F298614

General Info

Members Datasets Scaffolds Average Seq Length
194 120 388 387

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10000559|Ga0105248_100005593
Length 404
Sequence MAPRKSNTERLGGPPSTGSEATRLIRAGQAPETLAKTVGPPIQKGSTVLLPNAASLYDDANYLTYGRQGLAAQTALQDALAGLENAAGVTLYPSGVAALSGALLAVLKTGDEILVTDAAYKPTRRFCDHALKRFGVKTTYFDPRTPPETLLGEAAPATRLILMESPGSLSFEMQDMARVAELAKPRDILTVADNTWGAGYLYKPLDHGIDIALQALTKYVGGHSDTFMGSAATADPKLLRALNDGVLHLGWAVSGDDAYQMLRGLRTMPTRLARHGTSGLEVAAWLRDHPMVGEVLHPALPGAAGHDLWKRDYIGASGLFGFVLQPGPQAAVDAFLDELDLFGLGFSWGGFESLAIACDHQLTSRKLLRSYPGPLIRLHIGLEDPADLIADLARGLDVYAARRG

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
27 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
41 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
42 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
72 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
73 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
74 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
75 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
76 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
83 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
84 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
85 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
86 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
87 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
88 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
89 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
90 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
91 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
92 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
93 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
94 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
95 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
98 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
99 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
100 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
101 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
102 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
103 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
104 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
105 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
106 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
107 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
108 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
109 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
110 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
111 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
112 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
113 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
114 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
115 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
116 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
117 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
118 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
119 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
120 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.4
Nodule 0.52
Rhizoplane 2.58
Rhizosphere 74.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10000559 3300009177 Bacteria 42238
2 Ga0055530_10000559 3300003791 Bacteria 32231
3 Ga0055531_10001988 3300003794 Bacteria 14208
4 Ga0065165_1000277 3300005262 Bacteria 87540
5 Ga0070658_10114648 3300005327 Bacteria 2235
6 Ga0070668_100000605 3300005347 Bacteria 23992
7 Ga0070668_100001328 3300005347 Bacteria 17649
8 Ga0070668_100003091 3300005347 Bacteria 12300
9 Ga0070669_100018842 3300005353 Bacteria 4934
10 Ga0070671_100000342 3300005355 Bacteria 32006
11 Ga0070659_100010857 3300005366 Bacteria 6715
12 Ga0070667_100001045 3300005367 Bacteria 25251
13 Ga0070667_100014065 3300005367 Bacteria 6613
14 Ga0070662_100021252 3300005457 Bacteria 4430
15 Ga0070681_10028089 3300005458 Bacteria 5656
16 Ga0070679_100063437 3300005530 Bacteria 3683
17 Ga0068853_100358901 3300005539 Bacteria 1357
18 Ga0070665_100000801 3300005548 Bacteria 41188
19 Ga0070665_100000934 3300005548 Bacteria 37393
20 Ga0070665_100038321 3300005548 Bacteria 4819
