F297811

General Info

Members Datasets Scaffolds Average Seq Length
193 128 193 190

Family's Representative Sequence

Representative Sequence 3300050496|nmdc:mga07m45_181353_c1|nmdc:mga07m45_181353_c1_183_821
Length 212
Sequence MRSERLIPPARALGRVARVSEQTVHAPYGQLPRGGVVRPITRWGEPVMHRPQQPVTAYDDELERLAADMVETMYAADGVGLAACQIGVDRAIFVFDCPDDDGRRTLGVVCNPELTLPEGKDRKLDEGDEGCLSYPGAFVECARPDFATVTGTGLDGSPVEFSGTGMLARCLQHETDHTKGTVFGDRLATKQRKRLQKAMEKAADDYPLDWPT

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
40 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
41 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
62 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
63 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
70 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
73 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
74 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
75 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
76 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
82 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
83 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
84 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
85 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
86 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
87 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
88 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
89 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
90 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
91 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
94 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
95 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
96 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
107 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
108 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
109 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
110 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
111 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
112 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
113 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
114 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
115 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
116 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
117 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
118 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
119 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
120 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
121 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
122 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
123 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
126 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
127 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
128 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.13
Nodule 0
Rhizoplane 13.99
Rhizosphere 66.84
Stem 0
Stem Tuber 0
Unclassified 1.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10581562 3300005327 Bacteria 970
2 Ga0070683_100019433 3300005329 Bacteria 6034
3 Ga0068868_100063111 3300005338 Bacteria 2938
4 Ga0070692_10001392 3300005345 Bacteria 8752
5 Ga0070671_100293728 3300005355 Bacteria 1383
