F299044
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 194 | 160 | 177 | 349 |
Family's Representative Sequence
| Representative Sequence | 3300044712|Ga0453684_0001900|Ga0453684_0001900_26899_27999 |
| Length | 366 |
| Sequence | MNDTSETTSAKTGMEIGVITLGEFLNDPQSGQKVSAQQRIQEIVQAAQLADEAGLDAFGVGEHHSLDFVVSAVPVVLAAIAPLTKRIRLTSAVTVLSTADPVREFENYATLDLLSAGRAEMIVGRGAFVESFPLFGYDVNDYDRLFPEKLDLLLKLNSSERVTWQGRLRSPLNNAEIAPRPLQAELPIWVGVGGTRQSVVRAGTLGLPMMVGIIGGASAQFAPLMELYRRTGMEAKHAPTQLKTGVTSYLHIEKISQEAIDEFYPYHTHYFEQLGRSRGRMIQLSRSDYEQNASLHGAYFVGSPQQIIDKLLYQHEIFGHQRFMAQIDIGGLPYKKVAQTIELLATEVVPVIRRETAGHVNVSQKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 2 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 3 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 4 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 5 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 6 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 7 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 8 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 9 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 10 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 11 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 12 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 13 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 14 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 15 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 16 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 17 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 57 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 58 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 115 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 116 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 117 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 118 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 119 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 120 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 121 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 122 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 123 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 124 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 136 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 137 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 138 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 139 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 140 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 141 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 142 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 143 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 144 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 145 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 146 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 147 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 148 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 149 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 154 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 155 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 156 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 157 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 158 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 159 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 160 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.72 |
| Metatranscriptomes | 0.52 |
| Isolates | 8.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.25 |
| Nodule | 3.61 |
| Rhizoplane | 7.22 |
| Rhizosphere | 75.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1000836 | 3300002773 | Bacteria | 15283 |