21 Ga0068855_100082473 3300005563 Bacteria 3726
22 Ga0068855_100105162 3300005563 Bacteria 3246
23 Ga0068855_100109390 3300005563 Bacteria 3174
24 Ga0070664_100172281 3300005564 Bacteria 1920
25 Ga0068859_100005983 3300005617 Bacteria 12354
26 Ga0068859_100028692 3300005617 Bacteria 5580
27 Ga0068864_100000521 3300005618 Bacteria 33096
28 Ga0068864_100007846 3300005618 Bacteria 8794
29 Ga0068864_100057243 3300005618 Bacteria 3368
30 Ga0068864_100083986 3300005618 Bacteria 2797
31 Ga0068863_100000007 3300005841 Bacteria 257578
32 Ga0068863_100007553 3300005841 Bacteria 10635
33 Ga0068863_100012541 3300005841 Bacteria 8179
34 Ga0068863_100039411 3300005841 Bacteria 4495
35 Ga0068858_100000025 3300005842 Bacteria 160546
36 Ga0068858_100014669 3300005842 Bacteria 7377
37 Ga0068858_100075711 3300005842 Bacteria 3126
38 Ga0068860_100000128 3300005843 Bacteria 122731
39 Ga0068860_100000139 3300005843 Bacteria 119188
40 Ga0068860_100001319 3300005843 Bacteria 26929
41 Ga0068860_100236464 3300005843 Bacteria 1776
42 Ga0068862_100000121 3300005844 Bacteria 91849
43 Ga0068862_100005194 3300005844 Bacteria 10940
44 Ga0070717_10023121 3300006028 Bacteria 4920
45 Ga0097620_100005983 3300006931 Bacteria 12354
46 Ga0097620_100028692 3300006931 Bacteria 5580
47 Ga0079104_1014758 3300006946 Bacteria 2344
48 Ga0105250_10010034 3300009092 Bacteria 3963
49 Ga0105240_10001061 3300009093 Bacteria 48640
50 Ga0105240_10031757 3300009093 Bacteria 6843
51 Ga0105240_10095475 3300009093 Bacteria 3625
52 Ga0105245_10348715 3300009098 Bacteria 1466
53 Ga0105248_10014322 3300009177 Bacteria 8728
54 Ga0105248_10029256 3300009177 Bacteria 6146
55 Ga0105248_10042663 3300009177 Bacteria 5087
56 Ga0105248_10297845 3300009177 Bacteria 1816
57 Ga0105238_10010017 3300009551 Bacteria 9506
58 Ga0105238_10024894 3300009551 Bacteria 6099
59 Ga0105238_10069546 3300009551 Bacteria 3521
60 Ga0105249_10065930 3300009553 Bacteria 3333
61 Ga0105249_10146566 3300009553 Bacteria 2269
62 Ga0105239_10165097 3300010375 Bacteria 2476
63 Ga0157373_10000340 3300013100 Bacteria 37871
64 Ga0157373_10000686 3300013100 Bacteria 26568
65 Ga0157370_10053245 3300013104 Bacteria 3860
66 Ga0157370_10138634 3300013104 Bacteria 2266
67 Ga0157370_10211499 3300013104 Bacteria 1797
68 Ga0163162_10244613 3300013306 Bacteria 1925
69 Ga0157375_10048199 3300013308 Bacteria 4166
70 Ga0163163_10025109 3300014325 Bacteria 5678
71 Ga0163163_10105871 3300014325 Bacteria 2838
72 Ga0163163_10161121 3300014325 Bacteria 2289
73 Ga0163163_10184666 3300014325 Bacteria 2133
74 Ga0163163_10218684 3300014325 Bacteria 1954
75 Ga0157379_10000697 3300014968 Bacteria 27269
76 Ga0157379_10014405 3300014968 Bacteria 6937
77 Ga0213876_10015697 3300021384 Bacteria 4009
78 Ga0209026_1000744 3300025250 Bacteria 18612
79 Ga0209758_1000920 3300025297 Bacteria 39827
80 Ga0209050_1000200 3300025298 Bacteria 134115
81 Ga0209257_1000225 3300025304 Bacteria 134023
82 Ga0207705_10079374 3300025909 Bacteria 2390
83 Ga0207707_10045313 3300025912 Bacteria 3833
84 Ga0207695_10000939 3300025913 Bacteria 51994
85 Ga0207695_10002233 3300025913 Bacteria 29071
86 Ga0207695_10014542 3300025913 Bacteria 9313
87 Ga0207695_10020936 3300025913 Bacteria 7474
88 Ga0207652_10074159 3300025921 Bacteria 2962
89 Ga0207681_10009311 3300025923 Bacteria 5999
90 Ga0207694_10020481 3300025924 Bacteria 5004
91 Ga0207694_10184583 3300025924 Bacteria 1692
92 Ga0207650_10000099 3300025925 Bacteria 113522
93 Ga0207650_10170628 3300025925 Bacteria 1729
94 Ga0207644_10001653 3300025931 Bacteria 14370
95 Ga0207706_10087340 3300025933 Bacteria 2742
96 Ga0207711_10018993 3300025941 Bacteria 5718
97 Ga0207711_10024977 3300025941 Bacteria 5012
98 Ga0207711_10026254 3300025941 Bacteria 4887
99 Ga0207667_10020497 3300025949 Bacteria 7350
100 Ga0207667_10086031 3300025949 Bacteria 3254
101 Ga0207667_10099336 3300025949 Bacteria 3003
102 Ga0207712_10000415 3300025961 Bacteria 36527
103 Ga0207668_10000046 3300025972 Bacteria 102051
104 Ga0207668_10000465 3300025972 Bacteria 25478
105 Ga0207668_10001842 3300025972 Bacteria 12378
106 Ga0207668_10050592 3300025972 Bacteria 2865
107 Ga0207658_10000106 3300025986 Bacteria 90920
108 Ga0207658_10012318 3300025986 Bacteria 5838
109 Ga0207658_10051008 3300025986 Bacteria 3047
