F298675

General Info

Members Datasets Scaffolds Average Seq Length
194 157 388 321

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10186042|Ga0157375_101860422
Length 358
Sequence METWQALNVRPATGERLISIVRLEPDDGRDRPPHMQNTFPVILGLIVPLFLAATIATAAPSAKAAEDRYIAARDAAIEKISAIYDAGNADDAARKAXXXXSADLAAQMRAILNEPDRDGFGPAKLNIDTFSKGDEGFGTLDGLRFDARLGKNGETASQNGADGKYVEPKAHIIVTTQTLFERWLRAHKDWWGKDTRNVPQQIGAALKDESFYTQAISSGAAVVNFNSLPIAKPAGATFAYGMLAGRTQSDIPDAADTVFVSAIANGKVYVAYGSIDPKVQIPACIAIRANINKKAEQAEDDLRSEKIDRKAYDKLGNLRQKGEDEYKRCFTQNAPRQASLAQATLQAERLLAAALNKR

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
11 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
12 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
13 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
25 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
26 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
37 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
52 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
53 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
54 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
57 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
58 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
59 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
60 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
61 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
62 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
63 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
64 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
65 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
66 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
67 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
68 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
69 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
70 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
71 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
72 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
73 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
76 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
77 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
78 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
79 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
80 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
81 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
82 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
83 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
84 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
85 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
86 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
87 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
88 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
89 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
90 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
91 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
92 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
93 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
96 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
97 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
98 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
99 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
100 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
101 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
102 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
103 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
104 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
105 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
106 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
107 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
108 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
109 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
110 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
111 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
112 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
113 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
114 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
115 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
