | 161 |
| 34 | 3300049585 | Ga0501069_0030369 | Ga0501069_0030369_523_1101 | 161 |
| 35 | 3300049675 | Ga0501243_019051 | Ga0501243_019051_518_1087 | 161 |
| 36 | 3300053088 | Ga0500644_0000541 | Ga0500644_0000541_8009_8593 | 161 |
| 37 | 3300014497 | Ga0182008_10039018 | Ga0182008_100390182 | 162 |
| 38 | 3300005329 | Ga0070683_100019433 | Ga0070683_1000194337 | 163 |
| 39 | 3300005338 | Ga0068868_100063111 | Ga0068868_1000631112 | 163 |
| 40 | 3300005345 | Ga0070692_10001392 | Ga0070692_100013928 | 163 |
| 41 | 3300005355 | Ga0070671_100293728 | Ga0070671_1002937282 | 163 |
| 42 | 3300005364 | Ga0070673_100212698 | Ga0070673_1002126982 | 163 |
| 43 | 3300005441 | Ga0070700_100004347 | Ga0070700_1000043472 | 163 |
| 44 | 3300005466 | Ga0070685_10026895 | Ga0070685_100268954 | 163 |
| 45 | 3300005535 | Ga0070684_100389867 | Ga0070684_1003898672 | 163 |
| 46 | 3300005535 | Ga0070684_100490385 | Ga0070684_1004903852 | 163 |
| 47 | 3300005539 | Ga0068853_100046253 | Ga0068853_1000462533 | 163 |
| 48 | 3300005543 | Ga0070672_100171497 | Ga0070672_1001714972 | 163 |
| 49 | 3300005547 | Ga0070693_100137229 | Ga0070693_1001372292 | 163 |
| 50 | 3300005578 | Ga0068854_100071452 | Ga0068854_1000714523 | 163 |
| 51 | 3300005616 | Ga0068852_100026197 | Ga0068852_1000261976 | 163 |
| 52 | 3300005718 | Ga0068866_10008276 | Ga0068866_100082764 | 163 |
| 53 | 3300005719 | Ga0068861_100502280 | Ga0068861_1005022802 | 163 |
| 54 | 3300006038 | Ga0075365_10027536 | Ga0075365_100275364 | 163 |
| 55 | 3300006038 | Ga0075365_10252103 | Ga0075365_102521032 | 163 |
| 56 | 3300006038 | Ga0075365_10317338 | Ga0075365_103173382 | 163 |
| 57 | 3300006048 | Ga0075363_100204999 | Ga0075363_1002049991 | 163 |
| 58 | 3300006178 | Ga0075367_10008972 | Ga0075367_100089722 | 163 |
| 59 | 3300006353 | Ga0075370_10000475 | Ga0075370_100004756 | 163 |
| 60 | 3300006353 | Ga0075370_10162255 | Ga0075370_101622552 | 163 |
| 61 | 3300006844 | Ga0075428_100302053 | Ga0075428_1003020532 | 163 |
| 62 | 3300006881 | Ga0068865_100150779 | Ga0068865_1001507792 | 163 |
| 63 | 3300009098 | Ga0105245_10025609 | Ga0105245_100256095 | 163 |
| 64 | 3300009098 | Ga0105245_10256397 | Ga0105245_102563972 | 163 |
| 65 | 3300009148 | Ga0105243_10106815 | Ga0105243_101068154 | 163 |
| 66 | 3300013105 | Ga0157369_10194420 | Ga0157369_101944202 | 163 |
| 67 | 3300013105 | Ga0157369_10388303 | Ga0157369_103883032 | 163 |
| 68 | 3300013307 | Ga0157372_10031509 | Ga0157372_100315092 | 163 |
| 69 | 3300013308 | Ga0157375_10718593 | Ga0157375_107185931 | 163 |
| 70 | 3300014325 | Ga0163163_10916925 | Ga0163163_109169252 | 163 |
| 71 | 3300014745 | Ga0157377_10005008 | Ga0157377_100050084 | 163 |
| 72 | 3300025901 | Ga0207688_10033832 | Ga0207688_100338323 | 163 |
