F298098

General Info

Members Datasets Scaffolds Average Seq Length
194 132 189 226

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10139856|Ga0070658_101398563
Length 227
Sequence MAEYVFAPPVQAAVPVEGSSALFPVRRILCVGRNYAAHRAEMGGDDREPPFFFSKPADAVVTPGHDAPYPSLTRNLHHEVELVAALGAGGADVSVEAARAMVFGYAVGVDLTRRDLQSAAKDKGQPWDSGKAFDAAAPIGLIRPAALCGDVQGRIRLTVNGETRQDATVADMIWSLPEVIAQASRLWRLAPGDLIYTGTPEGVGPLVRGDVAHGEIEAVGVLDFKIV

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
3 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
4 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
5 2643221584 Caulobacter sp. Root656 Isolate Unclassified
6 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
39 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
43 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
44 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
72 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
73 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
74 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
75 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
76 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
77 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
78 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
86 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
87 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
88 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
89 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
90 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
91 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
92 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
93 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
94 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
95 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
96 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
97 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
98 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
99 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
100 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
101 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
102 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
103 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
104 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
105 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
106 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
107 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
110 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
111 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
112 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
113 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
114 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
115 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
116 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
117 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
122 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
123 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
124 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
125 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
126 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
127 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
128 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
129 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
130 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
131 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
132 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.42
Metatranscriptomes 0
Isolates 2.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.01
Nodule 0
Rhizoplane 8.25
Rhizosphere 69.59
Stem 0
Stem Tuber 0
Unclassified 5.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055537_1001348 3300003773 Bacteria 9936
2 Ga0055524_1021342 3300003775 Bacteria 2150
3 Ga0055528_1003391 3300003790 Bacteria 8032
4 Ga0055531_10003059 3300003794 Bacteria 10834
5 Ga0055531_10016872 3300003794 Bacteria 3120
6 Ga0065165_1000345 3300005262 Bacteria 76072
7 Ga0065165_1001741 3300005262 Bacteria 21716
8 Ga0070658_10078048 3300005327 Bacteria 2717
9 Ga0070658_10139856 3300005327 Bacteria 2022
10 Ga0070658_10156490 3300005327 Bacteria 1911
11 Ga0070670_100050368 3300005331 Bacteria 3579
12 Ga0070660_100044754 3300005339 Bacteria 3386
13 Ga0070660_100232436 3300005339 Bacteria 1500
14 Ga0070691_10002545 3300005341 Bacteria 8125
15 Ga0070671_100093954 3300005355 Bacteria 2513
16 Ga0070673_100075892 3300005364 Bacteria 2712
17 Ga0070659_100010444 3300005366 Bacteria 6829
18 Ga0070662_100063994 3300005457 Bacteria 2692
19 Ga0070681_10011022 3300005458 Bacteria 8935
20 Ga0070681_10041217 3300005458 Bacteria 4626
21 Ga0070679_100004932 3300005530 Bacteria 12312
22 Ga0070679_100085248 3300005530 Bacteria 3146
23 Ga0068853_100024809 3300005539 Bacteria 5029
24 Ga0070665_100000246 3300005548 Bacteria 90170
25 Ga0068855_100012972 3300005563 Bacteria 10056
26 Ga0068855_100033269 3300005563 Bacteria 6154
27 Ga0068855_100389583 3300005563 Bacteria 1529
28 Ga0070664_100085033 3300005564 Bacteria 2732
29 Ga0068852_100240832 3300005616 Bacteria 1729
30 Ga0068864_100005824 3300005618 Bacteria 10104
31 Ga0068864_100054186 3300005618 Bacteria 3461
32 Ga0068863_100380246 3300005841 Bacteria 1378
33 Ga0068858_100930259 3300005842 Bacteria 851
34 Ga0068860_100000027 3300005843 Bacteria 267207
35 Ga0070717_10355737 3300006028 Bacteria 1310
36 Ga0068865_100005457 3300006881 Bacteria 7716
37 Ga0105240_10002602 3300009093 Bacteria 28871
38 Ga0105240_10028500 3300009093 Bacteria 7293
39 Ga0105240_10108617 3300009093 Bacteria 3361
40 Ga0105242_10052365 3300009176 Bacteria 3330
41 Ga0105248_10000112 3300009177 Bacteria 91321
42 Ga0105248_10080823 3300009177 Bacteria 3654
43 Ga0105238_10020059 3300009551 Bacteria 6805
44 Ga0105238_10061613 3300009551 Bacteria 3754
45 Ga0105238_10075235 3300009551 Bacteria 3369
46 Ga0105238_10311512 3300009551 Bacteria 1559
47 Ga0105239_10261030 3300010375 Bacteria 1947
48 Ga0105239_10860007 3300010375 Bacteria 1040
49 Ga0163163_10073353 3300014325 Bacteria 3413
50 Ga0163163_10554113 3300014325 Bacteria 1212
51 Ga0182007_10027730 3300015262 Bacteria 1950
52 Ga0209565_1000192 3300025263 Bacteria 74812
53 Ga0209565_1000416 3300025263 Bacteria 35062
54 Ga0209673_1002928 3300025273 Bacteria 10742
55 Ga0209673_1026012 3300025273 Bacteria 1933
56 Ga0209675_1005887 3300025291 Bacteria 5031
57 Ga0209564_1002796 3300025295 Bacteria 13026