| 2 | JGI25150J39212_1002942 | 3300002774 | Bacteria | 4109 |
| 3 | JGI25160J50197_1000557 | 3300003354 | Bacteria | 21129 |
| 4 | Ga0065714_10009248 | 3300005288 | Bacteria | 2986 |
| 5 | Ga0065715_10095973 | 3300005293 | Bacteria | 3970 |
| 6 | Ga0065715_10200266 | 3300005293 | Bacteria | 1365 |
| 7 | Ga0070683_100039521 | 3300005329 | Bacteria | 4331 |
| 8 | Ga0070677_10058963 | 3300005333 | Bacteria | 1578 |
| 9 | Ga0070689_100128630 | 3300005340 | Unclassified | 2029 |
| 10 | Ga0070687_100115354 | 3300005343 | Unclassified | 1527 |
| 11 | Ga0070661_100000391 | 3300005344 | Bacteria | 34135 |
| 12 | Ga0070669_100077842 | 3300005353 | Bacteria | 2464 |
| 13 | Ga0070675_100072617 | 3300005354 | Bacteria | 2857 |
| 14 | Ga0070688_100048835 | 3300005365 | Bacteria | 2631 |
| 15 | Ga0070659_100009665 | 3300005366 | Bacteria | 7088 |
| 16 | Ga0070659_100148719 | 3300005366 | Unclassified | 1910 |
| 17 | Ga0070667_100394138 | 3300005367 | Bacteria | 1259 |
| 18 | Ga0070709_10119220 | 3300005434 | Bacteria | 1786 |
| 19 | Ga0070714_100074880 | 3300005435 | Bacteria | 2936 |
| 20 | Ga0070713_100080320 | 3300005436 | Bacteria | 2780 |
| 21 | Ga0070711_100098546 | 3300005439 | Bacteria | 2122 |
| 22 | Ga0070705_100005481 | 3300005440 | Bacteria | 6186 |
| 23 | Ga0070694_100110157 | 3300005444 | Bacteria | 1961 |
| 24 | Ga0070708_100027521 | 3300005445 | Bacteria | 4879 |
| 25 | Ga0070685_10073402 | 3300005466 | Bacteria | 2033 |
| 26 | Ga0070706_100038392 | 3300005467 | Bacteria | 4419 |
| 27 | Ga0070707_100393711 | 3300005468 | Bacteria | 1345 |
| 28 | Ga0070698_100054195 | 3300005471 | Bacteria | 4073 |
| 29 | Ga0070698_100097588 | 3300005471 | Bacteria | 2914 |
| 30 | Ga0070684_100031721 | 3300005535 | Bacteria | 4500 |
| 31 | Ga0070684_100367897 | 3300005535 | Unclassified | 1323 |
| 32 | Ga0070697_100125881 | 3300005536 | Bacteria | 2146 |
| 33 | Ga0070697_100298631 | 3300005536 | Bacteria | 1384 |
| 34 | Ga0070695_100130675 | 3300005545 | Unclassified | 1730 |
| 35 | Ga0070704_100050645 | 3300005549 | Bacteria | 2920 |
| 36 | Ga0068856_100034744 | 3300005614 | Bacteria | 4939 |
| 37 | Ga0070702_100011108 | 3300005615 | Unclassified | 4468 |
| 38 | Ga0068859_100144696 | 3300005617 | Unclassified | 2451 |
| 39 | Ga0068863_100025843 | 3300005841 | Bacteria | 5602 |
| 40 | Ga0068863_100133094 | 3300005841 | Bacteria | 2374 |
| 41 | Ga0068863_100212711 | 3300005841 | Bacteria | 1862 |
| 42 | Ga0068858_100135282 | 3300005842 | Unclassified | 2312 |
| 43 | Ga0068858_100196601 | 3300005842 | Bacteria | 1906 |
| 44 | Ga0068860_100118610 | 3300005843 | Bacteria | 2533 |
| 45 | Ga0068862_100180960 | 3300005844 | Unclassified | 1892 |
| 46 | Ga0070717_10111075 | 3300006028 | Bacteria | 2338 |
| 47 | Ga0070715_10019337 | 3300006163 | Unclassified | 2611 |
| 48 | Ga0070716_100076714 | 3300006173 | Bacteria | 1981 |
| 49 | Ga0070716_100277592 | 3300006173 | Bacteria | 1155 |
| 50 | Ga0070712_100129907 | 3300006175 | Unclassified | 1908 |
| 51 | Ga0075433_10006249 | 3300006852 | Bacteria | 9401 |
| 52 | Ga0075434_100252986 | 3300006871 | Archaea | 1781 |
| 53 | Ga0075434_100340482 | 3300006871 | Bacteria | 1521 |
| 54 | Ga0075436_100014154 | 3300006914 | Bacteria | 5460 |
| 55 | Ga0097620_100144696 | 3300006931 | Unclassified | 2451 |
| 56 | Ga0105240_10292196 | 3300009093 | Bacteria | 1868 |
| 57 | Ga0105247_10040622 | 3300009101 | Bacteria | 2844 |
| 58 | Ga0114129_10051571 | 3300009147 | Archaea | 5776 |
| 59 | Ga0105242_10041893 | 3300009176 | Unclassified | 3695 |
| 60 | Ga0105242_10414181 | 3300009176 | Bacteria | 1261 |
| 61 | Ga0105248_10092584 | 3300009177 | Bacteria | 3404 |
| 62 | Ga0105248_10221694 | 3300009177 | Unclassified | 2129 |
| 63 | Ga0105237_10001986 | 3300009545 | Bacteria | 26023 |