| 73 | 3300025926 | Ga0207659_10470771 | Ga0207659_104707711 | 163 |
| 74 | 3300025927 | Ga0207687_10045877 | Ga0207687_100458772 | 163 |
| 75 | 3300025940 | Ga0207691_10006151 | Ga0207691_1000615112 | 163 |
| 76 | 3300025944 | Ga0207661_10135535 | Ga0207661_101355352 | 163 |
| 77 | 3300025960 | Ga0207651_10256804 | Ga0207651_102568042 | 163 |
| 78 | 3300025972 | Ga0207668_10103895 | Ga0207668_101038952 | 163 |
| 79 | 3300026023 | Ga0207677_10302623 | Ga0207677_103026232 | 163 |
| 80 | 3300026041 | Ga0207639_10123029 | Ga0207639_101230293 | 163 |
| 81 | 3300026075 | Ga0207708_10000379 | Ga0207708_100003792 | 163 |
| 82 | 3300026089 | Ga0207648_10002445 | Ga0207648_100024454 | 163 |
| 83 | 3300026118 | Ga0207675_100022928 | Ga0207675_1000229282 | 163 |
| 84 | 3300026121 | Ga0207683_10093282 | Ga0207683_100932822 | 163 |
| 85 | 3300026142 | Ga0207698_10195045 | Ga0207698_101950452 | 163 |
| 86 | 3300027866 | Ga0209813_10198475 | Ga0209813_101984752 | 163 |
| 87 | 3300038443 | Ga0395901_0352340 | Ga0395901_0352340_288_881 | 163 |
| 88 | 3300044765 | Ga0466970_0028495 | Ga0466970_0028495_1356_1973 | 163 |
| 89 | 3300048903 | Ga0496100_0427171 | Ga0496100_0427171_32_619 | 163 |
| 90 | 3300048909 | Ga0496106_0210660 | Ga0496106_0210660_255_842 | 163 |
| 91 | 3300048910 | Ga0496107_0154619 | Ga0496107_0154619_364_951 | 163 |
| 92 | 3300048912 | Ga0496109_0100798 | Ga0496109_0100798_89_676 | 163 |
| 93 | 3300048913 | Ga0496110_0160043 | Ga0496110_0160043_934_1521 | 163 |
| 94 | 3300049568 | Ga0501031_0008225 | Ga0501031_0008225_6001_6594 | 163 |
| 95 | 3300049572 | Ga0501036_0026263 | Ga0501036_0026263_1714_2307 | 163 |
| 96 | 3300049573 | Ga0501037_0317347 | Ga0501037_0317347_291_884 | 163 |
| 97 | 3300049576 | Ga0501040_0015443 | Ga0501040_0015443_2063_2656 | 163 |
| 98 | 3300049577 | Ga0501041_0006202 | Ga0501041_0006202_3628_4221 | 163 |
| 99 | 3300049578 | Ga0501042_0033213 | Ga0501042_0033213_2274_2867 | 163 |
| 100 | 3300049579 | Ga0501043_0643848 | Ga0501043_0643848_16_609 | 163 |
| 101 | 3300049580 | Ga0501046_0249183 | Ga0501046_0249183_134_727 | 163 |
| 102 | 3300049582 | Ga0501048_0034871 | Ga0501048_0034871_2815_3408 | 163 |
| 103 | 3300049586 | Ga0501070_0030971 | Ga0501070_0030971_1553_2137 | 163 |
| 104 | 3300049586 | Ga0501070_0038787 | Ga0501070_0038787_2121_2714 | 163 |
| 105 | 3300049587 | Ga0501071_0010499 | Ga0501071_0010499_4185_4778 | 163 |
| 106 | 3300049588 | Ga0501072_0008263 | Ga0501072_0008263_3333_3926 | 163 |
| 107 | 3300049591 | Ga0501075_0027862 | Ga0501075_0027862_3011_3604 | 163 |
| 108 | 3300049592 | Ga0501076_0592789 | Ga0501076_0592789_80_673 | 163 |
| 109 | 3300049742 | Ga0501080_0019678 | Ga0501080_0019678_2568_3161 | 163 |
| 110 | 3300049743 | Ga0501081_0042312 | Ga0501081_0042312_320_913 | 163 |