116 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
117 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
125 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
126 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
127 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
128 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
129 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
130 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
131 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
132 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
133 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
134 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
135 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
136 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
137 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
138 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
139 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
140 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
141 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
142 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
143 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
144 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
145 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
146 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
147 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
148 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
149 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
150 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
151 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
152 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
153 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
154 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
155 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
156 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
157 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.78
Metatranscriptomes 0
Isolates 7.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.86
Nodule 7.22
Rhizoplane 6.7
Rhizosphere 64.95
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10186042 3300013308 Bacteria 2230
2 JGI25153J46596_10000938 3300003215 Bacteria 17749
3 Ga0070676_10098639 3300005328 Bacteria 1801
4 Ga0068868_100067091 3300005338 Bacteria 2855
5 Ga0068868_100157809 3300005338 Bacteria 1872
6 Ga0070671_100357982 3300005355 Bacteria 1246
7 Ga0070667_100106452 3300005367 Bacteria 2427
8 Ga0070663_100494089 3300005455 Bacteria 1015
9 Ga0070679_100206729 3300005530 Bacteria 1927
10 Ga0070665_100004521 3300005548 Bacteria 14572
11 Ga0070665_100026356 3300005548 Bacteria 5855
12 Ga0070665_100045923 3300005548 Bacteria 4387
13 Ga0068859_100057727 3300005617 Bacteria 3909
14 Ga0068859_100119705 3300005617 Bacteria 2700
15 Ga0068859_100474786 3300005617 Bacteria 1346
16 Ga0068864_100135644 3300005618 Bacteria 2216
17 Ga0068860_100099006 3300005843 Bacteria 2781
18 Ga0068862_100284111 3300005844 Bacteria 1517
19 Ga0081455_10011829 3300005937 Bacteria 8737
20 Ga0081455_10019088 3300005937 Bacteria 6499
21 Ga0081540_1002823 3300005983 Bacteria 14059
22 Ga0081540_1055124 3300005983 Bacteria 1938
23 Ga0075365_10117833 3300006038 Bacteria 1830
24 Ga0075365_10142822 3300006038 Bacteria 1662
25 Ga0075368_10004495 3300006042 Bacteria 4734
26 Ga0075363_100001509 3300006048 Bacteria 8884
27 Ga0075363_100192232 3300006048 Bacteria 1164
28 Ga0075364_10025180 3300006051 Bacteria 3786
29 Ga0075367_10040274 3300006178 Bacteria 2727
30 Ga0075370_10015255 3300006353 Bacteria 4109
31 Ga0075428_100087938 3300006844 Bacteria 3389
32 Ga0097620_100057726 3300006931 Bacteria 3909
33 Ga0097620_100119706 3300006931 Bacteria 2700
34 Ga0097620_100474834 3300006931 Bacteria 1346
35 Ga0099825_1021940 3300006941 Bacteria 4222
36 Ga0099822_1012647 3300006943 Bacteria 10050
37 Ga0099795_10050478 3300007788 Bacteria 1513
38 Ga0105240_10615973 3300009093 Bacteria 1194
39 Ga0111539_10306389 3300009094 Bacteria 1848
40 Ga0105243_10168291 3300009148 Bacteria 1896
41 Ga0105243_10257308 3300009148 Bacteria 1561
42 Ga0105242_10135299 3300009176 Bacteria 2132
43 Ga0105248_10494121 3300009177 Bacteria 1379
44 Ga0105249_10109742 3300009553 Bacteria 2606