110 Ga0207703_10003905 3300026035 Bacteria 12377
111 Ga0207703_10005352 3300026035 Bacteria 10336
112 Ga0207639_10327026 3300026041 Bacteria 1363
113 Ga0207702_10320699 3300026078 Bacteria 1475
114 Ga0207641_10000012 3300026088 Bacteria 375486
115 Ga0207641_10001351 3300026088 Bacteria 24324
116 Ga0207641_10011504 3300026088 Bacteria 7264
117 Ga0207641_10035880 3300026088 Bacteria 4135
118 Ga0207676_10000119 3300026095 Bacteria 69303
119 Ga0207676_10000360 3300026095 Bacteria 38926
120 Ga0209981_1001095 3300027378 Bacteria 3446
121 Ga0209999_1000810 3300027543 Bacteria 5154
122 Ga0209983_1004119 3300027665 Bacteria 3070
123 Ga0268266_10000636 3300028379 Bacteria 47724
124 Ga0268266_10008544 3300028379 Bacteria 9101
125 Ga0268265_10004148 3300028380 Bacteria 10160
126 Ga0268265_10004244 3300028380 Bacteria 10003
127 Ga0268265_10027763 3300028380 Bacteria 4044
128 Ga0268264_10000046 3300028381 Bacteria 364597
129 Ga0268264_10000059 3300028381 Bacteria 306927
130 Ga0268264_10052782 3300028381 Bacteria 3390
131 Ga0307517_10001866 3300028786 Bacteria 34489
132 Ga0307517_10074312 3300028786 Bacteria 2999
133 Ga0265327_10000166 3300031251 Bacteria 141539
134 Ga0265327_10004508 3300031251 Bacteria 12291
135 Ga0307513_10000181 3300031456 Bacteria 91264
136 Ga0307513_10001569 3300031456 Bacteria 32781
137 Ga0307513_10019742 3300031456 Bacteria 8011
138 Ga0307508_10084270 3300031616 Bacteria 2761
139 Ga0307516_10000004 3300031730 Bacteria 367451
140 Ga0307510_10016721 3300033180 Bacteria 8656
141 Ga0307510_10079961 3300033180 Bacteria 3182
142 Ga0373927_0001060 3300035695 Bacteria 20988
143 Ga0373925_0000039 3300037068 Bacteria 138537
144 Ga0373925_0093061 3300037068 Bacteria 2307
145 Ga0395900_0148990 3300037418 Bacteria 2391
146 Ga0395900_0191427 3300037418 Bacteria 2075
147 Ga0395898_0064715 3300037466 Bacteria 3546
148 Ga0395905_0085448 3300037471 Bacteria 2956
149 Ga0395905_0224111 3300037471 Bacteria 1759
150 Ga0395905_0307382 3300037471 Bacteria 1474
151 Ga0395901_0474123 3300038443 Bacteria 1277
152 Ga0436365_0799727 3300039437 Bacteria 5181
153 Ga0436365_1721793 3300039437 Bacteria 3797
154 Ga0495629_0026484 3300046459 Bacteria 4119
155 Ga0495594_0062803 3300046499 Bacteria 2057
156 Ga0495610_0061697 3300046512 Bacteria 1780
157 Ga0495642_0002527 3300046528 Bacteria 7397
158 Ga0495597_0008063 3300046542 Bacteria 5299
159 Ga0495668_0025472 3300046616 Bacteria 3361
160 Ga0495636_0042325 3300047318 Bacteria 1892
161 Ga0495687_023542 3300047443 Bacteria 2940
162 Ga0495686_0006211 3300047472 Bacteria 9211
163 Ga0495602_0195418 3300048088 Bacteria 1548
164 Ga0496102_0324431 3300048905 Bacteria 1450
165 Ga0496106_0121629 3300048909 Bacteria 2041
166 Ga0496108_0077900 3300048911 Bacteria 2805
167 Ga0496109_0066397 3300048912 Bacteria 3303
168 Ga0496112_0011099 3300048915 Bacteria 8210
169 Ga0496116_0111188 3300048919 Bacteria 1610
170 Ga0496117_0005600 3300048920 Bacteria 13122
171 Ga0496118_0042252 3300048921 Bacteria 3598
172 Ga0496119_0043612 3300048922 Bacteria 2832
173 Ga0496121_0000009 3300048924 Bacteria 836971
174 Ga0501047_0000805 3300049581 Bacteria 32767
175 Ga0500635_0000054 3300053080 Bacteria 74486
176 Ga0500643_004182 3300053087 Bacteria 6617
177 Ga0500643_004378 3300053087 Bacteria 6411
178 Ga0500641_0001458 3300053096 Bacteria 8434
179 Ga0500555_013172 3300053103 Bacteria 2384
180 Ga0500556_0042279 3300053104 Bacteria 1611
181 Ga0500562_000145 3300053108 Bacteria 20904
182 Ga0500569_010565 3300053109 Bacteria 2180
183 Ga0500595_001580 3300053119 Bacteria 12021
184 Ga0500595_016366 3300053119 Bacteria 2763
185 Ga0500608_032295 3300053122 Bacteria 2487
186 Ga0500614_018598 3300053123 Bacteria 1582
187 Ga0500559_0010018 3300053136 Bacteria 4082
188 Ga0500616_0008483 3300053153 Bacteria 6374
189 Ga0500638_019865 3300053162 Bacteria 3156
190 Ga0500636_0081521 3300053177 Bacteria 1863
191 Ga0500637_0023798 3300053178 Bacteria 3352
192 Ga0500645_000184 3300053730 Bacteria 48312
193 Ga0500596_002569 3300053735 Bacteria 3567
194 Ga0500601_002991 3300053737 Bacteria 1823
195 Ga0105248_10000559
196 Ga0055530_10000559
197 Ga0055531_10001988
198 Ga0065165_1000277
199 Ga0070658_10114648
200 Ga0070668_100000605
201 Ga0070668_100001328
202 Ga0070668_100003091