| 111 | 3300049824 | Ga0501045_0095468 | Ga0501045_0095468_524_1117 | 163 |
| 112 | 3300050490 | nmdc:mga03n38_64895_c1 | nmdc:mga03n38_64895_c1_12_590 | 163 |
| 113 | 3300050491 | nmdc:mga00v17_341374_c1 | nmdc:mga00v17_341374_c1_362_940 | 163 |
| 114 | 3300050492 | nmdc:mga0yw44_164530_c1 | nmdc:mga0yw44_164530_c1_132_728 | 163 |
| 115 | 3300050492 | nmdc:mga0yw44_375876_c1 | nmdc:mga0yw44_375876_c1_326_919 | 163 |
| 116 | 3300050492 | nmdc:mga0yw44_4224_c1 | nmdc:mga0yw44_4224_c1_3865_4443 | 163 |
| 117 | 3300050492 | nmdc:mga0yw44_537804_c1 | nmdc:mga0yw44_537804_c1_80_673 | 163 |
| 118 | 3300050494 | nmdc:mga06z11_14036_c1 | nmdc:mga06z11_14036_c1_2607_3185 | 163 |
| 119 | 3300050494 | nmdc:mga06z11_452617_c1 | nmdc:mga06z11_452617_c1_81_677 | 163 |
| 120 | 3300050494 | nmdc:mga06z11_640406_c1 | nmdc:mga06z11_640406_c1_35_628 | 163 |
| 121 | 3300050495 | nmdc:mga04h51_228510_c1 | nmdc:mga04h51_228510_c1_86_664 | 163 |
| 122 | 3300050496 | nmdc:mga07m45_13133_c1 | nmdc:mga07m45_13133_c1_2477_3055 | 163 |
| 123 | 3300050496 | nmdc:mga07m45_181353_c1 | nmdc:mga07m45_181353_c1_183_821 | 163 |
| 124 | 3300050496 | nmdc:mga07m45_91438_c1 | nmdc:mga07m45_91438_c1_932_1528 | 163 |
| 125 | 3300050511 | nmdc:mga08y16_72204_c1 | nmdc:mga08y16_72204_c1_1784_2371 | 163 |
| 126 | 3300054114 | Ga0501084_0067964 | Ga0501084_0067964_80_673 | 163 |
| 127 | 3300005367 | Ga0070667_100012931 | Ga0070667_1000129314 | 164 |
| 128 | 3300005843 | Ga0068860_100620027 | Ga0068860_1006200272 | 164 |
| 129 | 3300006038 | Ga0075365_10052420 | Ga0075365_100524201 | 164 |
| 130 | 3300006042 | Ga0075368_10004089 | Ga0075368_100040893 | 164 |
| 131 | 3300006048 | Ga0075363_100006491 | Ga0075363_1000064916 | 164 |
| 132 | 3300006048 | Ga0075363_100049121 | Ga0075363_1000491212 | 164 |
| 133 | 3300006051 | Ga0075364_10024972 | Ga0075364_100249724 | 164 |
| 134 | 3300006051 | Ga0075364_10103576 | Ga0075364_101035762 | 164 |
| 135 | 3300028381 | Ga0268264_10000320 | Ga0268264_1000032067 | 164 |
| 136 | 3300031995 | Ga0307409_100509116 | Ga0307409_1005091162 | 164 |
| 137 | 3300050490 | nmdc:mga03n38_166806_c1 | nmdc:mga03n38_166806_c1_495_1091 | 164 |
| 138 | 3300050491 | nmdc:mga00v17_8441_c1 | nmdc:mga00v17_8441_c1_4056_4652 | 164 |
| 139 | 3300050492 | nmdc:mga0yw44_441394_c1 | nmdc:mga0yw44_441394_c1_110_706 | 164 |
| 140 | 3300050495 | nmdc:mga04h51_808_c1 | nmdc:mga04h51_808_c1_2700_3296 | 164 |
| 141 | 3300005366 | Ga0070659_100227108 | Ga0070659_1002271082 | 165 |
| 142 | 3300005441 | Ga0070700_100659441 | Ga0070700_1006594411 | 165 |
| 143 | 3300005718 | Ga0068866_10264655 | Ga0068866_102646552 | 165 |
| 144 | 3300006881 | Ga0068865_100727909 | Ga0068865_1007279091 | 165 |
| 145 | 3300026075 | Ga0207708_10721889 | Ga0207708_107218892 | 165 |
