F298401

General Info

Members Datasets Scaffolds Average Seq Length
194 152 388 192

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100277005|Ga0068856_1002770052
Length 196
Sequence MKPLTLTPALIPALLAFGLAQAAPATYQIDPTHTYPSFEADHMGISVWRGKLNKNTGSIVYDKASGTGTVEVQMDLASIDFGLEALNAWARGDQFFDVAKHPTASYKGRFDGVSGGSGGVPARLVGELTLNGQTRPVTLAIHQLKCIQHPIYKRELCGADASGSFNRDEFGLSAGKDYGFKMDVQLRIQIEAIAKE

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
50 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
54 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
55 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
56 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
58 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
91 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
92 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
97 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
98 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
99 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
100 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
101 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
102 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
103 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
104 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
105 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
106 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
107 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
108 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
109 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
110 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
111 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
112 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
113 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
114 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
117 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
118 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
119 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
122 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
123 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
124 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
125 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
126 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
127 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
128 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
129 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
130 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
131 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
132 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
133 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
134 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
135 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
136 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
137 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
138 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
139 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
140 2643221559 Lysobacter sp. Root559 Isolate Unclassified
141 2643221573 Lysobacter sp. Root604 Isolate Unclassified
142 2643221585 Pelomonas sp. Root662 Isolate Unclassified
143 2643221586 Lysobacter sp. Root667 Isolate Unclassified
144 2643221593 Lysobacter sp. Root690 Isolate Unclassified
145 2643221612 Lysobacter sp. Root76 Isolate Unclassified
146 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
147 2643221656 Pelomonas sp. Root405 Isolate Unclassified
148 2643221720 Lysobacter sp. Root916 Isolate Unclassified
149 2643221727 Lysobacter sp. Root96 Isolate Unclassified
150 2643221728 Lysobacter sp. Root983 Isolate Unclassified