58 Ga0209758_1000404 3300025297 Bacteria 74016
59 Ga0209758_1000917 3300025297 Bacteria 39944
60 Ga0209050_1001947 3300025298 Bacteria 19566
61 Ga0209256_1000810 3300025299 Bacteria 40058
62 Ga0209256_1002347 3300025299 Bacteria 15761
63 Ga0209257_1000227 3300025304 Bacteria 133512
64 Ga0209257_1000507 3300025304 Bacteria 68362
65 Ga0207705_10002827 3300025909 Bacteria 13280
66 Ga0207707_10172594 3300025912 Bacteria 1889
67 Ga0207707_10196501 3300025912 Bacteria 1759
68 Ga0207695_10001434 3300025913 Bacteria 40063
69 Ga0207695_10002208 3300025913 Bacteria 29280
70 Ga0207695_10018032 3300025913 Bacteria 8173
71 Ga0207695_10212350 3300025913 Bacteria 1845
72 Ga0207660_10040266 3300025917 Bacteria 3271
73 Ga0207657_10004268 3300025919 Bacteria 15143
74 Ga0207657_10037922 3300025919 Bacteria 4298
75 Ga0207652_10010326 3300025921 Bacteria 7520
76 Ga0207652_10231703 3300025921 Bacteria 1664
77 Ga0207694_10080295 3300025924 Bacteria 2560
78 Ga0207694_10114313 3300025924 Bacteria 2150
79 Ga0207687_10421181 3300025927 Bacteria 1102
80 Ga0207644_10178607 3300025931 Bacteria 1662
81 Ga0207644_10208207 3300025931 Bacteria 1545
82 Ga0207690_10000230 3300025932 Bacteria 41628
83 Ga0207690_10024990 3300025932 Bacteria 3746
84 Ga0207686_10027356 3300025934 Bacteria 3339
85 Ga0207704_10000424 3300025938 Bacteria 18950
86 Ga0207711_10000718 3300025941 Bacteria 32642
87 Ga0207711_10288421 3300025941 Bacteria 1512
88 Ga0207711_10369780 3300025941 Bacteria 1329
89 Ga0207667_10128907 3300025949 Bacteria 2605
90 Ga0207667_10317774 3300025949 Bacteria 1590
91 Ga0207651_10099681 3300025960 Bacteria 2152
92 Ga0207640_10070422 3300025981 Bacteria 2352
93 Ga0207678_10413510 3300026067 Bacteria 1169
94 Ga0207641_10307539 3300026088 Bacteria 1499
95 Ga0207676_10067378 3300026095 Bacteria 2859
96 Ga0207698_10208317 3300026142 Bacteria 1757
97 Ga0209981_1007082 3300027378 Bacteria 1508
98 Ga0268266_10000003 3300028379 Bacteria 1701703
99 Ga0268265_10010118 3300028380 Bacteria 6368
100 Ga0268264_10000181 3300028381 Bacteria 134092
101 Ga0307517_10006025 3300028786 Bacteria 18059
102 Ga0307517_10173083 3300028786 Bacteria 1414
103 Ga0307515_10048434 3300028794 Bacteria 6425
104 Ga0265331_10264320 3300031250 Bacteria 771
105 Ga0265327_10001088 3300031251 Bacteria 37825
106 Ga0265327_10046892 3300031251 Bacteria 2283
107 Ga0307513_10005316 3300031456 Bacteria 17027
108 Ga0307513_10007002 3300031456 Bacteria 14669
109 Ga0307513_10127980 3300031456 Bacteria 2490
110 Ga0307516_10000006 3300031730 Bacteria 298586
111 Ga0373946_0006963 3300035171 Bacteria 4120
112 Ga0373927_0000257 3300035695 Bacteria 41787
113 Ga0373925_0000083 3300037068 Bacteria 101171
114 Ga0395899_0002440 3300037312 Bacteria 15116
115 Ga0395900_0011388 3300037418 Bacteria 9102
116 Ga0395900_0119047 3300037418 Bacteria 2710
117 Ga0395898_0003119 3300037466 Bacteria 18715
118 Ga0395898_0102937 3300037466 Bacteria 2740
119 Ga0395905_0003431 3300037471 Bacteria 16959
120 Ga0395905_0072434 3300037471 Bacteria 3230
121 Ga0395905_0081214 3300037471 Bacteria 3038
122 Ga0395905_0197684 3300037471 Bacteria 1885
123 Ga0395901_0000008 3300038443 Bacteria 495962
124 Ga0395901_0022971 3300038443 Bacteria 6393
125 Ga0395901_0141315 3300038443 Bacteria 2530