45 Ga0105239_10283432 3300010375 Bacteria 1865
46 Ga0105239_10429214 3300010375 Bacteria 1498
47 Ga0157370_10111710 3300013104 Bacteria 2554
48 Ga0157375_10493426 3300013308 Bacteria 1389
49 Ga0157375_10662359 3300013308 Bacteria 1199
50 Ga0157379_10247984 3300014968 Bacteria 1616
51 Ga0209758_1013330 3300025297 Bacteria 4493
52 Ga0209758_1013354 3300025297 Bacteria 4485
53 Ga0207688_10046051 3300025901 Bacteria 2435
54 Ga0207645_10063645 3300025907 Bacteria 2357
55 Ga0207652_10030545 3300025921 Bacteria 4513
56 Ga0207644_10258326 3300025931 Bacteria 1392
57 Ga0207706_10082239 3300025933 Bacteria 2830
58 Ga0207691_10062452 3300025940 Bacteria 3380
59 Ga0207711_10077190 3300025941 Bacteria 2903
60 Ga0207711_10190536 3300025941 Bacteria 1868
61 Ga0207689_10010548 3300025942 Bacteria 7956
62 Ga0207689_10045691 3300025942 Bacteria 3620
63 Ga0207712_10105680 3300025961 Bacteria 2102
64 Ga0207712_10113818 3300025961 Bacteria 2034
65 Ga0207668_10026508 3300025972 Bacteria 3764
66 Ga0207668_10127262 3300025972 Bacteria 1939
67 Ga0207639_10025650 3300026041 Bacteria 4276
68 Ga0207678_10005874 3300026067 Bacteria 10939
69 Ga0207678_10036010 3300026067 Bacteria 4308
70 Ga0207678_10057070 3300026067 Bacteria 3360
71 Ga0207676_10116634 3300026095 Bacteria 2244
72 Ga0207683_10076435 3300026121 Bacteria 2965
73 Ga0209589_1000004 3300027357 Bacteria 578529
74 Ga0209489_100004 3300027361 Bacteria 578529
75 Ga0209700_100004 3300027363 Bacteria 578529
76 Ga0268266_10002093 3300028379 Bacteria 22080
77 Ga0268266_10005360 3300028379 Bacteria 11983
78 Ga0268266_10006591 3300028379 Bacteria 10604
79 Ga0268265_10056544 3300028380 Bacteria 2985
80 Ga0265334_10041197 3300028573 Bacteria 1806
81 Ga0307517_10004197 3300028786 Bacteria 22221
82 Ga0307515_10072833 3300028794 Bacteria 4628
83 Ga0307515_10277201 3300028794 Bacteria 1389
84 Ga0265332_10039729 3300031238 Bacteria 2038
85 Ga0265331_10027133 3300031250 Bacteria 2874
86 Ga0307509_10048654 3300031507 Bacteria 4551
87 Ga0265314_10023485 3300031711 Bacteria 4700
88 Ga0265314_10141197 3300031711 Bacteria 1489
89 Ga0307516_10056849 3300031730 Bacteria 3813
90 Ga0307510_10006805 3300033180 Bacteria 13635
91 Ga0373923_0018173 3300035111 Bacteria 2701
92 Ga0373953_0002282 3300035117 Bacteria 5769
93 Ga0373954_0004476 3300035118 Bacteria 6014
94 Ga0373956_0002503 3300035119 Bacteria 7480
95 Ga0373957_0000546 3300035120 Bacteria 9543
96 Ga0373955_0002750 3300035172 Bacteria 7717
97 Ga0373931_0020747 3300035691 Bacteria 3290
98 Ga0373927_0093663 3300035695 Bacteria 1952
99 Ga0373933_0007480 3300035724 Bacteria 5963
100 Ga0373937_0016505 3300036401 Bacteria 6560
101 Ga0373925_0107820 3300037068 Bacteria 2149
102 Ga0495617_006842 3300046452 Bacteria 3982
103 Ga0495592_0008874 3300046454 Bacteria 7550
104 Ga0495603_0021189 3300046455 Bacteria 3935
105 Ga0495603_0239294 3300046455 Bacteria 1046
106 Ga0495629_0015138 3300046459 Bacteria 5544
107 Ga0495638_0027446 3300046460 Bacteria 3684
108 Ga0495651_0033415 3300046462 Bacteria 4012
109 Ga0495653_0007949 3300046463 Bacteria 8683
110 Ga0495605_0108118 3300046474 Bacteria 1272
111 Ga0495608_0003691 3300046511 Bacteria 11008
112 Ga0495628_0056694 3300046516 Bacteria 3083
113 Ga0495630_0091254 3300046517 Bacteria 2302
114 Ga0495631_0055861 3300046518 Bacteria 1720
115 Ga0495632_0021729 3300046519 Bacteria 3453
116 Ga0495632_0056350 3300046519 Bacteria 1921
117 Ga0495644_0038720 3300046523 Bacteria 1798
118 Ga0495652_0077150 3300046529 Bacteria 2762
119 Ga0495640_0008852 3300046533 Bacteria 7868
120 Ga0495587_0028201 3300046536 Bacteria 3415
121 Ga0495622_0032614 3300046557 Bacteria 2432
122 Ga0495667_0019084 3300046559 Bacteria 4627
123 Ga0495656_0003511 3300046615 Bacteria 5304
124 Ga0495668_0043482 3300046616 Bacteria 2498
125 Ga0495634_0018941 3300046642 Bacteria 4895
126 Ga0495611_0064578 3300046648 Bacteria 1667
127 Ga0495635_0005522 3300046663 Bacteria 8796
128 Ga0495659_0018140 3300046664 Bacteria 2341
129 Ga0495657_0005377 3300046675 Bacteria 10127
130 Ga0495599_0004042 3300046678 Bacteria 8637
131 Ga0495623_0035710 3300046679 Bacteria 3185
132 Ga0495646_0006847 3300046680 Bacteria 7233
133 Ga0495670_0015088 3300046691 Bacteria 3801
134 Ga0495670_0037110 3300046691 Bacteria 2429
135 Ga0495600_0010165 3300046809 Bacteria 5832