151 2738541337 Pelomonas sp. BT06 Isolate Unclassified
152 2831864461 Roseateles noduli HZ7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.27
Metatranscriptomes 0.52
Isolates 7.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.95
Nodule 1.03
Rhizoplane 4.64
Rhizosphere 59.79
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100277005 3300005614 Bacteria 1694
2 JGI25154J39366_1001872 3300002738 Bacteria 6404
3 JGI25157J39369_1000179 3300002741 Bacteria 53655
4 JGI25151J46595_10000214 3300003187 Bacteria 69921
5 rootH1_10006088 3300003316 Bacteria 4578
6 rootH2_10002984 3300003320 Bacteria 28558
7 rootL2_10031788 3300003322 Bacteria 2363
8 rootH1_10000585 3300003323 Bacteria 10279
9 rootH1_10035381 3300003323 Bacteria 3773
10 Ga0055539_1000370 3300003752 Bacteria 18924
11 Ga0055539_1001238 3300003752 Bacteria 5130
12 Ga0055533_1000102 3300003756 Bacteria 108801
13 Ga0055525_1000161 3300003759 Bacteria 87478
14 Ga0055525_1001771 3300003759 Bacteria 3037
15 Ga0055524_1006960 3300003775 Bacteria 4861
16 Ga0055530_10043625 3300003791 Bacteria 1080
17 Ga0055531_10000044 3300003794 Bacteria 133446
18 Ga0055531_10005511 3300003794 Bacteria 7397
19 Ga0070658_10054776 3300005327 Bacteria 3238
20 Ga0070658_10104502 3300005327 Bacteria 2343
21 Ga0070682_100109258 3300005337 Bacteria 1840
22 Ga0070660_100046578 3300005339 Bacteria 3324
23 Ga0070660_100790978 3300005339 Bacteria 797
24 Ga0070675_100989598 3300005354 Bacteria 772
25 Ga0070673_100027858 3300005364 Bacteria 4194
26 Ga0070679_100177391 3300005530 Bacteria 2103
27 Ga0070684_100103790 3300005535 Bacteria 2543
28 Ga0068853_100072581 3300005539 Bacteria 2999
29 Ga0068853_100121362 3300005539 Bacteria 2332
30 Ga0070672_100390131 3300005543 Bacteria 1192
31 Ga0070665_100186753 3300005548 Bacteria 2073
32 Ga0068855_100132824 3300005563 Bacteria 2841
33 Ga0068855_100238553 3300005563 Bacteria 2032
34 Ga0068855_100468421 3300005563 Bacteria 1373
35 Ga0068857_100003388 3300005577 Bacteria 13272
36 Ga0068857_100147546 3300005577 Bacteria 2129
37 Ga0068854_100000830 3300005578 Bacteria 18458
38 Ga0068854_100025659 3300005578 Bacteria 4044
39 Ga0068856_100003595 3300005614 Bacteria 15600
40 Ga0068866_10054440 3300005718 Bacteria 2050
41 Ga0068861_100161511 3300005719 Bacteria 1849
42 Ga0068860_100403755 3300005843 Bacteria 1352
43 Ga0075366_10021958 3300006195 Bacteria 3711
44 Ga0075370_10445613 3300006353 Bacteria 779
45 Ga0099826_10262139 3300006948 Bacteria 904
46 Ga0105240_10035913 3300009093 Bacteria 6382
47 Ga0105240_10091130 3300009093 Bacteria 3725
48 Ga0105245_10234213 3300009098 Bacteria 1777
49 Ga0105241_10111088 3300009174 Bacteria 2194
50 Ga0105242_10082262 3300009176 Bacteria 2694
51 Ga0105238_10613033 3300009551 Bacteria 1097
52 Ga0105239_10016710 3300010375 Bacteria 8111
53 Ga0105246_10088474 3300011119 Bacteria 2225
54 Ga0157328_1001649 3300012478 Bacteria 983
55 Ga0157371_10186178 3300013102 Bacteria 1486
56 Ga0157369_10030122 3300013105 Bacteria 5987
57 Ga0157369_10120584 3300013105 Bacteria 2783
58 Ga0157372_10249451 3300013307 Bacteria 2060
59 Ga0157379_10591401 3300014968 Bacteria 1035
60 Ga0182007_10108191 3300015262 Bacteria 924
61 Ga0163161_10011579 3300017792 Bacteria 6122
62 Ga0206354_10609343 3300020081 Bacteria 667
63 Ga0213872_10182831 3300021361 Bacteria 905
64 Ga0209674_100015 3300025226 Bacteria 697299
65 Ga0209563_100017 3300025230 Bacteria 796449
66 Ga0209563_100088 3300025230 Bacteria 175375
67 Ga0209258_100557 3300025242 Bacteria 32937
68 Ga0209258_105502 3300025242 Bacteria 2130
69 Ga0207425_1000732 3300025245 Bacteria 17322
70 Ga0209646_1000112 3300025246 Bacteria 153075
71 Ga0209026_1000038 3300025250 Bacteria 281227
72 Ga0209677_100022 3300025253 Bacteria 410724
73 Ga0209677_100074 3300025253 Bacteria 133019