126 Ga0495638_0000639 3300046460 Bacteria 38450
127 Ga0495638_0009017 3300046460 Bacteria 7033
128 Ga0495584_0388973 3300046491 Bacteria 709
129 Ga0495583_0000003 3300046506 Bacteria 709273
130 Ga0495606_0056359 3300046507 Bacteria 2537
131 Ga0495616_0000016 3300046513 Bacteria 182686
132 Ga0495632_0001248 3300046519 Bacteria 21576
133 Ga0495643_0044628 3300046522 Bacteria 2408
134 Ga0495642_0064540 3300046528 Bacteria 1523
135 Ga0495654_0000777 3300046530 Bacteria 24638
136 Ga0495645_0040922 3300046543 Bacteria 3379
137 Ga0495633_0026174 3300046558 Bacteria 2865
138 Ga0495668_0014468 3300046616 Bacteria 4625
139 Ga0495668_0064068 3300046616 Bacteria 2024
140 Ga0495668_0206313 3300046616 Bacteria 1076
141 Ga0495625_0000152 3300046660 Bacteria 105589
142 Ga0495625_0006767 3300046660 Bacteria 10144
143 Ga0495659_0011674 3300046664 Bacteria 2832
144 Ga0495669_0000081 3300046684 Bacteria 63806
145 Ga0495670_0130639 3300046691 Bacteria 1309
146 Ga0495660_0010171 3300046810 Bacteria 5472
147 Ga0495672_0006996 3300047320 Bacteria 8573
148 Ga0495673_0000312 3300047469 Bacteria 63724
149 Ga0495673_0002154 3300047469 Bacteria 14295
150 Ga0495681_0023752 3300047470 Bacteria 3248
151 Ga0495686_0006390 3300047472 Bacteria 9035
152 Ga0495686_0130187 3300047472 Bacteria 1492
153 Ga0496100_0074056 3300048903 Bacteria 2281
154 Ga0496101_0172138 3300048904 Bacteria 1665
155 Ga0496102_0014891 3300048905 Bacteria 6766
156 Ga0496103_0047603 3300048906 Bacteria 2650
157 Ga0496106_0017948 3300048909 Bacteria 5233
158 Ga0496106_0115904 3300048909 Bacteria 2089
159 Ga0496107_0002848 3300048910 Bacteria 11433
160 Ga0496107_0014351 3300048910 Bacteria 5547
161 Ga0496108_0025436 3300048911 Bacteria 4879
162 Ga0496109_0726878 3300048912 Bacteria 931
163 Ga0496112_0012399 3300048915 Bacteria 7835
164 Ga0496112_0082744 3300048915 Bacteria 3174
165 Ga0496112_0230533 3300048915 Bacteria 1806
166 Ga0496115_0000050 3300048918 Bacteria 109402
167 Ga0496115_0001829 3300048918 Bacteria 15223
168 Ga0496115_0012114 3300048918 Bacteria 6483
169 Ga0496121_0004173 3300048924 Bacteria 19753
170 Ga0495678_039349 3300049459 Bacteria 1908
171 Ga0501047_0190905 3300049581 Bacteria 1912
172 Ga0501047_0584171 3300049581 Bacteria 940
173 Ga0501048_0466073 3300049582 Bacteria 905
174 Ga0501035_0054979 3300049822 Bacteria 3555
175 Ga0501035_0331444 3300049822 Bacteria 1277
176 Ga0495601_0565160 3300053077 Bacteria 731
177 Ga0500643_019108 3300053087 Bacteria 2262
178 Ga0500643_023383 3300053087 Bacteria 1975
179 Ga0500641_0018344 3300053096 Bacteria 2631
180 Ga0500555_028408 3300053103 Bacteria 1593
181 Ga0500562_000626 3300053108 Bacteria 8522
182 Ga0500595_016096 3300053119 Bacteria 2792
183 Ga0500559_0014925 3300053136 Bacteria 3283
184 Ga0500577_0005963 3300053142 Bacteria 3324
185 Ga0500616_0025796 3300053153 Bacteria 3259
186 Ga0500627_0018864 3300053158 Bacteria 2738
187 Ga0500645_003388 3300053730 Bacteria 6509
188 Ga0500645_003616 3300053730 Bacteria 6190
189 Ga0500609_000090 3300053731 Bacteria 11756

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0002440 Ga0395899_0002440_14487_15086 183
2 3300006028 Ga0070717_10355737 Ga0070717_103557372 205
3 3300010375 Ga0105239_10261030 Ga0105239_102610302 210
4 3300025932 Ga0207690_10000230 Ga0207690_1000023010 210