| 64 | Ga0105237_10192392 | 3300009545 | Unclassified | 2040 |
| 65 | Ga0105249_10095039 | 3300009553 | Unclassified | 2794 |
| 66 | Ga0157373_10026204 | 3300013100 | Unclassified | 4213 |
| 67 | Ga0157374_10054354 | 3300013296 | Bacteria | 3735 |
| 68 | Ga0157374_10099024 | 3300013296 | Bacteria | 2792 |
| 69 | Ga0157378_10013341 | 3300013297 | Bacteria | 7182 |
| 70 | Ga0163162_10023990 | 3300013306 | Bacteria | 6020 |
| 71 | Ga0157372_10053278 | 3300013307 | Bacteria | 4509 |
| 72 | Ga0157375_10018379 | 3300013308 | Bacteria | 6339 |
| 73 | Ga0163163_10009985 | 3300014325 | Bacteria | 8511 |
| 74 | Ga0157377_10085175 | 3300014745 | Bacteria | 1855 |
| 75 | Ga0206350_11096870 | 3300020080 | Archaea | 1125 |
| 76 | Ga0207425_1000415 | 3300025245 | Bacteria | 28739 |
| 77 | Ga0209129_1000337 | 3300025258 | Bacteria | 40559 |
| 78 | Ga0209564_1011664 | 3300025295 | Bacteria | 3912 |
| 79 | Ga0209758_1000195 | 3300025297 | Bacteria | 133982 |
| 80 | Ga0209758_1003265 | 3300025297 | Bacteria | 15035 |
| 81 | Ga0209256_1006097 | 3300025299 | Bacteria | 6546 |
| 82 | Ga0207426_1000893 | 3300025302 | Bacteria | 30173 |
| 83 | Ga0209051_1020151 | 3300025303 | Bacteria | 2884 |
| 84 | Ga0207697_10024624 | 3300025315 | Bacteria | 2464 |
| 85 | Ga0207692_10065260 | 3300025898 | Unclassified | 1898 |
| 86 | Ga0207647_10029082 | 3300025904 | Bacteria | 3581 |
| 87 | Ga0207685_10023105 | 3300025905 | Unclassified | 2112 |
| 88 | Ga0207684_10004947 | 3300025910 | Bacteria | 12435 |
| 89 | Ga0207684_10038536 | 3300025910 | Bacteria | 4055 |
| 90 | Ga0207671_10001381 | 3300025914 | Bacteria | 28250 |
| 91 | Ga0207671_10250818 | 3300025914 | Unclassified | 1391 |
| 92 | Ga0207693_10095563 | 3300025915 | Bacteria | 2330 |
| 93 | Ga0207693_10140233 | 3300025915 | Bacteria | 1901 |
| 94 | Ga0207663_10011581 | 3300025916 | Unclassified | 4741 |
| 95 | Ga0207663_10105923 | 3300025916 | Unclassified | 1899 |
| 96 | Ga0207662_10041986 | 3300025918 | Unclassified | 2694 |
| 97 | Ga0207649_10000307 | 3300025920 | Bacteria | 37507 |
| 98 | Ga0207646_10017554 | 3300025922 | Bacteria | 6692 |
| 99 | Ga0207646_10045408 | 3300025922 | Bacteria | 3944 |
| 100 | Ga0207659_10055871 | 3300025926 | Bacteria | 2825 |
| 101 | Ga0207700_10138938 | 3300025928 | Unclassified | 1994 |
| 102 | Ga0207664_10086255 | 3300025929 | Bacteria | 2564 |
| 103 | Ga0207690_10099157 | 3300025932 | Bacteria | 2077 |
| 104 | Ga0207670_10016908 | 3300025936 | Bacteria | 4397 |
| 105 | Ga0207665_10090635 | 3300025939 | Bacteria | 2119 |
| 106 | Ga0207665_10127530 | 3300025939 | Bacteria | 1803 |
| 107 | Ga0207665_10188177 | 3300025939 | Bacteria | 1498 |
| 108 | Ga0207691_10062745 | 3300025940 | Bacteria | 3371 |
| 109 | Ga0207711_10072736 | 3300025941 | Bacteria | 2987 |
| 110 | Ga0207711_10122734 | 3300025941 | Unclassified | 2321 |
| 111 | Ga0207651_10175943 | 3300025960 | Bacteria | 1693 |
| 112 | Ga0207712_10222790 | 3300025961 | Unclassified | 1509 |
| 113 | Ga0207668_10241286 | 3300025972 | Bacteria | 1462 |
| 114 | Ga0207703_10011295 | 3300026035 | Bacteria | 6944 |
| 115 | Ga0207703_10071655 | 3300026035 | Bacteria | 2863 |
| 116 | Ga0207678_10022711 | 3300026067 | Bacteria | 5494 |
| 117 | Ga0207708_10303722 | 3300026075 | Bacteria | 1299 |
| 118 | Ga0207702_10262952 | 3300026078 | Bacteria | 1625 |
| 119 | Ga0207641_10032474 | 3300026088 | Bacteria | 4333 |
| 120 | Ga0207648_10283710 | 3300026089 | Unclassified | 1481 |
| 121 | Ga0207676_10228817 | 3300026095 | Bacteria | 1661 |
| 122 | Ga0207683_10095236 | 3300026121 | Bacteria | 2654 |
| 123 | Ga0268264_10070590 | 3300028381 | Bacteria | 2957 |
| 124 | Ga0268264_10080510 | 3300028381 | Bacteria | 2781 |
| 125 | Ga0268264_10240844 | 3300028381 | Bacteria | 1675 |