74 Ga0209759_1000031 3300025256 Bacteria 281227
75 Ga0209759_1012006 3300025256 Bacteria 2424
76 Ga0209025_1000005 3300025294 Bacteria 1272149
77 Ga0209050_1020694 3300025298 Bacteria 2435
78 Ga0209256_1031488 3300025299 Bacteria 1450
79 Ga0209051_1028957 3300025303 Bacteria 2177
80 Ga0209257_1000094 3300025304 Bacteria 262243
81 Ga0209257_1000170 3300025304 Bacteria 169384
82 Ga0207705_10114297 3300025909 Bacteria 1997
83 Ga0207705_10120588 3300025909 Bacteria 1946
84 Ga0207705_10408593 3300025909 Bacteria 1050
85 Ga0207695_10008182 3300025913 Bacteria 13137
86 Ga0207695_10066983 3300025913 Bacteria 3685
87 Ga0207657_10041352 3300025919 Bacteria 4076
88 Ga0207657_10050928 3300025919 Bacteria 3601
89 Ga0207681_10980196 3300025923 Bacteria 709
90 Ga0207694_10673177 3300025924 Bacteria 872
91 Ga0207659_10692446 3300025926 Bacteria 872
92 Ga0207644_10636967 3300025931 Bacteria 887
93 Ga0207690_10473980 3300025932 Bacteria 1009
94 Ga0207706_10001797 3300025933 Bacteria 21093
95 Ga0207686_10752265 3300025934 Bacteria 778
96 Ga0207667_10000142 3300025949 Bacteria 109610
97 Ga0207667_10036170 3300025949 Bacteria 5294
98 Ga0207667_10680109 3300025949 Bacteria 1033
99 Ga0207640_10000014 3300025981 Bacteria 219683
100 Ga0207640_10000016 3300025981 Bacteria 208390
101 Ga0207640_10000018 3300025981 Bacteria 193664
102 Ga0207640_10018508 3300025981 Bacteria 4095
103 Ga0207702_10007134 3300026078 Bacteria 9561
104 Ga0207702_11142043 3300026078 Bacteria 773
105 Ga0207674_10015753 3300026116 Bacteria 8293
106 Ga0207675_100040067 3300026118 Bacteria 4372
107 Ga0207698_10015527 3300026142 Bacteria 5102
108 Ga0207698_10216747 3300026142 Bacteria 1726
109 Ga0209999_1051924 3300027543 Bacteria 775
110 Ga0209982_1002071 3300027552 Bacteria 2782
111 Ga0209983_1020090 3300027665 Bacteria 1391
112 Ga0209971_1027368 3300027682 Bacteria 1364
113 Ga0209974_10003127 3300027876 Bacteria 5993
114 Ga0209974_10022511 3300027876 Bacteria 2088
115 Ga0268266_10140686 3300028379 Bacteria 2166
116 Ga0268264_10318826 3300028381 Bacteria 1469
117 Ga0268264_10774438 3300028381 Bacteria 957
118 Ga0307515_10028078 3300028794 Bacteria 9582
119 Ga0307515_10056660 3300028794 Bacteria 5690
120 Ga0307513_10016581 3300031456 Bacteria 8880
121 Ga0307513_10161499 3300031456 Bacteria 2133
122 Ga0307513_10457777 3300031456 Bacteria 999
123 Ga0307509_10638048 3300031507 Bacteria 735
124 Ga0307408_100116401 3300031548 Bacteria 2063
125 Ga0307508_10230507 3300031616 Bacteria 1450
126 Ga0307516_10051346 3300031730 Bacteria 4042
127 Ga0307414_10001476 3300032004 Bacteria 12238
128 Ga0307414_10016425 3300032004 Bacteria 4499
129 Ga0307414_10434093 3300032004 Bacteria 1148
130 Ga0307411_10000032 3300032005 Bacteria 45793
131 Ga0395898_0011307 3300037466 Bacteria 9280
132 Ga0395905_0001617 3300037471 Bacteria 26775
133 Ga0395905_0283444 3300037471 Bacteria 1543
134 Ga0436361_0674447 3300039447 Bacteria 1555
135 Ga0439436_0007704 3300041404 Bacteria 3313
136 Ga0439465_0024010 3300041413 Bacteria 1920
137 Ga0451789_0331586 3300041443 Bacteria 1333
138 Ga0451791_0246334 3300041451 Bacteria 852
139 Ga0451791_0853881 3300041451 Bacteria 1216
140 Ga0451797_0342271 3300041453 Bacteria 1581
141 Ga0451802_1919989 3300041460 Bacteria 2388
142 Ga0451807_1392428 3300041486 Bacteria 2728
143 Ga0451807_1847167 3300041486 Bacteria 2883
144 Ga0451843_0388641 3300041509 Bacteria 1019
145 Ga0451843_0846481 3300041509 Bacteria 1862
146 Ga0439448_0241857 3300042005 Unclassified 636
147 Ga0439449_0035416 3300042007 Bacteria 1858
148 Ga0439462_0008680 3300042015 Bacteria 2566
149 Ga0450890_002145 3300042127 Bacteria 2754
150 Ga0450891_009240 3300042129 Bacteria 906
151 Ga0450892_000197 3300042130 Bacteria 7082
152 Ga0495650_0013041 3300046471 Bacteria 4425