6 Ga0070673_100212698 3300005364 Bacteria 1671
7 Ga0070659_100227108 3300005366 Bacteria 1542
8 Ga0070667_100012931 3300005367 Bacteria 6900
9 Ga0070667_100059835 3300005367 Bacteria 3223
10 Ga0070700_100004347 3300005441 Bacteria 7395
11 Ga0070700_100659441 3300005441 Bacteria 827
12 Ga0070685_10026895 3300005466 Bacteria 3175
13 Ga0070684_100389867 3300005535 Bacteria 1283
14 Ga0070684_100490385 3300005535 Bacteria 1138
15 Ga0068853_100046253 3300005539 Bacteria 3731
16 Ga0070672_100171497 3300005543 Bacteria 1805
17 Ga0070693_100137229 3300005547 Bacteria 1535
18 Ga0068854_100071452 3300005578 Bacteria 2539
19 Ga0068856_100562036 3300005614 Bacteria 1162
20 Ga0068852_100026197 3300005616 Bacteria 4735
21 Ga0068866_10008276 3300005718 Bacteria 4377
22 Ga0068866_10264655 3300005718 Bacteria 1058
23 Ga0068861_100502280 3300005719 Bacteria 1096
24 Ga0068860_100620027 3300005843 Bacteria 1088
25 Ga0081539_10083045 3300005985 Bacteria 1678
26 Ga0075365_10027536 3300006038 Bacteria 3618
27 Ga0075365_10052420 3300006038 Bacteria 2698
28 Ga0075365_10252103 3300006038 Bacteria 1240
29 Ga0075365_10317338 3300006038 Bacteria 1097
30 Ga0075368_10004089 3300006042 Bacteria 4909
31 Ga0075363_100006491 3300006048 Bacteria 5318
32 Ga0075363_100049121 3300006048 Bacteria 2245
33 Ga0075363_100094873 3300006048 Bacteria 1645
34 Ga0075363_100204999 3300006048 Bacteria 1127
35 Ga0075364_10008289 3300006051 Bacteria 6207
36 Ga0075364_10024972 3300006051 Bacteria 3800
37 Ga0075364_10103576 3300006051 Bacteria 1895
38 Ga0075367_10008972 3300006178 Bacteria 5206
39 Ga0075370_10000475 3300006353 Bacteria 15085
40 Ga0075370_10000774 3300006353 Bacteria 12812
41 Ga0075370_10162255 3300006353 Bacteria 1312
42 Ga0075428_100302053 3300006844 Bacteria 1721
43 Ga0068865_100150779 3300006881 Bacteria 1764
44 Ga0068865_100727909 3300006881 Bacteria 850
45 Ga0111539_12132142 3300009094 Bacteria 650
46 Ga0105245_10025609 3300009098 Bacteria 5188
47 Ga0105245_10060124 3300009098 Bacteria 3422
48 Ga0105245_10256397 3300009098 Bacteria 1701
49 Ga0105243_10106815 3300009148 Bacteria 2334
50 Ga0105249_10105751 3300009553 Bacteria 2654
51 Ga0157369_10194420 3300013105 Bacteria 2131
52 Ga0157369_10388303 3300013105 Bacteria 1449
53 Ga0157372_10031509 3300013307 Bacteria 5805
54 Ga0157372_10305884 3300013307 Bacteria 1850
55 Ga0157372_11018202 3300013307 Bacteria 959
56 Ga0157372_12198279 3300013307 Bacteria 634
57 Ga0157375_10222134 3300013308 Bacteria 2047
58 Ga0157375_10242984 3300013308 Bacteria 1960
59 Ga0157375_10695508 3300013308 Bacteria 1171
60 Ga0157375_10718593 3300013308 Bacteria 1152
61 Ga0163163_10916925 3300014325 Bacteria 939
62 Ga0157380_12578589 3300014326 Bacteria 574
63 Ga0182008_10039018 3300014497 Bacteria 2374
64 Ga0157377_10005008 3300014745 Bacteria 6181
65 Ga0206353_10156710 3300020082 Bacteria 2453
66 Ga0207688_10033832 3300025901 Bacteria 2828
67 Ga0207643_10105457 3300025908 Bacteria 1656
68 Ga0207659_10470771 3300025926 Bacteria 1060
69 Ga0207687_10045877 3300025927 Bacteria 3023
70 Ga0207687_10066722 3300025927 Bacteria 2558
71 Ga0207669_10736400 3300025937 Bacteria 813
72 Ga0207691_10006151 3300025940 Bacteria 11606
73 Ga0207661_10135535 3300025944 Bacteria 2114
74 Ga0207651_10256804 3300025960 Bacteria 1433