| 146 | 3300044693 | Ga0466961_0149681 | Ga0466961_0149681_234_845 | 165 |
| 147 | 3300044765 | Ga0466970_0098567 | Ga0466970_0098567_847_1458 | 165 |
| 148 | 3300044842 | Ga0466957_0292975 | Ga0466957_0292975_64_675 | 165 |
| 149 | 3300045049 | Ga0466959_0102357 | Ga0466959_0102357_1121_1732 | 165 |
| 150 | 3300045836 | Ga0466958_0341823 | Ga0466958_0341823_173_784 | 165 |
| 151 | 3300045976 | Ga0466967_0446792 | Ga0466967_0446792_622_1233 | 165 |
| 152 | 3300049576 | Ga0501040_0171178 | Ga0501040_0171178_297_896 | 165 |
| 153 | 3300049587 | Ga0501071_0431250 | Ga0501071_0431250_33_629 | 165 |
| 154 | 3300049588 | Ga0501072_0224785 | Ga0501072_0224785_729_1325 | 165 |
| 155 | 3300049824 | Ga0501045_0383717 | Ga0501045_0383717_295_891 | 165 |
| 156 | 3300048908 | Ga0496105_0302730 | Ga0496105_0302730_436_1029 | 166 |
| 157 | 3300048912 | Ga0496109_0109592 | Ga0496109_0109592_857_1450 | 166 |
| 158 | 3300005327 | Ga0070658_10581562 | Ga0070658_105815622 | 167 |
| 159 | 3300005614 | Ga0068856_100562036 | Ga0068856_1005620362 | 167 |
| 160 | 3300013307 | Ga0157372_10305884 | Ga0157372_103058843 | 167 |
| 161 | 3300013308 | Ga0157375_10222134 | Ga0157375_102221342 | 167 |
| 162 | 3300013308 | Ga0157375_10242984 | Ga0157375_102429842 | 167 |
| 163 | 3300013308 | Ga0157375_10695508 | Ga0157375_106955082 | 167 |
| 164 | 3300020082 | Ga0206353_10156710 | Ga0206353_101567102 | 167 |
| 165 | 3300031995 | Ga0307409_100010434 | Ga0307409_1000104346 | 167 |
| 166 | 3300032005 | Ga0307411_10021417 | Ga0307411_100214173 | 167 |
| 167 | 3300041498 | Ga0451841_0315187 | Ga0451841_0315187_29_634 | 167 |
| 168 | 3300044683 | Ga0466965_0033876 | Ga0466965_0033876_708_1325 | 167 |
| 169 | 3300044694 | Ga0466963_0336397 | Ga0466963_0336397_373_990 | 167 |
| 170 | 3300044765 | Ga0466970_0021681 | Ga0466970_0021681_1321_1938 | 167 |
| 171 | 3300044842 | Ga0466957_0258795 | Ga0466957_0258795_53_670 | 167 |
| 172 | 3300045976 | Ga0466967_0047423 | Ga0466967_0047423_2761_3372 | 167 |
| 173 | 3300048904 | Ga0496101_0060842 | Ga0496101_0060842_511_1128 | 167 |
| 174 | 3300048905 | Ga0496102_0054815 | Ga0496102_0054815_1227_1844 | 167 |
| 175 | 3300048906 | Ga0496103_0224246 | Ga0496103_0224246_80_697 | 167 |
| 176 | 3300048907 | Ga0496104_0532570 | Ga0496104_0532570_112_729 | 167 |
| 177 | 3300048908 | Ga0496105_0155967 | Ga0496105_0155967_388_1005 | 167 |
| 178 | 3300048908 | Ga0496105_0339352 | Ga0496105_0339352_70_678 | 167 |
| 179 | 3300048910 | Ga0496107_0090314 | Ga0496107_0090314_311_928 | 167 |
| 180 | 3300048911 | Ga0496108_0087771 | Ga0496108_0087771_921_1529 | 167 |
| 181 | 3300048911 | Ga0496108_0256884 | Ga0496108_0256884_818_1426 | 167 |
| 182 | 3300048912 | Ga0496109_0035443 | Ga0496109_0035443_885_1493 | 167 |
| 183 | 3300048912 | Ga0496109_0089463 | Ga0496109_0089463_631_1248 | 167 |