153 Ga0495639_0014033 3300046475 Bacteria 3466
154 Ga0495606_0000560 3300046507 Bacteria 59169
155 Ga0495663_0003791 3300046525 Bacteria 4314
156 Ga0495652_0521927 3300046529 Bacteria 821
157 Ga0495671_0095818 3300046692 Bacteria 1452
158 Ga0495649_0000144 3300046694 Bacteria 62066
159 Ga0495589_0001128 3300046794 Bacteria 15878
160 Ga0495683_0068025 3300047323 Bacteria 1753
161 Ga0496102_0001784 3300048905 Bacteria 18672
162 Ga0496115_0411134 3300048918 Bacteria 1097
163 Ga0496122_0045374 3300048925 Bacteria 3417
164 Ga0496123_0196286 3300048926 Bacteria 1039
165 Ga0496124_0054706 3300048927 Bacteria 3377
166 Ga0496124_0149125 3300048927 Bacteria 1837
167 Ga0501296_020425 3300049519 Bacteria 844
168 Ga0501206_045895 3300049653 Bacteria 684
169 Ga0501211_001356 3300049658 Bacteria 2614
170 Ga0501227_009313 3300049665 Bacteria 2114
171 Ga0501235_001340 3300049669 Bacteria 5217
172 Ga0501236_018531 3300049670 Bacteria 1006
173 Ga0501249_042149 3300049679 Bacteria 1037
174 Ga0501261_038950 3300049690 Bacteria 743
175 Ga0501221_003118 3300049704 Bacteria 2724
176 Ga0501264_012623 3300049761 Bacteria 830
177 Ga0501269_031273 3300049766 Bacteria 684
178 nmdc:mga0k408_102467_c1 3300050493 Bacteria 1688
179 nmdc:mga07m45_78770_c1 3300050496 Bacteria 1098
180 Ga0500635_0000089 3300053080 Bacteria 56345
181 2643742586 2643221544 Bacteria 5886209
182 2643817446 2643221559 Bacteria 4424915
183 2643878643 2643221573 Bacteria 4784121
184 2643936111 2643221585 Bacteria 5812563
185 2643940101 2643221586 Bacteria 4446529
186 2643976616 2643221593 Bacteria 6296053
187 2644079229 2643221612 Bacteria 4361984
188 2644258458 2643221646 Bacteria 6433402
189 2644316756 2643221656 Bacteria 5809961
190 2644659959 2643221720 Bacteria 4694283
191 2644694673 2643221727 Bacteria 4415595
192 2644697262 2643221728 Bacteria 4797149
193 2739056866 2738541337 Bacteria 6183410
194 2831869825 2831864461 Bacteria 6502356
195 Ga0068856_100277005
196 JGI25154J39366_1001872
197 JGI25157J39369_1000179
198 JGI25151J46595_10000214
199 rootH1_10006088
200 rootH2_10002984
201 rootL2_10031788
202 rootH1_10000585
203 rootH1_10035381
204 Ga0055539_1000370
205 Ga0055539_1001238
206 Ga0055533_1000102
207 Ga0055525_1000161
208 Ga0055525_1001771
209 Ga0055524_1006960
210 Ga0055530_10043625
211 Ga0055531_10000044
212 Ga0055531_10005511
213 Ga0070658_10054776
214 Ga0070658_10104502
215 Ga0070682_100109258
216 Ga0070660_100046578
217 Ga0070660_100790978
218 Ga0070675_100989598
219 Ga0070673_100027858
220 Ga0070679_100177391
221 Ga0070684_100103790
222 Ga0068853_100072581
223 Ga0068853_100121362
224 Ga0070672_100390131
225 Ga0070665_100186753
226 Ga0068855_100132824
227 Ga0068855_100238553
228 Ga0068855_100468421
229 Ga0068857_100003388
230 Ga0068857_100147546
231 Ga0068854_100000830
232 Ga0068854_100025659
233 Ga0068856_100003595
234 Ga0068866_10054440
235 Ga0068861_100161511
236 Ga0068860_100403755
237 Ga0075366_10021958
238 Ga0075370_10445613
239 Ga0099826_10262139
240 Ga0105240_10035913
241 Ga0105240_10091130
242 Ga0105245_10234213
243 Ga0105241_10111088
244 Ga0105242_10082262
245 Ga0105238_10613033
246 Ga0105239_10016710
247 Ga0105246_10088474
248 Ga0157328_1001649
249 Ga0157371_10186178
250 Ga0157369_10030122
251 Ga0157369_10120584
252 Ga0157372_10249451
253 Ga0157379_10591401
254 Ga0182007_10108191
255 Ga0163161_10011579
256 Ga0206354_10609343
257 Ga0213872_10182831
258 Ga0209674_100015
259 Ga0209563_100017
260 Ga0209563_100088
261 Ga0209258_100557
262 Ga0209258_105502
263 Ga0207425_1000732
264 Ga0209646_1000112
265 Ga0209026_1000038
266 Ga0209677_100022
267 Ga0209677_100074
268 Ga0209759_1000031
269 Ga0209759_1012006
270 Ga0209025_1000005
271 Ga0209050_1020694
272 Ga0209256_1031488
273 Ga0209051_1028957