75 Ga0207668_10103895 3300025972 Bacteria 2117
76 Ga0207658_10043562 3300025986 Bacteria 3263
77 Ga0207677_10302623 3300026023 Bacteria 1321
78 Ga0207639_10123029 3300026041 Bacteria 2135
79 Ga0207708_10000379 3300026075 Bacteria 34728
80 Ga0207708_10721889 3300026075 Bacteria 853
81 Ga0207648_10002445 3300026089 Bacteria 19971
82 Ga0207675_100022928 3300026118 Bacteria 5807
83 Ga0207683_10093282 3300026121 Bacteria 2683
84 Ga0207698_10195045 3300026142 Bacteria 1808
85 Ga0209813_10198475 3300027866 Bacteria 742
86 Ga0268264_10000320 3300028381 Bacteria 75931
87 Ga0307410_10139770 3300031852 Bacteria 1790
88 Ga0307406_10340504 3300031901 Bacteria 1168
89 Ga0307407_10116692 3300031903 Bacteria 1685
90 Ga0307409_100010434 3300031995 Bacteria 5779
91 Ga0307409_100509116 3300031995 Bacteria 1174
92 Ga0307416_100072687 3300032002 Bacteria 2864
93 Ga0307414_10231725 3300032004 Bacteria 1523
94 Ga0307411_10021417 3300032005 Bacteria 3783
95 Ga0307411_10327717 3300032005 Bacteria 1239
96 Ga0307415_100169924 3300032126 Bacteria 1699
97 Ga0395900_0081917 3300037418 Bacteria 3315
98 Ga0436364_0459928 3300037853 Bacteria 1691
99 Ga0395901_0352340 3300038443 Bacteria 1519
100 Ga0451841_0315187 3300041498 Bacteria 645
101 Ga0466965_0033876 3300044683 Bacteria 2498
102 Ga0466961_0149681 3300044693 Bacteria 1458
103 Ga0466963_0336397 3300044694 Bacteria 1063
104 Ga0466970_0021681 3300044765 Bacteria 3348
105 Ga0466970_0028495 3300044765 Bacteria 2935
106 Ga0466970_0098567 3300044765 Bacteria 1590
107 Ga0466970_0945017 3300044765 Bacteria 508
108 Ga0466957_0258795 3300044842 Bacteria 1159
109 Ga0466957_0292975 3300044842 Bacteria 1092
110 Ga0466959_0102357 3300045049 Bacteria 2050
111 Ga0466958_0341823 3300045836 Bacteria 963
112 Ga0466967_0047423 3300045976 Bacteria 3745
113 Ga0466967_0446792 3300045976 Bacteria 1263
114 Ga0495652_0670970 3300046529 Bacteria 700
115 Ga0496100_0427171 3300048903 Bacteria 1013
116 Ga0496101_0060842 3300048904 Bacteria 2741
117 Ga0496102_0054815 3300048905 Bacteria 3636
118 Ga0496103_0224246 3300048906 Bacteria 1209
119 Ga0496104_0532570 3300048907 Bacteria 1086
120 Ga0496105_0155967 3300048908 Bacteria 1875
121 Ga0496105_0302730 3300048908 Bacteria 1285
122 Ga0496105_0339352 3300048908 Bacteria 1202
123 Ga0496106_0210660 3300048909 Bacteria 1548
124 Ga0496107_0090314 3300048910 Bacteria 2237
125 Ga0496107_0154619 3300048910 Bacteria 1698
126 Ga0496107_0312516 3300048910 Bacteria 1169
127 Ga0496108_0087771 3300048911 Bacteria 2642
128 Ga0496108_0108011 3300048911 Bacteria 2377
129 Ga0496108_0256884 3300048911 Bacteria 1520
130 Ga0496109_0035443 3300048912 Bacteria 4501
131 Ga0496109_0089463 3300048912 Bacteria 2846
132 Ga0496109_0100798 3300048912 Bacteria 2679
133 Ga0496109_0109592 3300048912 Bacteria 2567
134 Ga0496110_0160043 3300048913 Bacteria 2041
135 Ga0496110_0235112 3300048913 Bacteria 1667
136 Ga0496110_0293492 3300048913 Bacteria 1481
137 Ga0496111_0308454 3300048914 Bacteria 1173
138 Ga0496113_0192508 3300048916 Bacteria 1619
139 Ga0496114_0045004 3300048917 Bacteria 3664
140 Ga0496114_0052576 3300048917 Bacteria 3394
141 Ga0496114_0088654 3300048917 Bacteria 2624
142 Ga0501031_0008225 3300049568 Bacteria 6786
143 Ga0501036_0026263 3300049572 Bacteria 4914
144 Ga0501037_0317347 3300049573 Bacteria 1079
145 Ga0501039_0361205 3300049575 Bacteria 1141
146 Ga0501040_0015443 3300049576 Bacteria 5048
147 Ga0501040_0171178 3300049576 Bacteria 1538
148 Ga0501041_0006202 3300049577 Bacteria 6990
149 Ga0501042_0033213 3300049578 Bacteria 3657
150 Ga0501043_0643848 3300049579 Bacteria 779
151 Ga0501046_0249183 3300049580 Bacteria 1308
152 Ga0501048_0034871 3300049582 Bacteria 3626
153 Ga0501048_0059712 3300049582 Bacteria 2703
154 Ga0501067_0033621 3300049583 Bacteria 2844
155 Ga0501068_0127008 3300049584 Bacteria 1593
156 Ga0501069_0030369 3300049585 Bacteria 2967
157 Ga0501070_0030971 3300049586 Bacteria 4481
158 Ga0501070_0038787 3300049586 Bacteria 3975
159 Ga0501071_0010499 3300049587 Bacteria 6209
160 Ga0501071_0431250 3300049587 Bacteria 1008
161 Ga0501072_0008263 3300049588 Bacteria 7908
162 Ga0501072_0224785 3300049588 Bacteria 1496
163 Ga0501075_0027862 3300049591 Bacteria 4166
164 Ga0501075_0136499 3300049591 Bacteria 1869
165 Ga0501076_0592789 3300049592 Bacteria 914
166 Ga0501243_019051 3300049675 Bacteria 1123
167 Ga0501080_0019678 3300049742 Bacteria 6252
168 Ga0501081_0042312 3300049743 Bacteria 3121
169 Ga0501081_0363564 3300049743 Bacteria 1068
170 Ga0501045_0095468 3300049824 Bacteria 2199
171 Ga0501045_0383717 3300049824 Bacteria 1046
172 nmdc:mga03n38_166806_c1 3300050490 Bacteria 1119
173 nmdc:mga03n38_64895_c1 3300050490 Bacteria 1673
174 nmdc:mga00v17_341374_c1 3300050491 Bacteria 974
175 nmdc:mga00v17_8441_c1 3300050491 Bacteria 5544
176 nmdc:mga0yw44_164530_c1 3300050492 Bacteria 1454
177 nmdc:mga0yw44_375876_c1 3300050492 Bacteria 959
178 nmdc:mga0yw44_4224_c1 3300050492 Bacteria 6542
179 nmdc:mga0yw44_441394_c1 3300050492 Bacteria 882
180 nmdc:mga0yw44_537804_c1 3300050492 Bacteria 793
181 nmdc:mga06z11_14036_c1 3300050494 Bacteria 3536
182 nmdc:mga06z11_452617_c1 3300050494 Bacteria 776
183 nmdc:mga06z11_640406_c1 3300050494 Bacteria 647
184 nmdc:mga04h51_228510_c1 3300050495 Bacteria 740
185 nmdc:mga04h51_808_c1 3300050495 Bacteria 7281
186 nmdc:mga07m45_13133_c1 3300050496 Bacteria 4386
187 nmdc:mga07m45_181353_c1 3300050496 Bacteria 1224
188 nmdc:mga07m45_91438_c1 3300050496 Bacteria 1743
189 nmdc:mga08y16_72204_c1 3300050511 Bacteria 3597
190 Ga0495619_0368083 3300053085 Bacteria 994
191 Ga0500644_0000541 3300053088 Bacteria 15557
192 Ga0501084_0067964 3300054114 Bacteria 2983
193 Ga0466962_0056431 3300061719 Bacteria 1876

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044765 Ga0466970_0945017 Ga0466970_0945017_22_486 131
2 3300049582 Ga0501048_0059712 Ga0501048_0059712_1242_1739 138
3 3300037418 Ga0395900_0081917 Ga0395900_0081917_434_934 139
4 3300009094 Ga0111539_12132142 Ga0111539_121321421 146
5 3300009553 Ga0105249_10105751 Ga0105249_101057514 146
6 3300013307 Ga0157372_12198279 Ga0157372_121982791 146
7 3300014326 Ga0157380_12578589 Ga0157380_125785891 146
8 3300025937 Ga0207669_10736400 Ga0207669_107364002 146
9 3300048911 Ga0496108_0108011 Ga0496108_0108011_15_536 146
10 3300049583 Ga0501067_0033621 Ga0501067_0033621_2278_2799 146
11 3300025908 Ga0207643_10105457 Ga0207643_101054571 148
12 3300046529 Ga0495652_0670970 Ga0495652_0670970_114_650 150
13 3300005367 Ga0070667_100059835 Ga0070667_1000598354 152
14 3300025986 Ga0207658_10043562 Ga0207658_100435623 152