5 3300046491 Ga0495584_0388973 Ga0495584_0388973_39_674 210
6 3300037418 Ga0395900_0119047 Ga0395900_0119047_449_1138 213
7 3300037466 Ga0395898_0003119 Ga0395898_0003119_435_1124 213
8 3300037471 Ga0395905_0003431 Ga0395905_0003431_13729_14418 213
9 3300038443 Ga0395901_0000008 Ga0395901_0000008_494825_495514 213
10 3300053119 Ga0500595_016096 Ga0500595_016096_1722_2402 214
11 3300009093 Ga0105240_10108617 Ga0105240_101086173 215
12 3300025913 Ga0207695_10212350 Ga0207695_102123503 215
13 3300009551 Ga0105238_10061613 Ga0105238_100616133 218
14 3300025924 Ga0207694_10114313 Ga0207694_101143133 218
15 3300005563 Ga0068855_100033269 Ga0068855_1000332693 220
16 3300025949 Ga0207667_10128907 Ga0207667_101289073 220
17 iso_pu_bacteria 2510917020 2511122224 220
18 iso_pu_bacteria 2582581280 2585151318 221
19 iso_pu_bacteria 2582581293 2585197187 221
20 iso_pu_bacteria 2643221552 2643781146 221
21 iso_pu_bacteria 2643221584 2643930480 221
22 3300006881 Ga0068865_100005457 Ga0068865_1000054572 224
23 3300009177 Ga0105248_10000112 Ga0105248_100001125 224
24 3300014325 Ga0163163_10554113 Ga0163163_105541132 224
25 3300025931 Ga0207644_10208207 Ga0207644_102082072 224
26 3300025938 Ga0207704_10000424 Ga0207704_1000042414 224
27 3300025941 Ga0207711_10000718 Ga0207711_1000071834 224
28 3300025941 Ga0207711_10288421 Ga0207711_102884211 224
29 3300028786 Ga0307517_10006025 Ga0307517_1000602515 224
30 3300028786 Ga0307517_10173083 Ga0307517_101730832 224
31 3300031456 Ga0307513_10005316 Ga0307513_1000531611 224
32 3300031456 Ga0307513_10007002 Ga0307513_100070029 224
33 3300031456 Ga0307513_10127980 Ga0307513_101279803 224
34 3300046543 Ga0495645_0040922 Ga0495645_0040922_1469_2146 224
35 3300046684 Ga0495669_0000081 Ga0495669_0000081_18079_18759 224
36 3300047469 Ga0495673_0000312 Ga0495673_0000312_38958_39644 224
37 3300048915 Ga0496112_0012399 Ga0496112_0012399_538_1215 224
38 3300049581 Ga0501047_0190905 Ga0501047_0190905_88_768 224
39 3300049822 Ga0501035_0054979 Ga0501035_0054979_2420_3100 224
40 3300053077 Ga0495601_0565160 Ga0495601_0565160_40_717 224
41 3300053142 Ga0500577_0005963 Ga0500577_0005963_1826_2512 224
42 3300003773 Ga0055537_1001348 Ga0055537_10013486 225
43 3300003775 Ga0055524_1021342 Ga0055524_10213422 225
44 3300003790 Ga0055528_1003391 Ga0055528_10033916 225
45 3300003794 Ga0055531_10003059 Ga0055531_100030599 225
46 3300003794 Ga0055531_10016872 Ga0055531_100168724 225
47 3300005262 Ga0065165_1000345 Ga0065165_100034569 225
48 3300005262 Ga0065165_1001741 Ga0065165_10017413 225
49 3300005327 Ga0070658_10078048 Ga0070658_100780483 225
50 3300005327 Ga0070658_10139856 Ga0070658_101398563 225
51 3300005327 Ga0070658_10156490 Ga0070658_101564901 225
52 3300005331 Ga0070670_100050368 Ga0070670_1000503685 225
53 3300005339 Ga0070660_100044754 Ga0070660_1000447542 225
54 3300005339 Ga0070660_100232436 Ga0070660_1002324362 225
55 3300005341 Ga0070691_10002545 Ga0070691_100025454 225
56 3300005355 Ga0070671_100093954 Ga0070671_1000939543 225
57 3300005364 Ga0070673_100075892 Ga0070673_1000758922 225
58 3300005366 Ga0070659_100010444 Ga0070659_1000104444 225
59 3300005457 Ga0070662_100063994 Ga0070662_1000639942 225
60 3300005458 Ga0070681_10011022 Ga0070681_1001102210 225
61 3300005458 Ga0070681_10041217 Ga0070681_100412175 225