| 126 | Ga0265327_10000087 | 3300031251 | Bacteria | 198174 |
| 127 | Ga0265327_10000114 | 3300031251 | Bacteria | 174833 |
| 128 | Ga0307509_10012465 | 3300031507 | Bacteria | 10167 |
| 129 | Ga0307509_10126932 | 3300031507 | Bacteria | 2515 |
| 130 | Ga0265314_10077655 | 3300031711 | Bacteria | 2202 |
| 131 | Ga0307410_10286725 | 3300031852 | Bacteria | 1294 |
| 132 | Ga0451807_0422351 | 3300041486 | Unclassified | 1875 |
| 133 | Ga0451847_0562736 | 3300041503 | Bacteria | 1706 |
| 134 | Ga0451853_1554842 | 3300041512 | Bacteria | 10570 |
| 135 | Ga0439432_025573 | 3300042006 | Unclassified | 1936 |
| 136 | Ga0453684_0001900 | 3300044712 | Bacteria | 54239 |
| 137 | Ga0466967_0020733 | 3300045976 | Bacteria | 5321 |
| 138 | Ga0495650_0080762 | 3300046471 | Bacteria | 1254 |
| 139 | Ga0495607_0099242 | 3300046501 | Bacteria | 1562 |
| 140 | Ga0495620_0011102 | 3300046515 | Bacteria | 4716 |
| 141 | Ga0495632_0010869 | 3300046519 | Bacteria | 5354 |
| 142 | Ga0495654_0027151 | 3300046530 | Bacteria | 2938 |
| 143 | Ga0495597_0014861 | 3300046542 | Bacteria | 3701 |
| 144 | Ga0495645_0204922 | 3300046543 | Unclassified | 1335 |
| 145 | Ga0495668_0006580 | 3300046616 | Bacteria | 7583 |
| 146 | Ga0495668_0044538 | 3300046616 | Bacteria | 2466 |
| 147 | Ga0495625_0027269 | 3300046660 | Bacteria | 4303 |
| 148 | Ga0495683_0056583 | 3300047323 | Bacteria | 1951 |
| 149 | Ga0495687_084529 | 3300047443 | Bacteria | 1233 |
| 150 | Ga0496100_0078674 | 3300048903 | Bacteria | 2220 |
| 151 | Ga0496101_0220170 | 3300048904 | Unclassified | 1473 |
| 152 | Ga0496101_0288879 | 3300048904 | Bacteria | 1283 |
| 153 | Ga0496102_0107116 | 3300048905 | Bacteria | 2602 |
| 154 | Ga0496106_0075541 | 3300048909 | Bacteria | 2581 |
| 155 | Ga0496108_0012367 | 3300048911 | Bacteria | 6945 |
| 156 | Ga0496109_0077982 | 3300048912 | Bacteria | 3049 |
| 157 | Ga0496110_0117472 | 3300048913 | Unclassified | 2395 |
| 158 | Ga0496112_0075321 | 3300048915 | Bacteria | 3338 |
| 159 | Ga0496112_0318612 | 3300048915 | Bacteria | 1499 |
| 160 | Ga0496113_0071636 | 3300048916 | Bacteria | 2636 |
| 161 | Ga0496115_0142807 | 3300048918 | Bacteria | 1975 |
| 162 | Ga0496125_0037583 | 3300048928 | Bacteria | 4207 |
| 163 | Ga0496126_0037323 | 3300048929 | Bacteria | 4536 |
| 164 | Ga0501039_0108910 | 3300049575 | Archaea | 2165 |
| 165 | Ga0501243_000202 | 3300049675 | Bacteria | 7244 |
| 166 | nmdc:mga05p37_78908_c1 | 3300050507 | Archaea | 4054 |
| 167 | nmdc:mga0n895_117904_c1 | 3300050512 | Archaea | 2674 |
| 168 | nmdc:mga0n895_195410_c1 | 3300050512 | Bacteria | 2054 |
| 169 | nmdc:mga0n895_408673_c1 | 3300050512 | Bacteria | 1373 |
| 170 | nmdc:mga08x19_26823_c1 | 3300050514 | Bacteria | 3598 |
| 171 | nmdc:mga0a205_18615_c1 | 3300050515 | Bacteria | 6533 |
| 172 | nmdc:mga0a205_49153_c1 | 3300050515 | Archaea | 4070 |
| 173 | Ga0500641_0066576 | 3300053096 | Bacteria | 1509 |
| 174 | Ga0500569_010193 | 3300053109 | Bacteria | 2205 |
| 175 | Ga0500658_0003072 | 3300053134 | Bacteria | 6382 |
| 176 | Ga0500616_0025821 | 3300053153 | Bacteria | 3257 |
| 177 | Ga0500622_0001007 | 3300053156 | Bacteria | 23773 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006871 | Ga0075434_100252986 | Ga0075434_1002529861 | 302 |
| 2 | 3300020080 | Ga0206350_11096870 | Ga0206350_110968701 | 305 |
| 3 | 3300050515 | nmdc:mga0a205_18615_c1 | nmdc:mga0a205_18615_c1_5331_6290 | 308 |
| 4 | 3300026075 | Ga0207708_10303722 | Ga0207708_103037221 | 317 |
| 5 | 3300026095 | Ga0207676_10228817 | Ga0207676_102288172 | 318 |
| 6 | 3300005333 | Ga0070677_10058963 | Ga0070677_100589632 | 320 |
| 7 | 3300025940 | Ga0207691_10062745 | Ga0207691_100627452 | 320 |
| 8 | 3300025960 | Ga0207651_10175943 | Ga0207651_101759432 | 320 |