15 3300048913 Ga0496110_0235112 Ga0496110_0235112_940_1533 152
16 3300009098 Ga0105245_10060124 Ga0105245_100601243 154
17 3300013307 Ga0157372_11018202 Ga0157372_110182022 154
18 3300025927 Ga0207687_10066722 Ga0207687_100667221 154
19 3300037853 Ga0436364_0459928 Ga0436364_0459928_535_1074 154
20 3300005985 Ga0081539_10083045 Ga0081539_100830452 160
21 3300006048 Ga0075363_100094873 Ga0075363_1000948732 161
22 3300006051 Ga0075364_10008289 Ga0075364_100082892 161
23 3300006353 Ga0075370_10000774 Ga0075370_100007742 161
24 3300031852 Ga0307410_10139770 Ga0307410_101397702 161
25 3300031901 Ga0307406_10340504 Ga0307406_103405042 161
26 3300031903 Ga0307407_10116692 Ga0307407_101166922 161
27 3300032002 Ga0307416_100072687 Ga0307416_1000726872 161
28 3300032004 Ga0307414_10231725 Ga0307414_102317252 161
29 3300032005 Ga0307411_10327717 Ga0307411_103277172 161
30 3300032126 Ga0307415_100169924 Ga0307415_1001699242 161
31 3300048910 Ga0496107_0312516 Ga0496107_0312516_175_759 161
32 3300048914 Ga0496111_0308454 Ga0496111_0308454_514_1098 161
33 3300049584 Ga0501068_0127008 Ga0501068_0127008_418_1005 161
34 3300049585 Ga0501069_0030369 Ga0501069_0030369_523_1101 161
35 3300049675 Ga0501243_019051 Ga0501243_019051_518_1087 161
36 3300053088 Ga0500644_0000541 Ga0500644_0000541_8009_8593 161
37 3300014497 Ga0182008_10039018 Ga0182008_100390182 162
38 3300005329 Ga0070683_100019433 Ga0070683_1000194337 163
39 3300005338 Ga0068868_100063111 Ga0068868_1000631112 163
40 3300005345 Ga0070692_10001392 Ga0070692_100013928 163
41 3300005355 Ga0070671_100293728 Ga0070671_1002937282 163
42 3300005364 Ga0070673_100212698 Ga0070673_1002126982 163
43 3300005441 Ga0070700_100004347 Ga0070700_1000043472 163
44 3300005466 Ga0070685_10026895 Ga0070685_100268954 163
45 3300005535 Ga0070684_100389867 Ga0070684_1003898672 163
46 3300005535 Ga0070684_100490385 Ga0070684_1004903852 163
47 3300005539 Ga0068853_100046253 Ga0068853_1000462533 163
48 3300005543 Ga0070672_100171497 Ga0070672_1001714972 163
49 3300005547 Ga0070693_100137229 Ga0070693_1001372292 163
50 3300005578 Ga0068854_100071452 Ga0068854_1000714523 163
51 3300005616 Ga0068852_100026197 Ga0068852_1000261976 163
52 3300005718 Ga0068866_10008276 Ga0068866_100082764 163
53 3300005719 Ga0068861_100502280 Ga0068861_1005022802 163
54 3300006038 Ga0075365_10027536 Ga0075365_100275364 163
55 3300006038 Ga0075365_10252103 Ga0075365_102521032 163
56 3300006038 Ga0075365_10317338 Ga0075365_103173382 163
57 3300006048 Ga0075363_100204999 Ga0075363_1002049991 163
58 3300006178 Ga0075367_10008972 Ga0075367_100089722 163
59 3300006353 Ga0075370_10000475 Ga0075370_100004756 163
60 3300006353 Ga0075370_10162255 Ga0075370_101622552 163
61 3300006844 Ga0075428_100302053 Ga0075428_1003020532 163
62 3300006881 Ga0068865_100150779 Ga0068865_1001507792 163
63 3300009098 Ga0105245_10025609 Ga0105245_100256095 163
64 3300009098 Ga0105245_10256397 Ga0105245_102563972 163
65 3300009148 Ga0105243_10106815 Ga0105243_101068154 163
66 3300013105 Ga0157369_10194420 Ga0157369_101944202 163
67 3300013105 Ga0157369_10388303 Ga0157369_103883032 163
68 3300013307 Ga0157372_10031509 Ga0157372_100315092 163
69 3300013308 Ga0157375_10718593 Ga0157375_107185931 163