62 3300005530 Ga0070679_100004932 Ga0070679_10000493210 225
63 3300005530 Ga0070679_100085248 Ga0070679_1000852483 225
64 3300005539 Ga0068853_100024809 Ga0068853_1000248095 225
65 3300005548 Ga0070665_100000246 Ga0070665_10000024630 225
66 3300005563 Ga0068855_100012972 Ga0068855_10001297215 225
67 3300005563 Ga0068855_100389583 Ga0068855_1003895832 225
68 3300005564 Ga0070664_100085033 Ga0070664_1000850333 225
69 3300005616 Ga0068852_100240832 Ga0068852_1002408322 225
70 3300005618 Ga0068864_100005824 Ga0068864_1000058245 225
71 3300005618 Ga0068864_100054186 Ga0068864_1000541863 225
72 3300005841 Ga0068863_100380246 Ga0068863_1003802462 225
73 3300005842 Ga0068858_100930259 Ga0068858_1009302591 225
74 3300005843 Ga0068860_100000027 Ga0068860_100000027121 225
75 3300009093 Ga0105240_10002602 Ga0105240_1000260218 225
76 3300009093 Ga0105240_10028500 Ga0105240_100285004 225
77 3300009176 Ga0105242_10052365 Ga0105242_100523652 225
78 3300009177 Ga0105248_10080823 Ga0105248_100808235 225
79 3300009551 Ga0105238_10020059 Ga0105238_100200594 225
80 3300009551 Ga0105238_10075235 Ga0105238_100752354 225
81 3300009551 Ga0105238_10311512 Ga0105238_103115122 225
82 3300010375 Ga0105239_10860007 Ga0105239_108600071 225
83 3300014325 Ga0163163_10073353 Ga0163163_100733532 225
84 3300015262 Ga0182007_10027730 Ga0182007_100277302 225
85 3300025263 Ga0209565_1000192 Ga0209565_100019230 225
86 3300025263 Ga0209565_1000416 Ga0209565_10004164 225
87 3300025273 Ga0209673_1002928 Ga0209673_10029288 225
88 3300025273 Ga0209673_1026012 Ga0209673_10260122 225
89 3300025291 Ga0209675_1005887 Ga0209675_10058873 225
90 3300025295 Ga0209564_1002796 Ga0209564_10027968 225
91 3300025297 Ga0209758_1000404 Ga0209758_100040436 225
92 3300025297 Ga0209758_1000917 Ga0209758_100091738 225
93 3300025298 Ga0209050_1001947 Ga0209050_10019476 225
94 3300025299 Ga0209256_1000810 Ga0209256_100081033 225
95 3300025299 Ga0209256_1002347 Ga0209256_10023474 225
96 3300025304 Ga0209257_1000227 Ga0209257_100022755 225
97 3300025304 Ga0209257_1000507 Ga0209257_100050717 225
98 3300025909 Ga0207705_10002827 Ga0207705_100028278 225
99 3300025912 Ga0207707_10172594 Ga0207707_101725943 225
100 3300025912 Ga0207707_10196501 Ga0207707_101965012 225
101 3300025913 Ga0207695_10001434 Ga0207695_1000143428 225
102 3300025913 Ga0207695_10002208 Ga0207695_1000220814 225
103 3300025913 Ga0207695_10018032 Ga0207695_100180329 225
104 3300025917 Ga0207660_10040266 Ga0207660_100402664 225
105 3300025919 Ga0207657_10004268 Ga0207657_1000426811 225
106 3300025919 Ga0207657_10037922 Ga0207657_100379223 225
107 3300025921 Ga0207652_10010326 Ga0207652_100103262 225
108 3300025921 Ga0207652_10231703 Ga0207652_102317032 225
109 3300025924 Ga0207694_10080295 Ga0207694_100802952 225
110 3300025927 Ga0207687_10421181 Ga0207687_104211812 225
111 3300025931 Ga0207644_10178607 Ga0207644_101786072 225
112 3300025932 Ga0207690_10024990 Ga0207690_100249902 225
113 3300025934 Ga0207686_10027356 Ga0207686_100273564 225
114 3300025941 Ga0207711_10369780 Ga0207711_103697802 225
115 3300025949 Ga0207667_10317774 Ga0207667_103177742 225
116 3300025960 Ga0207651_10099681 Ga0207651_100996813 225
117 3300025981 Ga0207640_10070422 Ga0207640_100704222 225