203 Ga0070669_100018842
204 Ga0070671_100000342
205 Ga0070659_100010857
206 Ga0070667_100001045
207 Ga0070667_100014065
208 Ga0070662_100021252
209 Ga0070681_10028089
210 Ga0070679_100063437
211 Ga0068853_100358901
212 Ga0070665_100000801
213 Ga0070665_100000934
214 Ga0070665_100038321
215 Ga0068855_100082473
216 Ga0068855_100105162
217 Ga0068855_100109390
218 Ga0070664_100172281
219 Ga0068859_100005983
220 Ga0068859_100028692
221 Ga0068864_100000521
222 Ga0068864_100007846
223 Ga0068864_100057243
224 Ga0068864_100083986
225 Ga0068863_100000007
226 Ga0068863_100007553
227 Ga0068863_100012541
228 Ga0068863_100039411
229 Ga0068858_100000025
230 Ga0068858_100014669
231 Ga0068858_100075711
232 Ga0068860_100000128
233 Ga0068860_100000139
234 Ga0068860_100001319
235 Ga0068860_100236464
236 Ga0068862_100000121
237 Ga0068862_100005194
238 Ga0070717_10023121
239 Ga0097620_100005983
240 Ga0097620_100028692
241 Ga0079104_1014758
242 Ga0105250_10010034
243 Ga0105240_10001061
244 Ga0105240_10031757
245 Ga0105240_10095475
246 Ga0105245_10348715
247 Ga0105248_10014322
248 Ga0105248_10029256
249 Ga0105248_10042663
250 Ga0105248_10297845
251 Ga0105238_10010017
252 Ga0105238_10024894
253 Ga0105238_10069546
254 Ga0105249_10065930
255 Ga0105249_10146566
256 Ga0105239_10165097
257 Ga0157373_10000340
258 Ga0157373_10000686
259 Ga0157370_10053245
260 Ga0157370_10138634
261 Ga0157370_10211499
262 Ga0163162_10244613
263 Ga0157375_10048199
264 Ga0163163_10025109
265 Ga0163163_10105871
266 Ga0163163_10161121
267 Ga0163163_10184666
268 Ga0163163_10218684
269 Ga0157379_10000697
270 Ga0157379_10014405
271 Ga0213876_10015697
272 Ga0209026_1000744
273 Ga0209758_1000920
274 Ga0209050_1000200
275 Ga0209257_1000225
276 Ga0207705_10079374
277 Ga0207707_10045313
278 Ga0207695_10000939
279 Ga0207695_10002233
280 Ga0207695_10014542
281 Ga0207695_10020936
282 Ga0207652_10074159
283 Ga0207681_10009311
284 Ga0207694_10020481
285 Ga0207694_10184583
286 Ga0207650_10000099
287 Ga0207650_10170628
288 Ga0207644_10001653
289 Ga0207706_10087340
290 Ga0207711_10018993
291 Ga0207711_10024977
292 Ga0207711_10026254
293 Ga0207667_10020497
294 Ga0207667_10086031
295 Ga0207667_10099336
296 Ga0207712_10000415
297 Ga0207668_10000046
298 Ga0207668_10000465
299 Ga0207668_10001842
300 Ga0207668_10050592
301 Ga0207658_10000106
302 Ga0207658_10012318
303 Ga0207658_10051008
304 Ga0207703_10003905
305 Ga0207703_10005352
306 Ga0207639_10327026
307 Ga0207702_10320699
308 Ga0207641_10000012
309 Ga0207641_10001351
310 Ga0207641_10011504
311 Ga0207641_10035880
312 Ga0207676_10000119
313 Ga0207676_10000360
314 Ga0209981_1001095
315 Ga0209999_1000810
316 Ga0209983_1004119
317 Ga0268266_10000636
318 Ga0268266_10008544
319 Ga0268265_10004148
320 Ga0268265_10004244
321 Ga0268265_10027763
322 Ga0268264_10000046
323 Ga0268264_10000059
324 Ga0268264_10052782
325 Ga0307517_10001866
326 Ga0307517_10074312
327 Ga0265327_10000166
328 Ga0265327_10004508
329 Ga0307513_10000181
330 Ga0307513_10001569
331 Ga0307513_10019742
332 Ga0307508_10084270
333 Ga0307516_10000004
334 Ga0307510_10016721
335 Ga0307510_10079961
336 Ga0373927_0001060
337 Ga0373925_0000039
338 Ga0373925_0093061
339 Ga0395900_0148990
340 Ga0395900_0191427
341 Ga0395898_0064715
342 Ga0395905_0085448
343 Ga0395905_0224111
344 Ga0395905_0307382
345 Ga0395901_0474123
346 Ga0436365_0799727
347 Ga0436365_1721793
348 Ga0495629_0026484
349 Ga0495594_0062803
350 Ga0495610_0061697
351 Ga0495642_0002527
352 Ga0495597_0008063
353 Ga0495668_0025472
354 Ga0495636_0042325
355 Ga0495687_023542
356 Ga0495686_0006211
357 Ga0495602_0195418
358 Ga0496102_0324431
359 Ga0496106_0121629
360 Ga0496108_0077900
361 Ga0496109_0066397
362 Ga0496112_0011099
363 Ga0496116_0111188
364 Ga0496117_0005600
365 Ga0496118_0042252
366 Ga0496119_0043612
367 Ga0496121_0000009
368 Ga0501047_0000805
369 Ga0500635_0000054
370 Ga0500643_004182
371 Ga0500643_004378
372 Ga0500641_0001458
373 Ga0500555_013172
374 Ga0500556_0042279
375 Ga0500562_000145
376 Ga0500569_010565
377 Ga0500595_001580
378 Ga0500595_016366
379 Ga0500608_032295
380 Ga0500614_018598
381 Ga0500559_0010018
382 Ga0500616_0008483
383 Ga0500638_019865
384 Ga0500636_0081521
385 Ga0500637_0023798
386 Ga0500645_000184
387 Ga0500596_002569
388 Ga0500601_002991