| 9 | 3300025972 | Ga0207668_10241286 | Ga0207668_102412861 | 320 |
| 10 | 3300028381 | Ga0268264_10240844 | Ga0268264_102408442 | 320 |
| 11 | 3300048929 | Ga0496126_0037323 | Ga0496126_0037323_1905_2942 | 322 |
| 12 | 3300005844 | Ga0068862_100180960 | Ga0068862_1001809601 | 326 |
| 13 | 3300041486 | Ga0451807_0422351 | Ga0451807_0422351_547_1542 | 329 |
| 14 | 3300045976 | Ga0466967_0020733 | Ga0466967_0020733_1953_2999 | 329 |
| 15 | 3300013100 | Ga0157373_10026204 | Ga0157373_100262044 | 330 |
| 16 | 3300031711 | Ga0265314_10077655 | Ga0265314_100776552 | 330 |
| 17 | 3300053156 | Ga0500622_0001007 | Ga0500622_0001007_386_1396 | 330 |
| 18 | 3300005440 | Ga0070705_100005481 | Ga0070705_1000054813 | 333 |
| 19 | 3300006852 | Ga0075433_10006249 | Ga0075433_100062495 | 333 |
| 20 | 3300049675 | Ga0501243_000202 | Ga0501243_000202_4012_5052 | 333 |
| 21 | iso_pu_bacteria | 2799112218 | 2799183078 | 333 |
| 22 | 3300031251 | Ga0265327_10000114 | Ga0265327_10000114113 | 334 |
| 23 | 3300006914 | Ga0075436_100014154 | Ga0075436_1000141544 | 335 |
| 24 | 3300013296 | Ga0157374_10054354 | Ga0157374_100543542 | 335 |
| 25 | 3300046543 | Ga0495645_0204922 | Ga0495645_0204922_189_1265 | 335 |
| 26 | 3300050514 | nmdc:mga08x19_26823_c1 | nmdc:mga08x19_26823_c1_669_1706 | 335 |
| 27 | iso_pu_bacteria | 2929239360 | 2929241481 | 336 |
| 28 | 3300005435 | Ga0070714_100074880 | Ga0070714_1000748804 | 338 |
| 29 | 3300005436 | Ga0070713_100080320 | Ga0070713_1000803204 | 338 |
| 30 | 3300005439 | Ga0070711_100098546 | Ga0070711_1000985463 | 338 |
| 31 | 3300005467 | Ga0070706_100038392 | Ga0070706_1000383922 | 338 |
| 32 | 3300005468 | Ga0070707_100393711 | Ga0070707_1003937111 | 338 |
| 33 | 3300005536 | Ga0070697_100298631 | Ga0070697_1002986311 | 338 |
| 34 | 3300006028 | Ga0070717_10111075 | Ga0070717_101110753 | 338 |
| 35 | 3300006163 | Ga0070715_10019337 | Ga0070715_100193373 | 338 |
| 36 | 3300006173 | Ga0070716_100076714 | Ga0070716_1000767142 | 338 |
| 37 | 3300025898 | Ga0207692_10065260 | Ga0207692_100652602 | 338 |
| 38 | 3300025905 | Ga0207685_10023105 | Ga0207685_100231052 | 338 |
| 39 | 3300025915 | Ga0207693_10095563 | Ga0207693_100955633 | 338 |
| 40 | 3300025916 | Ga0207663_10105923 | Ga0207663_101059231 | 338 |
| 41 | 3300025929 | Ga0207664_10086255 | Ga0207664_100862552 | 338 |
| 42 | 3300025961 | Ga0207712_10222790 | Ga0207712_102227902 | 338 |
| 43 | 3300005288 | Ga0065714_10009248 | Ga0065714_100092481 | 339 |
| 44 | iso_pu_bacteria | 2510065019 | 2510134546 | 339 |
| 45 | iso_pu_bacteria | 2513237085 | 2513574272 | 339 |
| 46 | iso_pu_bacteria | 2515154134 | 2515737779 | 339 |
| 47 | iso_pu_bacteria | 2585427526 | 2585525917 | 339 |
| 48 | iso_pu_bacteria | 2599185236 | 2599717768 | 339 |
| 49 | iso_pu_bacteria | 2775507049 | 2776910977 | 339 |
| 50 | iso_pu_bacteria | 2838661181 | 2838667405 | 339 |
| 51 | iso_pu_bacteria | 2842163707 | 2842163719 | 339 |
| 52 | iso_pu_bacteria | 2919100787 | 2919102237 | 339 |
| 53 | iso_pu_bacteria | 2923556063 | 2923561808 | 339 |
| 54 | iso_pu_bacteria | 2935901341 | 2935902820 | 339 |
| 55 | iso_pu_bacteria | 3005416602 | 3005416698 | 339 |
| 56 | iso_pu_bacteria | 8005307578 | 8005307590 | 339 |
| 57 | iso_pu_bacteria | 8005314921 | 8005320659 | 339 |
| 58 | iso_pu_bacteria | 8024479707 | 8024485335 | 339 |
| 59 | 3300003354 | JGI25160J50197_1000557 | JGI25160J50197_100055719 | 340 |
| 60 | 3300005353 | Ga0070669_100077842 | Ga0070669_1000778423 | 340 |
| 61 | 3300025302 | Ga0207426_1000893 | Ga0207426_100089326 | 340 |
| 62 | 3300031507 | Ga0307509_10012465 | Ga0307509_100124656 | 340 |
| 63 | 3300031507 | Ga0307509_10126932 | Ga0307509_101269322 | 340 |
| 64 | 3300046616 | Ga0495668_0006580 | Ga0495668_0006580_4226_5272 | 340 |