118 3300026067 Ga0207678_10413510 Ga0207678_104135102 225
119 3300026088 Ga0207641_10307539 Ga0207641_103075392 225
120 3300026095 Ga0207676_10067378 Ga0207676_100673782 225
121 3300026142 Ga0207698_10208317 Ga0207698_102083173 225
122 3300027378 Ga0209981_1007082 Ga0209981_10070822 225
123 3300028379 Ga0268266_10000003 Ga0268266_10000003974 225
124 3300028380 Ga0268265_10010118 Ga0268265_100101184 225
125 3300028381 Ga0268264_10000181 Ga0268264_100001814 225
126 3300028794 Ga0307515_10048434 Ga0307515_100484342 225
127 3300031250 Ga0265331_10264320 Ga0265331_102643201 225
128 3300031251 Ga0265327_10001088 Ga0265327_1000108827 225
129 3300031251 Ga0265327_10046892 Ga0265327_100468922 225
130 3300031730 Ga0307516_10000006 Ga0307516_10000006201 225
131 3300035171 Ga0373946_0006963 Ga0373946_0006963_1008_1688 225
132 3300035695 Ga0373927_0000257 Ga0373927_0000257_30356_31036 225
133 3300037068 Ga0373925_0000083 Ga0373925_0000083_38920_39600 225
134 3300037418 Ga0395900_0011388 Ga0395900_0011388_6910_7590 225
135 3300037466 Ga0395898_0102937 Ga0395898_0102937_1944_2633 225
136 3300037471 Ga0395905_0072434 Ga0395905_0072434_234_914 225
137 3300037471 Ga0395905_0081214 Ga0395905_0081214_1707_2387 225
138 3300037471 Ga0395905_0197684 Ga0395905_0197684_296_976 225
139 3300038443 Ga0395901_0022971 Ga0395901_0022971_4570_5250 225
140 3300038443 Ga0395901_0141315 Ga0395901_0141315_535_1215 225
141 3300046460 Ga0495638_0000639 Ga0495638_0000639_36009_36686 225
142 3300046460 Ga0495638_0009017 Ga0495638_0009017_3760_4437 225
143 3300046506 Ga0495583_0000003 Ga0495583_0000003_399500_400177 225
144 3300046507 Ga0495606_0056359 Ga0495606_0056359_21_698 225
145 3300046513 Ga0495616_0000016 Ga0495616_0000016_165460_166137 225
146 3300046519 Ga0495632_0001248 Ga0495632_0001248_7925_8602 225
147 3300046522 Ga0495643_0044628 Ga0495643_0044628_649_1326 225
148 3300046528 Ga0495642_0064540 Ga0495642_0064540_70_750 225
149 3300046530 Ga0495654_0000777 Ga0495654_0000777_7743_8420 225
150 3300046558 Ga0495633_0026174 Ga0495633_0026174_284_961 225
151 3300046616 Ga0495668_0014468 Ga0495668_0014468_2112_2789 225
152 3300046616 Ga0495668_0064068 Ga0495668_0064068_1204_1881 225
153 3300046616 Ga0495668_0206313 Ga0495668_0206313_306_983 225
154 3300046660 Ga0495625_0000152 Ga0495625_0000152_49577_50254 225
155 3300046660 Ga0495625_0006767 Ga0495625_0006767_12_689 225
156 3300046664 Ga0495659_0011674 Ga0495659_0011674_1965_2681 225
157 3300046691 Ga0495670_0130639 Ga0495670_0130639_465_1181 225
158 3300046810 Ga0495660_0010171 Ga0495660_0010171_719_1396 225
159 3300047320 Ga0495672_0006996 Ga0495672_0006996_4415_5095 225
160 3300047469 Ga0495673_0002154 Ga0495673_0002154_5971_6648 225
161 3300047470 Ga0495681_0023752 Ga0495681_0023752_2239_2916 225
162 3300047472 Ga0495686_0006390 Ga0495686_0006390_1066_1746 225
163 3300047472 Ga0495686_0130187 Ga0495686_0130187_775_1452 225
164 3300048903 Ga0496100_0074056 Ga0496100_0074056_1411_2127 225
165 3300048904 Ga0496101_0172138 Ga0496101_0172138_107_784 225
166 3300048905 Ga0496102_0014891 Ga0496102_0014891_4216_4896 225
167 3300048906 Ga0496103_0047603 Ga0496103_0047603_149_829 225
168 3300048909 Ga0496106_0017948 Ga0496106_0017948_1256_1933 225
169 3300048909 Ga0496106_0115904 Ga0496106_0115904_20_760 225