70 3300014325 Ga0163163_10916925 Ga0163163_109169252 163
71 3300014745 Ga0157377_10005008 Ga0157377_100050084 163
72 3300025901 Ga0207688_10033832 Ga0207688_100338323 163
73 3300025926 Ga0207659_10470771 Ga0207659_104707711 163
74 3300025927 Ga0207687_10045877 Ga0207687_100458772 163
75 3300025940 Ga0207691_10006151 Ga0207691_1000615112 163
76 3300025944 Ga0207661_10135535 Ga0207661_101355352 163
77 3300025960 Ga0207651_10256804 Ga0207651_102568042 163
78 3300025972 Ga0207668_10103895 Ga0207668_101038952 163
79 3300026023 Ga0207677_10302623 Ga0207677_103026232 163
80 3300026041 Ga0207639_10123029 Ga0207639_101230293 163
81 3300026075 Ga0207708_10000379 Ga0207708_100003792 163
82 3300026089 Ga0207648_10002445 Ga0207648_100024454 163
83 3300026118 Ga0207675_100022928 Ga0207675_1000229282 163
84 3300026121 Ga0207683_10093282 Ga0207683_100932822 163
85 3300026142 Ga0207698_10195045 Ga0207698_101950452 163
86 3300027866 Ga0209813_10198475 Ga0209813_101984752 163
87 3300038443 Ga0395901_0352340 Ga0395901_0352340_288_881 163
88 3300044765 Ga0466970_0028495 Ga0466970_0028495_1356_1973 163
89 3300048903 Ga0496100_0427171 Ga0496100_0427171_32_619 163
90 3300048909 Ga0496106_0210660 Ga0496106_0210660_255_842 163
91 3300048910 Ga0496107_0154619 Ga0496107_0154619_364_951 163
92 3300048912 Ga0496109_0100798 Ga0496109_0100798_89_676 163
93 3300048913 Ga0496110_0160043 Ga0496110_0160043_934_1521 163
94 3300049568 Ga0501031_0008225 Ga0501031_0008225_6001_6594 163
95 3300049572 Ga0501036_0026263 Ga0501036_0026263_1714_2307 163
96 3300049573 Ga0501037_0317347 Ga0501037_0317347_291_884 163
97 3300049576 Ga0501040_0015443 Ga0501040_0015443_2063_2656 163
98 3300049577 Ga0501041_0006202 Ga0501041_0006202_3628_4221 163
99 3300049578 Ga0501042_0033213 Ga0501042_0033213_2274_2867 163
100 3300049579 Ga0501043_0643848 Ga0501043_0643848_16_609 163
101 3300049580 Ga0501046_0249183 Ga0501046_0249183_134_727 163
102 3300049582 Ga0501048_0034871 Ga0501048_0034871_2815_3408 163
103 3300049586 Ga0501070_0030971 Ga0501070_0030971_1553_2137 163
104 3300049586 Ga0501070_0038787 Ga0501070_0038787_2121_2714 163
105 3300049587 Ga0501071_0010499 Ga0501071_0010499_4185_4778 163
106 3300049588 Ga0501072_0008263 Ga0501072_0008263_3333_3926 163
107 3300049591 Ga0501075_0027862 Ga0501075_0027862_3011_3604 163
108 3300049592 Ga0501076_0592789 Ga0501076_0592789_80_673 163
109 3300049742 Ga0501080_0019678 Ga0501080_0019678_2568_3161 163
110 3300049743 Ga0501081_0042312 Ga0501081_0042312_320_913 163
111 3300049824 Ga0501045_0095468 Ga0501045_0095468_524_1117 163
112 3300050490 nmdc:mga03n38_64895_c1 nmdc:mga03n38_64895_c1_12_590 163
113 3300050491 nmdc:mga00v17_341374_c1 nmdc:mga00v17_341374_c1_362_940 163
114 3300050492 nmdc:mga0yw44_164530_c1 nmdc:mga0yw44_164530_c1_132_728 163
115 3300050492 nmdc:mga0yw44_375876_c1 nmdc:mga0yw44_375876_c1_326_919 163
116 3300050492 nmdc:mga0yw44_4224_c1 nmdc:mga0yw44_4224_c1_3865_4443 163
117 3300050492 nmdc:mga0yw44_537804_c1 nmdc:mga0yw44_537804_c1_80_673 163
118 3300050494 nmdc:mga06z11_14036_c1 nmdc:mga06z11_14036_c1_2607_3185 163
119 3300050494 nmdc:mga06z11_452617_c1 nmdc:mga06z11_452617_c1_81_677 163
120 3300050494 nmdc:mga06z11_640406_c1 nmdc:mga06z11_640406_c1_35_628 163
121 3300050495 nmdc:mga04h51_228510_c1 nmdc:mga04h51_228510_c1_86_664 163