| 65 | 3300005445 | Ga0070708_100027521 | Ga0070708_1000275213 | 341 |
| 66 | 3300005466 | Ga0070685_10073402 | Ga0070685_100734022 | 341 |
| 67 | 3300005471 | Ga0070698_100097588 | Ga0070698_1000975882 | 341 |
| 68 | 3300005536 | Ga0070697_100125881 | Ga0070697_1001258813 | 341 |
| 69 | 3300005614 | Ga0068856_100034744 | Ga0068856_1000347444 | 341 |
| 70 | 3300005615 | Ga0070702_100011108 | Ga0070702_1000111085 | 341 |
| 71 | 3300005842 | Ga0068858_100196601 | Ga0068858_1001966012 | 341 |
| 72 | 3300009147 | Ga0114129_10051571 | Ga0114129_100515713 | 341 |
| 73 | 3300009176 | Ga0105242_10041893 | Ga0105242_100418934 | 341 |
| 74 | 3300013307 | Ga0157372_10053278 | Ga0157372_100532784 | 341 |
| 75 | 3300014325 | Ga0163163_10009985 | Ga0163163_100099852 | 341 |
| 76 | 3300025910 | Ga0207684_10038536 | Ga0207684_100385365 | 341 |
| 77 | 3300025922 | Ga0207646_10017554 | Ga0207646_100175545 | 341 |
| 78 | 3300025922 | Ga0207646_10045408 | Ga0207646_100454085 | 341 |
| 79 | 3300026078 | Ga0207702_10262952 | Ga0207702_102629521 | 341 |
| 80 | 3300026089 | Ga0207648_10283710 | Ga0207648_102837102 | 341 |
| 81 | 3300026121 | Ga0207683_10095236 | Ga0207683_100952362 | 341 |
| 82 | 3300031251 | Ga0265327_10000087 | Ga0265327_1000008724 | 341 |
| 83 | 3300049575 | Ga0501039_0108910 | Ga0501039_0108910_238_1284 | 341 |
| 84 | 3300050507 | nmdc:mga05p37_78908_c1 | nmdc:mga05p37_78908_c1_1214_2263 | 341 |
| 85 | 3300050512 | nmdc:mga0n895_117904_c1 | nmdc:mga0n895_117904_c1_1152_2201 | 341 |
| 86 | 3300050515 | nmdc:mga0a205_49153_c1 | nmdc:mga0a205_49153_c1_590_1639 | 341 |
| 87 | 3300031852 | Ga0307410_10286725 | Ga0307410_102867252 | 342 |
| 88 | 3300042006 | Ga0439432_025573 | Ga0439432_025573_137_1210 | 342 |
| 89 | 3300044712 | Ga0453684_0001900 | Ga0453684_0001900_26899_27999 | 342 |
| 90 | 3300053096 | Ga0500641_0066576 | Ga0500641_0066576_341_1372 | 342 |
| 91 | 3300002773 | JGI25152J39213_1000836 | JGI25152J39213_100083611 | 343 |
| 92 | 3300002774 | JGI25150J39212_1002942 | JGI25150J39212_10029424 | 343 |
| 93 | 3300005293 | Ga0065715_10095973 | Ga0065715_100959732 | 343 |
| 94 | 3300005293 | Ga0065715_10200266 | Ga0065715_102002662 | 343 |
| 95 | 3300005329 | Ga0070683_100039521 | Ga0070683_1000395216 | 343 |
| 96 | 3300005340 | Ga0070689_100128630 | Ga0070689_1001286302 | 343 |
| 97 | 3300005343 | Ga0070687_100115354 | Ga0070687_1001153542 | 343 |
| 98 | 3300005344 | Ga0070661_100000391 | Ga0070661_10000039123 | 343 |
| 99 | 3300005354 | Ga0070675_100072617 | Ga0070675_1000726174 | 343 |
| 100 | 3300005365 | Ga0070688_100048835 | Ga0070688_1000488354 | 343 |
| 101 | 3300005366 | Ga0070659_100009665 | Ga0070659_1000096654 | 343 |
| 102 | 3300005366 | Ga0070659_100148719 | Ga0070659_1001487192 | 343 |
| 103 | 3300005367 | Ga0070667_100394138 | Ga0070667_1003941382 | 343 |
| 104 | 3300005434 | Ga0070709_10119220 | Ga0070709_101192202 | 343 |
| 105 | 3300005444 | Ga0070694_100110157 | Ga0070694_1001101572 | 343 |
| 106 | 3300005471 | Ga0070698_100054195 | Ga0070698_1000541953 | 343 |
| 107 | 3300005535 | Ga0070684_100031721 | Ga0070684_1000317214 | 343 |
| 108 | 3300005535 | Ga0070684_100367897 | Ga0070684_1003678971 | 343 |
| 109 | 3300005545 | Ga0070695_100130675 | Ga0070695_1001306752 | 343 |
| 110 | 3300005549 | Ga0070704_100050645 | Ga0070704_1000506454 | 343 |
| 111 | 3300005617 | Ga0068859_100144696 | Ga0068859_1001446962 | 343 |
| 112 | 3300005841 | Ga0068863_100025843 | Ga0068863_1000258437 | 343 |
| 113 | 3300005841 | Ga0068863_100133094 | Ga0068863_1001330943 | 343 |
| 114 | 3300005841 | Ga0068863_100212711 | Ga0068863_1002127112 | 343 |
| 115 | 3300005842 | Ga0068858_100135282 | Ga0068858_1001352822 | 343 |