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01053

Cys_Met_Meta_PP

Cys/Met metabolism PLP-dependent enzyme

21

397

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e6g-assembly1.cif.gz_D crystal structure of xometc, a cystathionine c-lyase-like protein from xanthomonas oryzae pv.oryzae 0.9089 54 377
1pff-assembly1.cif.gz_A crystal structure of homocysteine alpha-, gamma-lyase at 1.8 angstroms 0.8961 58 382
3e6g-assembly1.cif.gz_B crystal structure of xometc, a cystathionine c-lyase-like protein from xanthomonas oryzae pv.oryzae 0.895 55 377
2nmp-assembly1.cif.gz_A crystal structure of human cystathionine gamma lyase 0.8918 45 382
5tsu-assembly2.cif.gz_F active conformation for engineered human cystathionine gamma lyase (e59n, r119l, e339v) to depleting methionine 0.8872 23 382
ID Description Score Start End Superfamily
af_A0A0P0VYR6_1_109_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9063 143 250 3.40.640.10
2nmpB02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9013 253 382 3.90.1150.10
2fq6A02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.894 253 382 3.90.1150.10
1pffB01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.8935 58 250 3.40.640.10
af_A4I885_262_396_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.8904 258 384 3.90.1150.10
ID Description Score Start End GO Terms
AF-V4NKY1-F1-model_v4 Cystathionine beta-lyase 0.9509 59 385 GO:0009086
GO:0019346
GO:0019450
GO:0030170
GO:0047804
AF-A0A3B9EKY8-F1-model_v4 Cystathionine beta-lyase 0.9454 69 385 GO:0009086
GO:0019346
GO:0019450
GO:0030170
GO:0047804
AF-A0A2S6TIB3-F1-model_v4 Cystathionine beta-lyase (EC 4.4.1.8) 0.9406 100 385 GO:0019346
GO:0019450
GO:0030170
GO:0047804
AF-A0A7C7X156-F1-model_v4 deleted 0.9382 90 301
AF-A0A833KQ90-F1-model_v4 deleted 0.9359 63 247

Map