122 3300050496 nmdc:mga07m45_13133_c1 nmdc:mga07m45_13133_c1_2477_3055 163
123 3300050496 nmdc:mga07m45_181353_c1 nmdc:mga07m45_181353_c1_183_821 163
124 3300050496 nmdc:mga07m45_91438_c1 nmdc:mga07m45_91438_c1_932_1528 163
125 3300050511 nmdc:mga08y16_72204_c1 nmdc:mga08y16_72204_c1_1784_2371 163
126 3300054114 Ga0501084_0067964 Ga0501084_0067964_80_673 163
127 3300005367 Ga0070667_100012931 Ga0070667_1000129314 164
128 3300005843 Ga0068860_100620027 Ga0068860_1006200272 164
129 3300006038 Ga0075365_10052420 Ga0075365_100524201 164
130 3300006042 Ga0075368_10004089 Ga0075368_100040893 164
131 3300006048 Ga0075363_100006491 Ga0075363_1000064916 164
132 3300006048 Ga0075363_100049121 Ga0075363_1000491212 164
133 3300006051 Ga0075364_10024972 Ga0075364_100249724 164
134 3300006051 Ga0075364_10103576 Ga0075364_101035762 164
135 3300028381 Ga0268264_10000320 Ga0268264_1000032067 164
136 3300031995 Ga0307409_100509116 Ga0307409_1005091162 164
137 3300050490 nmdc:mga03n38_166806_c1 nmdc:mga03n38_166806_c1_495_1091 164
138 3300050491 nmdc:mga00v17_8441_c1 nmdc:mga00v17_8441_c1_4056_4652 164
139 3300050492 nmdc:mga0yw44_441394_c1 nmdc:mga0yw44_441394_c1_110_706 164
140 3300050495 nmdc:mga04h51_808_c1 nmdc:mga04h51_808_c1_2700_3296 164
141 3300005366 Ga0070659_100227108 Ga0070659_1002271082 165
142 3300005441 Ga0070700_100659441 Ga0070700_1006594411 165
143 3300005718 Ga0068866_10264655 Ga0068866_102646552 165
144 3300006881 Ga0068865_100727909 Ga0068865_1007279091 165
145 3300026075 Ga0207708_10721889 Ga0207708_107218892 165
146 3300044693 Ga0466961_0149681 Ga0466961_0149681_234_845 165
147 3300044765 Ga0466970_0098567 Ga0466970_0098567_847_1458 165
148 3300044842 Ga0466957_0292975 Ga0466957_0292975_64_675 165
149 3300045049 Ga0466959_0102357 Ga0466959_0102357_1121_1732 165
150 3300045836 Ga0466958_0341823 Ga0466958_0341823_173_784 165
151 3300045976 Ga0466967_0446792 Ga0466967_0446792_622_1233 165
152 3300049576 Ga0501040_0171178 Ga0501040_0171178_297_896 165
153 3300049587 Ga0501071_0431250 Ga0501071_0431250_33_629 165
154 3300049588 Ga0501072_0224785 Ga0501072_0224785_729_1325 165
155 3300049824 Ga0501045_0383717 Ga0501045_0383717_295_891 165
156 3300048908 Ga0496105_0302730 Ga0496105_0302730_436_1029 166
157 3300048912 Ga0496109_0109592 Ga0496109_0109592_857_1450 166
158 3300005327 Ga0070658_10581562 Ga0070658_105815622 167
159 3300005614 Ga0068856_100562036 Ga0068856_1005620362 167
160 3300013307 Ga0157372_10305884 Ga0157372_103058843 167
161 3300013308 Ga0157375_10222134 Ga0157375_102221342 167
162 3300013308 Ga0157375_10242984 Ga0157375_102429842 167
163 3300013308 Ga0157375_10695508 Ga0157375_106955082 167
164 3300020082 Ga0206353_10156710 Ga0206353_101567102 167
165 3300031995 Ga0307409_100010434 Ga0307409_1000104346 167
166 3300032005 Ga0307411_10021417 Ga0307411_100214173 167
167 3300041498 Ga0451841_0315187 Ga0451841_0315187_29_634 167
168 3300044683 Ga0466965_0033876 Ga0466965_0033876_708_1325 167
169 3300044694 Ga0466963_0336397 Ga0466963_0336397_373_990 167
170 3300044765 Ga0466970_0021681 Ga0466970_0021681_1321_1938 167
171 3300044842 Ga0466957_0258795 Ga0466957_0258795_53_670 167
172 3300045976 Ga0466967_0047423 Ga0466967_0047423_2761_3372 167
173 3300048904 Ga0496101_0060842 Ga0496101_0060842_511_1128 167