170 3300048910 Ga0496107_0002848 Ga0496107_0002848_602_1279 225
171 3300048910 Ga0496107_0014351 Ga0496107_0014351_2357_3073 225
172 3300048911 Ga0496108_0025436 Ga0496108_0025436_2695_3375 225
173 3300048912 Ga0496109_0726878 Ga0496109_0726878_147_863 225
174 3300048915 Ga0496112_0082744 Ga0496112_0082744_261_941 225
175 3300048915 Ga0496112_0230533 Ga0496112_0230533_68_748 225
176 3300048918 Ga0496115_0000050 Ga0496115_0000050_118_798 225
177 3300048918 Ga0496115_0001829 Ga0496115_0001829_1969_2649 225
178 3300048918 Ga0496115_0012114 Ga0496115_0012114_2234_2911 225
179 3300048924 Ga0496121_0004173 Ga0496121_0004173_11055_11732 225
180 3300049459 Ga0495678_039349 Ga0495678_039349_584_1261 225
181 3300049581 Ga0501047_0584171 Ga0501047_0584171_61_741 225
182 3300049582 Ga0501048_0466073 Ga0501048_0466073_26_727 225
183 3300049822 Ga0501035_0331444 Ga0501035_0331444_133_813 225
184 3300053087 Ga0500643_019108 Ga0500643_019108_916_1596 225
185 3300053087 Ga0500643_023383 Ga0500643_023383_1182_1859 225
186 3300053096 Ga0500641_0018344 Ga0500641_0018344_776_1456 225
187 3300053103 Ga0500555_028408 Ga0500555_028408_565_1242 225
188 3300053108 Ga0500562_000626 Ga0500562_000626_3324_4004 225
189 3300053136 Ga0500559_0014925 Ga0500559_0014925_1627_2304 225
190 3300053153 Ga0500616_0025796 Ga0500616_0025796_1393_2070 225
191 3300053158 Ga0500627_0018864 Ga0500627_0018864_1949_2626 225
192 3300053730 Ga0500645_003388 Ga0500645_003388_3889_4569 225
193 3300053730 Ga0500645_003616 Ga0500645_003616_3397_4074 225
194 3300053731 Ga0500609_000090 Ga0500609_000090_7805_8482 225

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

27

227

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4maq-assembly1.cif.gz_B crystal structure of a putative fumarylpyruvate hydrolase from burkholderia cenocepacia 0.9468 1 224
4maq-assembly1.cif.gz_A crystal structure of a putative fumarylpyruvate hydrolase from burkholderia cenocepacia 0.9428 2 224
6j5y-assembly1.cif.gz_A crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate 0.9411 3 225
6sbj-assembly2.cif.gz_C x-ray structure of mus musculus fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) apo-form uuncomplexed 0.9395 25 224
6sbi-assembly2.cif.gz_C x-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate 0.9314 25 224
ID Description Score Start End Superfamily
4maqA00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9428 2 224 3.90.850.10
af_Q9VDE2_1_220_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9387 25 224 3.90.850.10
af_Q4D6U8_2_270_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9324 1 225 3.90.850.10
af_Q4D6U8_2_270_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9284 1 225 3.90.850.10
af_P34673_5_211_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9239 25 222 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A7V7X9R7-F1-model_v4 deleted 0.9702 74 225
AF-F8XN92-F1-model_v4 deleted 0.968 71 225
AF-A0A226WXR6-F1-model_v4 Fumarylacetoacetate hydrolase family protein 0.9671 82 224 GO:0018773
GO:0046872
AF-A0A1S2HSE9-F1-model_v4 deleted 0.9665 77 225
AF-A0A3C1VT53-F1-model_v4 Fumarylacetoacetate hydrolase 0.9662 66 225 GO:0018773
GO:0046872

Feature Viewer

pLDDT pTM Quality
91.43 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map