| 184 | 3300048913 | Ga0496110_0293492 | Ga0496110_0293492_624_1235 | 167 |
| 185 | 3300048916 | Ga0496113_0192508 | Ga0496113_0192508_67_684 | 167 |
| 186 | 3300048917 | Ga0496114_0045004 | Ga0496114_0045004_2923_3540 | 167 |
| 187 | 3300048917 | Ga0496114_0052576 | Ga0496114_0052576_1158_1775 | 167 |
| 188 | 3300048917 | Ga0496114_0088654 | Ga0496114_0088654_1621_2238 | 167 |
| 189 | 3300049575 | Ga0501039_0361205 | Ga0501039_0361205_407_1006 | 167 |
| 190 | 3300049591 | Ga0501075_0136499 | Ga0501075_0136499_1184_1807 | 167 |
| 191 | 3300049743 | Ga0501081_0363564 | Ga0501081_0363564_241_864 | 167 |
| 192 | 3300053085 | Ga0495619_0368083 | Ga0495619_0368083_137_745 | 167 |
| 193 | 3300061719 | Ga0466962_0056431 | Ga0466962_0056431_269_886 | 167 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5t8z-assembly1.cif.gz_A | crystal structure of a peptide deformylase from burkholderia multivorans in complex with actinonin | 0.9429 | 14 | 161 |
| 4dr9-assembly1.cif.gz_A | crystal structure of a peptide deformylase from synechococcus elongatus in complex with actinonin | 0.934 | 18 | 161 |
| 5cx0-assembly1.cif.gz_A-2 | structure of xoo1075, a peptide deformylase from xanthomonas oryzae pv. oryzae, in complex with fragment 322 | 0.9318 | 14 | 160 |
| 5i2b-assembly1.cif.gz_A-2 | crystal structure of a peptide deformylase from burkholderia ambifaria with actinonin | 0.9262 | 14 | 160 |
| 6il2-assembly1.cif.gz_A | k4u complex structure of peptide deformylase from xanthomonas oryzae pv. oryzae | 0.9253 | 14 | 161 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5mtdB00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9194 | 17 | 161 | 3.90.45.10 |
| 3g5pA00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9132 | 14 | 161 | 3.90.45.10 |
| 1ws1A00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9127 | 14 | 161 | 3.90.45.10 |
| 5vcpA00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9121 | 15 | 160 | 3.90.45.10 |
| 4dr9B00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9081 | 18 | 161 | 3.90.45.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838GH81-F1-model_v4 | peptide deformylase (EC 3.5.1.88) | 0.9868 | 8 | 161 |
GO:0006412
GO:0042586 GO:0043686 |
| AF-A0A7V9MD65-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9865 | 7 | 161 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A7X0U2V1-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9861 | 26 | 160 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A7X8B5T6-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9854 | 13 | 161 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A1G9PX47-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9854 | 12 | 160 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar