F298992

General Info

Members Datasets Scaffolds Average Seq Length
194 132 388 337

Family's Representative Sequence

Representative Sequence 3300041486|Ga0451807_0542036|Ga0451807_0542036_364_1584
Length 380
Sequence MILAGVVAQRIRARADHQHAALHQVRVASGAAPFPPQPQDMPMRLLPTLLTAACSPDADTATGFAAVGQLTRYDPAFAEVVDAAARIEKLTGDEFTWSEGPTWIADGAYLLFTDVPENRMYRWSQADGLSVFLDPSGYAGPPLATIREGGANGLYAEAAGTVLLADSGNRLVARLDPAKKTRTTLAERFEGKRFNSPNDVVARSDGAVFFTDPPYGLTDGNDSPAKELKTNGVYRIDVNGSVHLLDDSLSSPNGIALSPDGNTLYVSNSDPQRPIWMAYTLDAAGNVTDKRQFADASDLMGEGVQGLPDGLTVSSEGLLFATGPGGVLVLDAAGKRLGRIETGSAIANCAFGDDGRTLYMTSHKFLARVPLKVAGPGFQN

Samples

Sample ID Description Type Environment
1 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
91 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
92 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
93 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
94 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
95 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
96 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
97 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
98 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
99 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
100 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
101 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
102 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
103 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
104 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
105 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
106 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
109 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
110 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
114 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
115 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
116 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
120 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
121 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
122 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
123 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
126 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
129 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
130 2919513703 Luteimonas sp. 3794 Isolate Unclassified
131 2919675420 Luteimonas terrae 4099 Isolate Unclassified
132 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.94
Metatranscriptomes 0
Isolates 2.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.06
Nodule 0
Rhizoplane 4.12
Rhizosphere 87.11
Stem 0
Stem Tuber 0
Unclassified 6.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451807_0542036 3300041486 Bacteria 3675
2 rootL2_10052819 3300003322 Bacteria 2630
3 rootH1_10148537 3300003323 Unclassified 1414
4 Ga0070690_100008784 3300005330 Bacteria 5833
5 Ga0070677_10002635 3300005333 Bacteria 5739
6 Ga0070677_10004394 3300005333 Bacteria 4600
7 Ga0068869_100126997 3300005334 Bacteria 1957
8 Ga0068869_100282714 3300005334 Bacteria 1334
9 Ga0070680_100120264 3300005336 Bacteria 2192
10 Ga0070682_100012301 3300005337 Bacteria 4904
11 Ga0070682_100046343 3300005337 Bacteria 2697
12 Ga0070689_100000019 3300005340 Bacteria 149968
13 Ga0070689_100070129 3300005340 Bacteria 2736
14 Ga0070668_100032141 3300005347 Bacteria 3994
15 Ga0070668_100033652 3300005347 Bacteria 3904
16 Ga0070669_100009130 3300005353 Bacteria 7068
17 Ga0070669_100333943 3300005353 Bacteria 1227
18 Ga0070675_100052622 3300005354 Bacteria 3348
19 Ga0070675_100078505 3300005354 Bacteria 2749
20 Ga0070675_100104001 3300005354 Bacteria 2395
21 Ga0070675_100136692 3300005354 Bacteria 2092
22 Ga0070674_100041193 3300005356 Bacteria 3128
23 Ga0070673_100011904 3300005364 Bacteria 5958
24 Ga0070710_10142074 3300005437 Bacteria 1473
25 Ga0070705_100011663 3300005440 Bacteria 4442
26 Ga0070700_100230533 3300005441 Bacteria 1318
27 Ga0070694_100046197 3300005444 Bacteria 2922
28 Ga0070678_100140535 3300005456 Bacteria 1932
29 Ga0070662_100000818 3300005457 Bacteria 19179
30 Ga0070681_10144059 3300005458 Bacteria 2312
31 Ga0068867_100160408 3300005459 Bacteria 1773
32 Ga0070685_10075855 3300005466 Bacteria 2004
33 Ga0070685_10127024 3300005466 Bacteria 1590
34 Ga0070679_100126711 3300005530 Bacteria 2536
35 Ga0070672_100036903 3300005543 Bacteria 3727
36 Ga0070672_100038335 3300005543 Bacteria 3661
37 Ga0070686_100010420 3300005544 Bacteria 5241
38 Ga0070665_100446825 3300005548 Bacteria 1302
39 Ga0070664_100030943 3300005564 Bacteria 4468
40 Ga0068857_100184276 3300005577 Bacteria 1900
41 Ga0070702_100134060 3300005615 Bacteria 1568
42 Ga0068859_100050940 3300005617 Bacteria 4161
43 Ga0068859_100071115 3300005617 Bacteria 3515
44 Ga0068861_100000294 3300005719 Bacteria 27986
45 Ga0068861_100010485 3300005719 Bacteria 6432
46 Ga0068861_100016454 3300005719 Bacteria 5234
47 Ga0068870_10001223 3300005840 Bacteria 10330
48 Ga0068870_10019931 3300005840 Bacteria 3258
49 Ga0068863_100042965 3300005841 Bacteria 4293
50 Ga0068863_100092280 3300005841 Bacteria 2873
51 Ga0068863_100094273 3300005841 Bacteria 2841
52 Ga0068863_100360287 3300005841 Unclassified 1417
53 Ga0068858_100079466 3300005842 Bacteria 3048
54 Ga0068862_100000378 3300005844 Bacteria 48343
55 Ga0068862_100045022 3300005844 Bacteria 3764
56 Ga0068862_100202899 3300005844 Unclassified 1789
57 Ga0081455_10006925 3300005937 Bacteria 12058
58 Ga0075364_10018862 3300006051 Bacteria 4326
59 Ga0097621_100101630 3300006237 Bacteria 2419
60 Ga0097621_100309747 3300006237 Unclassified 1396
61 Ga0068871_100089199 3300006358 Bacteria 2566
62 Ga0068871_100237685 3300006358 Bacteria 1583
63 Ga0068871_100239613 3300006358 Bacteria 1576
64 Ga0068871_100337781 3300006358 Unclassified 1329
65 Ga0075428_100050641 3300006844 Bacteria 4554
66 Ga0075428_100075605 3300006844 Bacteria 3678
67 Ga0075431_100369753 3300006847 Bacteria 1439
68 Ga0068865_100011968 3300006881 Bacteria 5449
69 Ga0097620_100050942 3300006931 Bacteria 4161
70 Ga0097620_100071113 3300006931 Bacteria 3515
71 Ga0111539_10175222 3300009094 Bacteria 2505
72 Ga0111539_10178556 3300009094 Bacteria 2480
73 Ga0111539_10315711 3300009094 Bacteria 1819
74 Ga0114129_10183183 3300009147 Bacteria 2848
75 Ga0105242_10208375 3300009176 Unclassified 1740
76 Ga0105249_10218356 3300009553 Unclassified 1875
77 Ga0163163_10049353 3300014325 Bacteria 4141
78 Ga0157380_10036404 3300014326 Bacteria 3807
79 Ga0157380_10122030 3300014326 Bacteria 2209
80 Ga0157379_10382671 3300014968 Bacteria 1291
81 Ga0157376_10063009 3300014969 Bacteria 3122
82 Ga0163161_10220448 3300017792 Bacteria 1469
83 Ga0207682_10002967 3300025893 Bacteria 7446
84 Ga0207682_10003471 3300025893 Bacteria 6833
85 Ga0207692_10119277 3300025898 Bacteria 1475
86 Ga0207645_10050538 3300025907 Bacteria 2655
87 Ga0207645_10070073 3300025907 Bacteria 2243
88 Ga0207643_10006182 3300025908 Bacteria 6408
89 Ga0207643_10060051 3300025908 Bacteria 2170
90 Ga0207707_10043876 3300025912 Bacteria 3899
91 Ga0207681_10069214 3300025923 Bacteria 2454
92 Ga0207706_10001531 3300025933 Bacteria 22948
93 Ga0207706_10296278 3300025933 Bacteria 1410
94 Ga0207670_10000013 3300025936 Bacteria 211834
95 Ga0207670_10237366 3300025936 Bacteria 1403
96 Ga0207670_10251266 3300025936 Unclassified 1367
97 Ga0207669_10031732 3300025937 Bacteria 2956
98 Ga0207669_10114998 3300025937 Bacteria 1812
99 Ga0207691_10002796 3300025940 Bacteria 17020
100 Ga0207691_10008395 3300025940 Bacteria 9925
101 Ga0207691_10078649 3300025940 Bacteria 2969
102 Ga0207689_10082428 3300025942 Bacteria 2644
103 Ga0207689_10087326 3300025942 Bacteria 2562
104 Ga0207689_10284380 3300025942 Bacteria 1369
105 Ga0207712_10009337 3300025961 Bacteria 6205
106 Ga0207668_10013011 3300025972 Bacteria 5113
107 Ga0207668_10022589 3300025972 Bacteria 4030
108 Ga0207668_10032981 3300025972 Bacteria 3428
109 Ga0207658_10319755 3300025986 Bacteria 1343
110 Ga0207678_10194869 3300026067 Bacteria 1732
111 Ga0207678_10202900 3300026067 Bacteria 1696
112 Ga0207708_10005774 3300026075 Bacteria 9148
113 Ga0207708_10051061 3300026075 Bacteria 3148
114 Ga0207708_10282106 3300026075 Bacteria 1346
115 Ga0207641_10018211 3300026088 Bacteria 5757
116 Ga0207674_10146595 3300026116 Bacteria 2319