136 Ga0495581_0015165 3300047315 Bacteria 4473
137 Ga0495604_0012537 3300047317 Bacteria 6742
138 Ga0495604_0260171 3300047317 Bacteria 1180
139 Ga0495674_0045522 3300047319 Bacteria 3896
140 Ga0495674_0236685 3300047319 Bacteria 1506
141 Ga0495680_0047726 3300047322 Bacteria 3366
142 Ga0495675_0005230 3300047444 Bacteria 7902
143 Ga0495684_0098281 3300047471 Bacteria 2213
144 Ga0495593_0005062 3300047673 Bacteria 7793
145 Ga0495602_0111084 3300048088 Bacteria 2226
146 Ga0496100_0203941 3300048903 Bacteria 1443
147 Ga0496101_0048033 3300048904 Bacteria 3066
148 Ga0496103_0085970 3300048906 Bacteria 1982
149 Ga0496104_0220151 3300048907 Bacteria 1810
150 Ga0496104_0221333 3300048907 Bacteria 1805
151 Ga0496105_0105830 3300048908 Bacteria 2322
152 Ga0496106_0083390 3300048909 Bacteria 2458
153 Ga0496108_0372119 3300048911 Bacteria 1247
154 Ga0496111_0074111 3300048914 Bacteria 2479
155 Ga0496112_0404625 3300048915 Bacteria 1304
156 Ga0496113_0028827 3300048916 Bacteria 3998
157 Ga0496114_0410354 3300048917 Bacteria 1199
158 Ga0496119_0096133 3300048922 Bacteria 1672
159 Ga0496121_0045635 3300048924 Bacteria 3763
160 Ga0496124_0156715 3300048927 Bacteria 1780
161 Ga0496124_0234348 3300048927 Bacteria 1370
162 Ga0496124_0259055 3300048927 Bacteria 1281
163 Ga0496125_0034007 3300048928 Bacteria 4500
164 Ga0496126_0030777 3300048929 Bacteria 5081
165 Ga0496126_0173822 3300048929 Bacteria 1833
166 nmdc:mga03n38_181506_c1 3300050490 Bacteria 1078
167 nmdc:mga0yw44_52439_c1 3300050492 Bacteria 2473
168 nmdc:mga0yw44_93526_c1 3300050492 Bacteria 1904
169 nmdc:mga07m45_12307_c1 3300050496 Bacteria 4519
170 Ga0495601_0021437 3300053077 Bacteria 3957
171 Ga0495595_0001214 3300053084 Bacteria 10020
172 Ga0495595_0022097 3300053084 Bacteria 2789
173 Ga0500566_0019720 3300053094 Bacteria 3960
174 Ga0500595_001332 3300053119 Bacteria 13364
175 Ga0500590_022802 3300053148 Bacteria 3253
176 Ga0500638_000810 3300053162 Bacteria 8620
177 Ga0500636_0134373 3300053177 Bacteria 1375
178 Ga0500637_0000716 3300053178 Bacteria 13237
179 Ga0500645_029786 3300053730 Bacteria 1646
180 Ga0500661_000675 3300055283 Bacteria 6405
181 2671118911 2667528175 Bacteria 7532676
182 2728753423 2728368998 Bacteria 8720350
183 2793071296 2791355197 Bacteria 8420563
184 2889040465 2889033259 Bacteria 9099371
185 2904697179 2904690495 Bacteria 9412302
186 2906641753 2906635258 Bacteria 8601019
187 2906667712 2906660503 Bacteria 8595048
188 2908762594 2908756301 Bacteria 8864324
189 2935631977 2935630451 Bacteria 8169952
190 2941507925 2941507105 Bacteria 8166816
191 2941515570 2941515067 Bacteria 8166720
192 2941523855 2941523033 Bacteria 8169134
193 8006943103 8006933436 Bacteria 10410654
194 8006982898 8006973647 Bacteria 10679141
195 Ga0157375_10186042
196 JGI25153J46596_10000938
197 Ga0070676_10098639
198 Ga0068868_100067091
199 Ga0068868_100157809
200 Ga0070671_100357982
201 Ga0070667_100106452
202 Ga0070663_100494089
203 Ga0070679_100206729
204 Ga0070665_100004521
205 Ga0070665_100026356
206 Ga0070665_100045923
207 Ga0068859_100057727
208 Ga0068859_100119705
209 Ga0068859_100474786
210 Ga0068864_100135644
211 Ga0068860_100099006
212 Ga0068862_100284111
213 Ga0081455_10011829
214 Ga0081455_10019088
215 Ga0081540_1002823
216 Ga0081540_1055124
217 Ga0075365_10117833
218 Ga0075365_10142822
219 Ga0075368_10004495
220 Ga0075363_100001509
221 Ga0075363_100192232
222 Ga0075364_10025180
223 Ga0075367_10040274
224 Ga0075370_10015255
225 Ga0075428_100087938
226 Ga0097620_100057726
227 Ga0097620_100119706
228 Ga0097620_100474834
229 Ga0099825_1021940
230 Ga0099822_1012647
231 Ga0099795_10050478
232 Ga0105240_10615973
233 Ga0111539_10306389
234 Ga0105243_10168291
235 Ga0105243_10257308
236 Ga0105242_10135299
237 Ga0105248_10494121
238 Ga0105249_10109742
239 Ga0105239_10283432
240 Ga0105239_10429214
241 Ga0157370_10111710
242 Ga0157375_10493426
243 Ga0157375_10662359
244 Ga0157379_10247984
245 Ga0209758_1013330
246 Ga0209758_1013354
247 Ga0207688_10046051
248 Ga0207645_10063645
249 Ga0207652_10030545
250 Ga0207644_10258326
251 Ga0207706_10082239
252 Ga0207691_10062452
253 Ga0207711_10077190
254 Ga0207711_10190536
255 Ga0207689_10010548
256 Ga0207689_10045691
257 Ga0207712_10105680
258 Ga0207712_10113818
259 Ga0207668_10026508
260 Ga0207668_10127262