274 Ga0209257_1000094
275 Ga0209257_1000170
276 Ga0207705_10114297
277 Ga0207705_10120588
278 Ga0207705_10408593
279 Ga0207695_10008182
280 Ga0207695_10066983
281 Ga0207657_10041352
282 Ga0207657_10050928
283 Ga0207681_10980196
284 Ga0207694_10673177
285 Ga0207659_10692446
286 Ga0207644_10636967
287 Ga0207690_10473980
288 Ga0207706_10001797
289 Ga0207686_10752265
290 Ga0207667_10000142
291 Ga0207667_10036170
292 Ga0207667_10680109
293 Ga0207640_10000014
294 Ga0207640_10000016
295 Ga0207640_10000018
296 Ga0207640_10018508
297 Ga0207702_10007134
298 Ga0207702_11142043
299 Ga0207674_10015753
300 Ga0207675_100040067
301 Ga0207698_10015527
302 Ga0207698_10216747
303 Ga0209999_1051924
304 Ga0209982_1002071
305 Ga0209983_1020090
306 Ga0209971_1027368
307 Ga0209974_10003127
308 Ga0209974_10022511
309 Ga0268266_10140686
310 Ga0268264_10318826
311 Ga0268264_10774438
312 Ga0307515_10028078
313 Ga0307515_10056660
314 Ga0307513_10016581
315 Ga0307513_10161499
316 Ga0307513_10457777
317 Ga0307509_10638048
318 Ga0307408_100116401
319 Ga0307508_10230507
320 Ga0307516_10051346
321 Ga0307414_10001476
322 Ga0307414_10016425
323 Ga0307414_10434093
324 Ga0307411_10000032
325 Ga0395898_0011307
326 Ga0395905_0001617
327 Ga0395905_0283444
328 Ga0436361_0674447
329 Ga0439436_0007704
330 Ga0439465_0024010
331 Ga0451789_0331586
332 Ga0451791_0246334
333 Ga0451791_0853881
334 Ga0451797_0342271
335 Ga0451802_1919989
336 Ga0451807_1392428
337 Ga0451807_1847167
338 Ga0451843_0388641
339 Ga0451843_0846481
340 Ga0439448_0241857
341 Ga0439449_0035416
342 Ga0439462_0008680
343 Ga0450890_002145
344 Ga0450891_009240
345 Ga0450892_000197
346 Ga0495650_0013041
347 Ga0495639_0014033
348 Ga0495606_0000560
349 Ga0495663_0003791
350 Ga0495652_0521927
351 Ga0495671_0095818
352 Ga0495649_0000144
353 Ga0495589_0001128
354 Ga0495683_0068025
355 Ga0496102_0001784
356 Ga0496115_0411134
357 Ga0496122_0045374
358 Ga0496123_0196286
359 Ga0496124_0054706
360 Ga0496124_0149125
361 Ga0501296_020425
362 Ga0501206_045895
363 Ga0501211_001356
364 Ga0501227_009313
365 Ga0501235_001340
366 Ga0501236_018531
367 Ga0501249_042149
368 Ga0501261_038950
369 Ga0501221_003118
370 Ga0501264_012623
371 Ga0501269_031273
372 nmdc:mga0k408_102467_c1
373 nmdc:mga07m45_78770_c1
374 Ga0500635_0000089
375 2643742586
376 2643817446
377 2643878643
378 2643936111
379 2643940101
380 2643976616
381 2644079229
382 2644258458
383 2644316756
384 2644659959
385 2644694673
386 2644697262
387 2739056866
388 2831869825

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04264

YceI

YceI-like domain

27

192

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ixg-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcnb 0.9592 24 190
5ixg-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcnb 0.9481 24 190
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.8667 24 191
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.866 24 191
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.8571 24 191
ID Description Score Start End Superfamily
5ixgA00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9592 24 190 2.40.128.110
5ixgA00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9481 24 190 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8672 24 191 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8585 24 191 2.40.128.110
1wubA00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8567 24 189 2.40.128.110
ID Description Score Start End GO Terms
AF-A0A0Q8MVU0-F1-model_v4 deleted 0.9796 16 191
AF-A0A519G6Z0-F1-model_v4 deleted 0.9783 14 191
AF-A0A845GAP6-F1-model_v4 Polyisoprenoid-binding protein 0.9783 16 191
AF-A0A7X9ZDK6-F1-model_v4 Polyisoprenoid-binding protein 0.977 18 191
AF-A0A0G9H140-F1-model_v4 Polyisoprenoid-binding protein 0.9749 14 191

Map