117 Ga0207674_10181947 3300026116 Bacteria 2053
118 Ga0207675_100000344 3300026118 Bacteria 44314
119 Ga0207675_100005554 3300026118 Bacteria 12068
120 Ga0207675_100017826 3300026118 Bacteria 6625
121 Ga0207675_100301016 3300026118 Bacteria 1562
122 Ga0207683_10011668 3300026121 Bacteria 7500
123 Ga0207683_10024907 3300026121 Bacteria 5157
124 Ga0207428_10259918 3300027907 Bacteria 1293
125 Ga0268266_10131844 3300028379 Bacteria 2236
126 Ga0268265_10000790 3300028380 Bacteria 30194
127 Ga0307513_10005109 3300031456 Bacteria 17369
128 Ga0307513_10051296 3300031456 Bacteria 4452
129 Ga0307509_10022680 3300031507 Bacteria 7071
130 Ga0307408_100077710 3300031548 Bacteria 2472
131 Ga0307413_10036912 3300031824 Bacteria 2818
132 Ga0307413_10080879 3300031824 Bacteria 2081
133 Ga0307410_10002380 3300031852 Bacteria 9069
134 Ga0307410_10021023 3300031852 Bacteria 4006
135 Ga0307406_10055727 3300031901 Bacteria 2528
136 Ga0307407_10011202 3300031903 Bacteria 4257
137 Ga0307407_10080708 3300031903 Bacteria 1966
138 Ga0307412_10105263 3300031911 Bacteria 2004
139 Ga0307409_100003665 3300031995 Bacteria 8408
140 Ga0307409_100178704 3300031995 Bacteria 1876
141 Ga0307416_100054417 3300032002 Bacteria 3217
142 Ga0307414_10002438 3300032004 Bacteria 9725
143 Ga0307414_10220736 3300032004 Unclassified 1556
144 Ga0307411_10039693 3300032005 Bacteria 2979
145 Ga0307415_100039304 3300032126 Bacteria 3126
146 Ga0373950_0000003 3300034818 Bacteria 541085
147 Ga0373954_0061934 3300035118 Bacteria 1767
148 Ga0400483_277180 3300039062 Unclassified 1613
149 Ga0451791_0586226 3300041451 Unclassified 1381
150 Ga0451797_1332563 3300041453 Bacteria 1524
151 Ga0451795_1713492 3300041456 Bacteria 2476
152 Ga0451802_0922970 3300041460 Bacteria 2907
153 Ga0451807_1413778 3300041486 Bacteria 2237
154 Ga0451807_2607721 3300041486 Bacteria 3505
155 Ga0451837_0452642 3300041494 Bacteria 3232
156 Ga0451853_0292669 3300041512 Bacteria 1930
157 Ga0439448_0037926 3300042005 Bacteria 1550
158 Ga0495590_0005962 3300046457 Bacteria 4776
159 Ga0495638_0011112 3300046460 Bacteria 6220
160 Ga0495632_0027280 3300046519 Bacteria 2993
161 Ga0495632_0069949 3300046519 Bacteria 1689
162 Ga0495656_0110047 3300046615 Bacteria 1287
163 Ga0495668_0017988 3300046616 Bacteria 4092
164 Ga0495625_0013468 3300046660 Bacteria 6571
165 Ga0495649_0001447 3300046694 Bacteria 17893
166 Ga0495649_0039955 3300046694 Bacteria 2571
167 Ga0496114_0083733 3300048917 Unclassified 2699
168 Ga0496122_0019214 3300048925 Bacteria 6254
169 Ga0496123_0012477 3300048926 Bacteria 7242
170 Ga0495678_055003 3300049459 Bacteria 1521
171 Ga0501038_0223161 3300049574 Bacteria 1503
172 Ga0501039_0090415 3300049575 Bacteria 2386
173 Ga0501067_0000369 3300049583 Bacteria 24624
174 Ga0501067_0057183 3300049583 Bacteria 2160
175 Ga0501068_0001490 3300049584 Bacteria 12461
176 Ga0501070_0035801 3300049586 Bacteria 4146
177 Ga0501071_0012334 3300049587 Bacteria 5795
178 Ga0501073_0005490 3300049589 Bacteria 9499
179 Ga0501074_0004546 3300049590 Bacteria 9930
180 Ga0501075_0044553 3300049591 Bacteria 3329
181 Ga0501076_0012431 3300049592 Bacteria 6363
182 Ga0501077_0040820 3300049593 Bacteria 2954
183 Ga0501245_021668 3300049708 Unclassified 1010
184 Ga0501079_0106042 3300049741 Bacteria 2180
185 Ga0501080_0032790 3300049742 Bacteria 4845
186 Ga0501083_0029092 3300049744 Bacteria 3804
187 nmdc:mga00v17_105680_c1 3300050491 Bacteria 1782
188 nmdc:mga00v17_38752_c1 3300050491 Bacteria 2851
189 nmdc:mga08y16_62681_c1 3300050511 Bacteria 3883
190 Ga0500637_0002574 3300053178 Bacteria 8104
191 2894416934 2894414249 Bacteria 4405451
192 2919516586 2919513703 Bacteria 3844312
193 2919675662 2919675420 Bacteria 3969095
194 8002870010 8002869464 Bacteria 3588529
195 Ga0451807_0542036
196 rootL2_10052819
197 rootH1_10148537
198 Ga0070690_100008784
199 Ga0070677_10002635
200 Ga0070677_10004394
201 Ga0068869_100126997
202 Ga0068869_100282714
203 Ga0070680_100120264
204 Ga0070682_100012301
205 Ga0070682_100046343
206 Ga0070689_100000019
207 Ga0070689_100070129
208 Ga0070668_100032141
209 Ga0070668_100033652