| 116 | 3300005843 | Ga0068860_100118610 | Ga0068860_1001186102 | 343 |
| 117 | 3300006173 | Ga0070716_100277592 | Ga0070716_1002775921 | 343 |
| 118 | 3300006175 | Ga0070712_100129907 | Ga0070712_1001299072 | 343 |
| 119 | 3300006871 | Ga0075434_100340482 | Ga0075434_1003404822 | 343 |
| 120 | 3300006931 | Ga0097620_100144696 | Ga0097620_1001446964 | 343 |
| 121 | 3300009093 | Ga0105240_10292196 | Ga0105240_102921962 | 343 |
| 122 | 3300009101 | Ga0105247_10040622 | Ga0105247_100406223 | 343 |
| 123 | 3300009176 | Ga0105242_10414181 | Ga0105242_104141812 | 343 |
| 124 | 3300009177 | Ga0105248_10092584 | Ga0105248_100925843 | 343 |
| 125 | 3300009177 | Ga0105248_10221694 | Ga0105248_102216943 | 343 |
| 126 | 3300009545 | Ga0105237_10001986 | Ga0105237_1000198624 | 343 |
| 127 | 3300009545 | Ga0105237_10192392 | Ga0105237_101923922 | 343 |
| 128 | 3300009553 | Ga0105249_10095039 | Ga0105249_100950393 | 343 |
| 129 | 3300013296 | Ga0157374_10099024 | Ga0157374_100990242 | 343 |
| 130 | 3300013297 | Ga0157378_10013341 | Ga0157378_100133415 | 343 |
| 131 | 3300013306 | Ga0163162_10023990 | Ga0163162_100239904 | 343 |
| 132 | 3300013308 | Ga0157375_10018379 | Ga0157375_100183791 | 343 |
| 133 | 3300014745 | Ga0157377_10085175 | Ga0157377_100851752 | 343 |
| 134 | 3300025245 | Ga0207425_1000415 | Ga0207425_100041513 | 343 |
| 135 | 3300025258 | Ga0209129_1000337 | Ga0209129_100033711 | 343 |
| 136 | 3300025295 | Ga0209564_1011664 | Ga0209564_10116643 | 343 |
| 137 | 3300025297 | Ga0209758_1000195 | Ga0209758_100019580 | 343 |
| 138 | 3300025297 | Ga0209758_1003265 | Ga0209758_10032655 | 343 |
| 139 | 3300025299 | Ga0209256_1006097 | Ga0209256_10060972 | 343 |
| 140 | 3300025303 | Ga0209051_1020151 | Ga0209051_10201513 | 343 |
| 141 | 3300025315 | Ga0207697_10024624 | Ga0207697_100246243 | 343 |
| 142 | 3300025904 | Ga0207647_10029082 | Ga0207647_100290823 | 343 |
| 143 | 3300025910 | Ga0207684_10004947 | Ga0207684_100049475 | 343 |
| 144 | 3300025914 | Ga0207671_10001381 | Ga0207671_1000138124 | 343 |
| 145 | 3300025914 | Ga0207671_10250818 | Ga0207671_102508182 | 343 |
| 146 | 3300025915 | Ga0207693_10140233 | Ga0207693_101402332 | 343 |
| 147 | 3300025916 | Ga0207663_10011581 | Ga0207663_100115812 | 343 |
| 148 | 3300025918 | Ga0207662_10041986 | Ga0207662_100419864 | 343 |
| 149 | 3300025920 | Ga0207649_10000307 | Ga0207649_1000030719 | 343 |
| 150 | 3300025926 | Ga0207659_10055871 | Ga0207659_100558714 | 343 |
| 151 | 3300025928 | Ga0207700_10138938 | Ga0207700_101389381 | 343 |
| 152 | 3300025932 | Ga0207690_10099157 | Ga0207690_100991572 | 343 |
| 153 | 3300025936 | Ga0207670_10016908 | Ga0207670_100169085 | 343 |
| 154 | 3300025939 | Ga0207665_10090635 | Ga0207665_100906353 | 343 |
| 155 | 3300025939 | Ga0207665_10127530 | Ga0207665_101275302 | 343 |
| 156 | 3300025939 | Ga0207665_10188177 | Ga0207665_101881772 | 343 |
| 157 | 3300025941 | Ga0207711_10072736 | Ga0207711_100727363 | 343 |
| 158 | 3300025941 | Ga0207711_10122734 | Ga0207711_101227342 | 343 |
| 159 | 3300026035 | Ga0207703_10011295 | Ga0207703_100112953 | 343 |
| 160 | 3300026035 | Ga0207703_10071655 | Ga0207703_100716553 | 343 |
| 161 | 3300026067 | Ga0207678_10022711 | Ga0207678_100227115 | 343 |
| 162 | 3300026088 | Ga0207641_10032474 | Ga0207641_100324743 | 343 |
| 163 | 3300028381 | Ga0268264_10070590 | Ga0268264_100705904 | 343 |
| 164 | 3300028381 | Ga0268264_10080510 | Ga0268264_100805103 | 343 |
| 165 | 3300041503 | Ga0451847_0562736 | Ga0451847_0562736_374_1405 | 343 |
| 166 | 3300041512 | Ga0451853_1554842 | Ga0451853_1554842_3965_4996 | 343 |
| 167 | 3300046471 | Ga0495650_0080762 | Ga0495650_0080762_11_1042 | 343 |
| 168 | 3300046501 | Ga0495607_0099242 | Ga0495607_0099242_153_1184 | 343 |