174 3300048905 Ga0496102_0054815 Ga0496102_0054815_1227_1844 167
175 3300048906 Ga0496103_0224246 Ga0496103_0224246_80_697 167
176 3300048907 Ga0496104_0532570 Ga0496104_0532570_112_729 167
177 3300048908 Ga0496105_0155967 Ga0496105_0155967_388_1005 167
178 3300048908 Ga0496105_0339352 Ga0496105_0339352_70_678 167
179 3300048910 Ga0496107_0090314 Ga0496107_0090314_311_928 167
180 3300048911 Ga0496108_0087771 Ga0496108_0087771_921_1529 167
181 3300048911 Ga0496108_0256884 Ga0496108_0256884_818_1426 167
182 3300048912 Ga0496109_0035443 Ga0496109_0035443_885_1493 167
183 3300048912 Ga0496109_0089463 Ga0496109_0089463_631_1248 167
184 3300048913 Ga0496110_0293492 Ga0496110_0293492_624_1235 167
185 3300048916 Ga0496113_0192508 Ga0496113_0192508_67_684 167
186 3300048917 Ga0496114_0045004 Ga0496114_0045004_2923_3540 167
187 3300048917 Ga0496114_0052576 Ga0496114_0052576_1158_1775 167
188 3300048917 Ga0496114_0088654 Ga0496114_0088654_1621_2238 167
189 3300049575 Ga0501039_0361205 Ga0501039_0361205_407_1006 167
190 3300049591 Ga0501075_0136499 Ga0501075_0136499_1184_1807 167
191 3300049743 Ga0501081_0363564 Ga0501081_0363564_241_864 167
192 3300053085 Ga0495619_0368083 Ga0495619_0368083_137_745 167
193 3300061719 Ga0466962_0056431 Ga0466962_0056431_269_886 167

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

37

193

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5t8z-assembly1.cif.gz_A crystal structure of a peptide deformylase from burkholderia multivorans in complex with actinonin 0.9429 14 161
4dr9-assembly1.cif.gz_A crystal structure of a peptide deformylase from synechococcus elongatus in complex with actinonin 0.934 18 161
5cx0-assembly1.cif.gz_A-2 structure of xoo1075, a peptide deformylase from xanthomonas oryzae pv. oryzae, in complex with fragment 322 0.9318 14 160
5i2b-assembly1.cif.gz_A-2 crystal structure of a peptide deformylase from burkholderia ambifaria with actinonin 0.9262 14 160
6il2-assembly1.cif.gz_A k4u complex structure of peptide deformylase from xanthomonas oryzae pv. oryzae 0.9253 14 161
ID Description Score Start End Superfamily
5mtdB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9194 17 161 3.90.45.10
3g5pA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9132 14 161 3.90.45.10
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9127 14 161 3.90.45.10
5vcpA00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9121 15 160 3.90.45.10
4dr9B00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9081 18 161 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A838GH81-F1-model_v4 peptide deformylase (EC 3.5.1.88) 0.9868 8 161 GO:0006412
GO:0042586
GO:0043686
AF-A0A7V9MD65-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9865 7 161 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A7X0U2V1-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9861 26 160 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A7X8B5T6-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9854 13 161 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A1G9PX47-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9854 12 160 GO:0006412
GO:0042586
GO:0043686
GO:0046872

Feature Viewer

pLDDT pTM Quality
87.93 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map