210 Ga0070669_100009130
211 Ga0070669_100333943
212 Ga0070675_100052622
213 Ga0070675_100078505
214 Ga0070675_100104001
215 Ga0070675_100136692
216 Ga0070674_100041193
217 Ga0070673_100011904
218 Ga0070710_10142074
219 Ga0070705_100011663
220 Ga0070700_100230533
221 Ga0070694_100046197
222 Ga0070678_100140535
223 Ga0070662_100000818
224 Ga0070681_10144059
225 Ga0068867_100160408
226 Ga0070685_10075855
227 Ga0070685_10127024
228 Ga0070679_100126711
229 Ga0070672_100036903
230 Ga0070672_100038335
231 Ga0070686_100010420
232 Ga0070665_100446825
233 Ga0070664_100030943
234 Ga0068857_100184276
235 Ga0070702_100134060
236 Ga0068859_100050940
237 Ga0068859_100071115
238 Ga0068861_100000294
239 Ga0068861_100010485
240 Ga0068861_100016454
241 Ga0068870_10001223
242 Ga0068870_10019931
243 Ga0068863_100042965
244 Ga0068863_100092280
245 Ga0068863_100094273
246 Ga0068863_100360287
247 Ga0068858_100079466
248 Ga0068862_100000378
249 Ga0068862_100045022
250 Ga0068862_100202899
251 Ga0081455_10006925
252 Ga0075364_10018862
253 Ga0097621_100101630
254 Ga0097621_100309747
255 Ga0068871_100089199
256 Ga0068871_100237685
257 Ga0068871_100239613
258 Ga0068871_100337781
259 Ga0075428_100050641
260 Ga0075428_100075605
261 Ga0075431_100369753
262 Ga0068865_100011968
263 Ga0097620_100050942
264 Ga0097620_100071113
265 Ga0111539_10175222
266 Ga0111539_10178556
267 Ga0111539_10315711
268 Ga0114129_10183183
269 Ga0105242_10208375
270 Ga0105249_10218356
271 Ga0163163_10049353
272 Ga0157380_10036404
273 Ga0157380_10122030
274 Ga0157379_10382671
275 Ga0157376_10063009
276 Ga0163161_10220448
277 Ga0207682_10002967
278 Ga0207682_10003471
279 Ga0207692_10119277
280 Ga0207645_10050538
281 Ga0207645_10070073
282 Ga0207643_10006182
283 Ga0207643_10060051
284 Ga0207707_10043876
285 Ga0207681_10069214
286 Ga0207706_10001531
287 Ga0207706_10296278
288 Ga0207670_10000013
289 Ga0207670_10237366
290 Ga0207670_10251266
291 Ga0207669_10031732
292 Ga0207669_10114998
293 Ga0207691_10002796
294 Ga0207691_10008395
295 Ga0207691_10078649
296 Ga0207689_10082428
297 Ga0207689_10087326
298 Ga0207689_10284380
299 Ga0207712_10009337
300 Ga0207668_10013011
301 Ga0207668_10022589
302 Ga0207668_10032981
303 Ga0207658_10319755
304 Ga0207678_10194869
305 Ga0207678_10202900
306 Ga0207708_10005774
307 Ga0207708_10051061
308 Ga0207708_10282106
309 Ga0207641_10018211
310 Ga0207674_10146595
311 Ga0207674_10181947
312 Ga0207675_100000344
313 Ga0207675_100005554
314 Ga0207675_100017826
315 Ga0207675_100301016
316 Ga0207683_10011668
317 Ga0207683_10024907
318 Ga0207428_10259918
319 Ga0268266_10131844
320 Ga0268265_10000790
321 Ga0307513_10005109
322 Ga0307513_10051296
323 Ga0307509_10022680
324 Ga0307408_100077710
325 Ga0307413_10036912
326 Ga0307413_10080879
327 Ga0307410_10002380
328 Ga0307410_10021023
329 Ga0307406_10055727
330 Ga0307407_10011202
331 Ga0307407_10080708
332 Ga0307412_10105263
333 Ga0307409_100003665
334 Ga0307409_100178704
335 Ga0307416_100054417
336 Ga0307414_10002438
337 Ga0307414_10220736
338 Ga0307411_10039693
339 Ga0307415_100039304
340 Ga0373950_0000003
341 Ga0373954_0061934
342 Ga0400483_277180
343 Ga0451791_0586226
344 Ga0451797_1332563
345 Ga0451795_1713492
346 Ga0451802_0922970
347 Ga0451807_1413778
348 Ga0451807_2607721
349 Ga0451837_0452642
350 Ga0451853_0292669
351 Ga0439448_0037926
352 Ga0495590_0005962
353 Ga0495638_0011112
354 Ga0495632_0027280
355 Ga0495632_0069949
356 Ga0495656_0110047
357 Ga0495668_0017988
358 Ga0495625_0013468
359 Ga0495649_0001447
360 Ga0495649_0039955
361 Ga0496114_0083733
362 Ga0496122_0019214
363 Ga0496123_0012477
364 Ga0495678_055003
365 Ga0501038_0223161
366 Ga0501039_0090415
367 Ga0501067_0000369
368 Ga0501067_0057183
369 Ga0501068_0001490
370 Ga0501070_0035801
371 Ga0501071_0012334
372 Ga0501073_0005490
373 Ga0501074_0004546
374 Ga0501075_0044553
375 Ga0501076_0012431
376 Ga0501077_0040820
377 Ga0501245_021668
378 Ga0501079_0106042
379 Ga0501080_0032790
380 Ga0501083_0029092
381 nmdc:mga00v17_105680_c1
382 nmdc:mga00v17_38752_c1
383 nmdc:mga08y16_62681_c1
384 Ga0500637_0002574
385 2894416934
386 2919516586
387 2919675662
388 8002870010

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08450

SGL

SMP-30/Gluconolactonase/LRE-like region

97

364

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dr2-assembly1.cif.gz_B structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.9102 24 335
3e5z-assembly2.cif.gz_B x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. 0.9052 34 342
3dr2-assembly1.cif.gz_A structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.9049 24 335
3e5z-assembly2.cif.gz_B x-ray structure of the putative gluconolactonase in protein family pf08450. northeast structural genomics consortium target drr130. 0.9022 34 342
3dr2-assembly1.cif.gz_B structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways 0.8896 24 335
ID Description Score Start End Superfamily
3dr2A00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9049 24 335 2.120.10.30
3e5zB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.9022 34 342 2.120.10.30
3e5zB00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8992 34 342 2.120.10.30
3dr2A00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8817 24 335 2.120.10.30
af_Q54ZP3_33_320_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.8164 52 339 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A4Q6GV13-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9881 82 342 GO:0016787
AF-A0A839WWH7-F1-model_v4 Gluconolactonase (EC 3.1.1.17) 0.9866 34 341 GO:0016787
GO:0046872
AF-A0A4V2BIK5-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.9866 162 342 GO:0016787
AF-A0A1T5K8W0-F1-model_v4 Gluconolactonase 0.9847 35 341 GO:0016787
GO:0046872
AF-A0A069J0L6-F1-model_v4 Gluconolactonase 0.982 36 339 GO:0016787
GO:0046872

Map