261 Ga0207639_10025650
262 Ga0207678_10005874
263 Ga0207678_10036010
264 Ga0207678_10057070
265 Ga0207676_10116634
266 Ga0207683_10076435
267 Ga0209589_1000004
268 Ga0209489_100004
269 Ga0209700_100004
270 Ga0268266_10002093
271 Ga0268266_10005360
272 Ga0268266_10006591
273 Ga0268265_10056544
274 Ga0265334_10041197
275 Ga0307517_10004197
276 Ga0307515_10072833
277 Ga0307515_10277201
278 Ga0265332_10039729
279 Ga0265331_10027133
280 Ga0307509_10048654
281 Ga0265314_10023485
282 Ga0265314_10141197
283 Ga0307516_10056849
284 Ga0307510_10006805
285 Ga0373923_0018173
286 Ga0373953_0002282
287 Ga0373954_0004476
288 Ga0373956_0002503
289 Ga0373957_0000546
290 Ga0373955_0002750
291 Ga0373931_0020747
292 Ga0373927_0093663
293 Ga0373933_0007480
294 Ga0373937_0016505
295 Ga0373925_0107820
296 Ga0495617_006842
297 Ga0495592_0008874
298 Ga0495603_0021189
299 Ga0495603_0239294
300 Ga0495629_0015138
301 Ga0495638_0027446
302 Ga0495651_0033415
303 Ga0495653_0007949
304 Ga0495605_0108118
305 Ga0495608_0003691
306 Ga0495628_0056694
307 Ga0495630_0091254
308 Ga0495631_0055861
309 Ga0495632_0021729
310 Ga0495632_0056350
311 Ga0495644_0038720
312 Ga0495652_0077150
313 Ga0495640_0008852
314 Ga0495587_0028201
315 Ga0495622_0032614
316 Ga0495667_0019084
317 Ga0495656_0003511
318 Ga0495668_0043482
319 Ga0495634_0018941
320 Ga0495611_0064578
321 Ga0495635_0005522
322 Ga0495659_0018140
323 Ga0495657_0005377
324 Ga0495599_0004042
325 Ga0495623_0035710
326 Ga0495646_0006847
327 Ga0495670_0015088
328 Ga0495670_0037110
329 Ga0495600_0010165
330 Ga0495581_0015165
331 Ga0495604_0012537
332 Ga0495604_0260171
333 Ga0495674_0045522
334 Ga0495674_0236685
335 Ga0495680_0047726
336 Ga0495675_0005230
337 Ga0495684_0098281
338 Ga0495593_0005062
339 Ga0495602_0111084
340 Ga0496100_0203941
341 Ga0496101_0048033
342 Ga0496103_0085970
343 Ga0496104_0220151
344 Ga0496104_0221333
345 Ga0496105_0105830
346 Ga0496106_0083390
347 Ga0496108_0372119
348 Ga0496111_0074111
349 Ga0496112_0404625
350 Ga0496113_0028827
351 Ga0496114_0410354
352 Ga0496119_0096133
353 Ga0496121_0045635
354 Ga0496124_0156715
355 Ga0496124_0234348
356 Ga0496124_0259055
357 Ga0496125_0034007
358 Ga0496126_0030777
359 Ga0496126_0173822
360 nmdc:mga03n38_181506_c1
361 nmdc:mga0yw44_52439_c1
362 nmdc:mga0yw44_93526_c1
363 nmdc:mga07m45_12307_c1
364 Ga0495601_0021437
365 Ga0495595_0001214
366 Ga0495595_0022097
367 Ga0500566_0019720
368 Ga0500595_001332
369 Ga0500590_022802
370 Ga0500638_000810
371 Ga0500636_0134373
372 Ga0500637_0000716
373 Ga0500645_029786
374 Ga0500661_000675
375 2671118911
376 2728753423
377 2793071296
378 2889040465
379 2904697179
380 2906641753
381 2906667712
382 2908762594
383 2935631977
384 2941507925
385 2941515570
386 2941523855
387 8006943103
388 8006982898

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7udo-assembly1.cif.gz_A crystal structure of designed helical repeat protein rpb_lrp2_r4 (proteolysis fragment?), forming pseudopolymeric filaments 0.8024 36 75
7q3d-assembly1.cif.gz_C structure of the human cplane complex 0.7444 203 239
5lcy-assembly1.cif.gz_C formaldehyde-responsive regulator frmr e64h variant from salmonella enterica serovar typhimurium 0.742 28 81
2f6m-assembly1.cif.gz_A structure of a vps23-c:vps28-n subcomplex 0.7282 248 301
2f6m-assembly2.cif.gz_C structure of a vps23-c:vps28-n subcomplex 0.7282 248 302
ID Description Score Start End Superfamily
af_Q2G1R8_2_85_1.20.58.1000 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Metal-sensitive repressor, helix protomer 0.8934 36 81 1.20.58.1000
af_Q3EBL9_141_209_1.10.287.660 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.8526 248 290 1.10.287.660
af_O07434_7_96_1.20.58.1000 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Metal-sensitive repressor, helix protomer 0.8071 34 81 1.20.58.1000
2cazA00 Special;Helix non-globular;Helix Hairpins; 0.7811 248 295 6.10.140.820
5lcyC00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Metal-sensitive repressor, helix protomer 0.742 28 81 1.20.58.1000
ID Description Score Start End GO Terms
AF-A0A0R3BUF5-F1-model_v4 deleted 0.9906 190 320
AF-A0A1E3EZR1-F1-model_v4 deleted 0.9663 166 320
AF-A0A0R3BUF5-F1-model_v4 deleted 0.9476 190 320
AF-A0A1E3EZR1-F1-model_v4 deleted 0.931 166 320
AF-A0A0C2AJP4-F1-model_v4 deleted 0.9224 34 320

Map