| 169 | 3300046515 | Ga0495620_0011102 | Ga0495620_0011102_3618_4649 | 343 |
| 170 | 3300046519 | Ga0495632_0010869 | Ga0495632_0010869_2652_3683 | 343 |
| 171 | 3300046530 | Ga0495654_0027151 | Ga0495654_0027151_1616_2647 | 343 |
| 172 | 3300046542 | Ga0495597_0014861 | Ga0495597_0014861_1612_2643 | 343 |
| 173 | 3300046616 | Ga0495668_0044538 | Ga0495668_0044538_1306_2337 | 343 |
| 174 | 3300046660 | Ga0495625_0027269 | Ga0495625_0027269_2968_3999 | 343 |
| 175 | 3300047323 | Ga0495683_0056583 | Ga0495683_0056583_322_1353 | 343 |
| 176 | 3300047443 | Ga0495687_084529 | Ga0495687_084529_114_1145 | 343 |
| 177 | 3300048903 | Ga0496100_0078674 | Ga0496100_0078674_652_1731 | 343 |
| 178 | 3300048904 | Ga0496101_0220170 | Ga0496101_0220170_84_1166 | 343 |
| 179 | 3300048904 | Ga0496101_0288879 | Ga0496101_0288879_131_1210 | 343 |
| 180 | 3300048905 | Ga0496102_0107116 | Ga0496102_0107116_548_1630 | 343 |
| 181 | 3300048909 | Ga0496106_0075541 | Ga0496106_0075541_652_1731 | 343 |
| 182 | 3300048911 | Ga0496108_0012367 | Ga0496108_0012367_254_1336 | 343 |
| 183 | 3300048912 | Ga0496109_0077982 | Ga0496109_0077982_1387_2469 | 343 |
| 184 | 3300048913 | Ga0496110_0117472 | Ga0496110_0117472_1055_2137 | 343 |
| 185 | 3300048915 | Ga0496112_0075321 | Ga0496112_0075321_284_1366 | 343 |
| 186 | 3300048915 | Ga0496112_0318612 | Ga0496112_0318612_138_1220 | 343 |
| 187 | 3300048916 | Ga0496113_0071636 | Ga0496113_0071636_879_1961 | 343 |
| 188 | 3300048918 | Ga0496115_0142807 | Ga0496115_0142807_326_1408 | 343 |
| 189 | 3300048928 | Ga0496125_0037583 | Ga0496125_0037583_780_1811 | 343 |
| 190 | 3300050512 | nmdc:mga0n895_195410_c1 | nmdc:mga0n895_195410_c1_220_1302 | 343 |
| 191 | 3300050512 | nmdc:mga0n895_408673_c1 | nmdc:mga0n895_408673_c1_144_1226 | 343 |
| 192 | 3300053109 | Ga0500569_010193 | Ga0500569_010193_107_1138 | 343 |
| 193 | 3300053134 | Ga0500658_0003072 | Ga0500658_0003072_1283_2314 | 343 |
| 194 | 3300053153 | Ga0500616_0025821 | Ga0500616_0025821_1785_2816 | 343 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2i7g-assembly1.cif.gz_A | crystal structure of monooxygenase from agrobacterium tumefaciens | 0.9568 | 1 | 342 |
| 2i7g-assembly1.cif.gz_A | crystal structure of monooxygenase from agrobacterium tumefaciens | 0.9486 | 1 | 342 |
| 1luc-assembly1.cif.gz_A | bacterial luciferase | 0.8895 | 1 | 337 |
| 7bip-assembly1.cif.gz_B | crystal structure of monooxygenase rslo1 from streptomyces bottropensis | 0.8847 | 1 | 337 |
| 7bip-assembly1.cif.gz_B | crystal structure of monooxygenase rslo1 from streptomyces bottropensis | 0.8746 | 1 | 337 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G136_3_353_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9597 | 1 | 342 | 3.20.20.30 |
| 2i7gA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9546 | 1 | 342 | 3.20.20.30 |
| 2i7gA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9463 | 1 | 342 | 3.20.20.30 |
| af_Q2G136_3_353_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9461 | 1 | 342 | 3.20.20.30 |
| 6friA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.8318 | 1 | 336 | 3.20.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0Q4R497-F1-model_v4 | Luciferase-like domain-containing protein | 0.9856 | 1 | 105 |
GO:0004497
GO:0005829 GO:0016705 |
| AF-H1S7G3-F1-model_v4 | Oxidoreductase | 0.9847 | 2 | 86 |
GO:0004497
GO:0005829 GO:0016705 |
| AF-A0A0M8K769-F1-model_v4 | Luciferase | 0.9813 | 1 | 342 |
GO:0004497
GO:0005829 GO:0016705 |
| AF-A0A421AYI2-F1-model_v4 | Luciferase-like monooxygenase | 0.9811 | 1 | 94 |
GO:0004497
GO:0005829 GO:0016705 |
| AF-A0A535JPW7-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9795 | 1 | 280 |
GO:0004497
GO:0005829 GO:0016705 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar