F299044

General Info

Members Datasets Scaffolds Average Seq Length
194 160 177 349

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0001900|Ga0453684_0001900_26899_27999
Length 366
Sequence MNDTSETTSAKTGMEIGVITLGEFLNDPQSGQKVSAQQRIQEIVQAAQLADEAGLDAFGVGEHHSLDFVVSAVPVVLAAIAPLTKRIRLTSAVTVLSTADPVREFENYATLDLLSAGRAEMIVGRGAFVESFPLFGYDVNDYDRLFPEKLDLLLKLNSSERVTWQGRLRSPLNNAEIAPRPLQAELPIWVGVGGTRQSVVRAGTLGLPMMVGIIGGASAQFAPLMELYRRTGMEAKHAPTQLKTGVTSYLHIEKISQEAIDEFYPYHTHYFEQLGRSRGRMIQLSRSDYEQNASLHGAYFVGSPQQIIDKLLYQHEIFGHQRFMAQIDIGGLPYKKVAQTIELLATEVVPVIRRETAGHVNVSQKL

Samples

Sample ID Description Type Environment
1 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
2 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
3 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
4 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
5 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
6 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
7 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
8 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
9 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
10 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
11 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
12 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
13 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
14 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
15 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
16 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
77 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
119 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
125 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
126 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
127 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
128 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
129 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
134 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
154 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
155 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
156 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
157 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
158 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
159 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
160 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.72
Metatranscriptomes 0.52
Isolates 8.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.25
Nodule 3.61
Rhizoplane 7.22
Rhizosphere 75.77
Stem 0
Stem Tuber 0
Unclassified 5.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000836 3300002773 Bacteria 15283
2 JGI25150J39212_1002942 3300002774 Bacteria 4109
3 JGI25160J50197_1000557 3300003354 Bacteria 21129
4 Ga0065714_10009248 3300005288 Bacteria 2986
5 Ga0065715_10095973 3300005293 Bacteria 3970
6 Ga0065715_10200266 3300005293 Bacteria 1365
7 Ga0070683_100039521 3300005329 Bacteria 4331
8 Ga0070677_10058963 3300005333 Bacteria 1578
9 Ga0070689_100128630 3300005340 Unclassified 2029
10 Ga0070687_100115354 3300005343 Unclassified 1527
11 Ga0070661_100000391 3300005344 Bacteria 34135
12 Ga0070669_100077842 3300005353 Bacteria 2464
13 Ga0070675_100072617 3300005354 Bacteria 2857
14 Ga0070688_100048835 3300005365 Bacteria 2631
15 Ga0070659_100009665 3300005366 Bacteria 7088
16 Ga0070659_100148719 3300005366 Unclassified 1910
17 Ga0070667_100394138 3300005367 Bacteria 1259
18 Ga0070709_10119220 3300005434 Bacteria 1786
19 Ga0070714_100074880 3300005435 Bacteria 2936
20 Ga0070713_100080320 3300005436 Bacteria 2780
21 Ga0070711_100098546 3300005439 Bacteria 2122
22 Ga0070705_100005481 3300005440 Bacteria 6186
23 Ga0070694_100110157 3300005444 Bacteria 1961
24 Ga0070708_100027521 3300005445 Bacteria 4879
25 Ga0070685_10073402 3300005466 Bacteria 2033
26 Ga0070706_100038392 3300005467 Bacteria 4419
27 Ga0070707_100393711 3300005468 Bacteria 1345
28 Ga0070698_100054195 3300005471 Bacteria 4073
29 Ga0070698_100097588 3300005471 Bacteria 2914
30 Ga0070684_100031721 3300005535 Bacteria 4500
31 Ga0070684_100367897 3300005535 Unclassified 1323
32 Ga0070697_100125881 3300005536 Bacteria 2146
33 Ga0070697_100298631 3300005536 Bacteria 1384
34 Ga0070695_100130675 3300005545 Unclassified 1730
35 Ga0070704_100050645 3300005549 Bacteria 2920
36 Ga0068856_100034744 3300005614 Bacteria 4939
37 Ga0070702_100011108 3300005615 Unclassified 4468
38 Ga0068859_100144696 3300005617 Unclassified 2451
39 Ga0068863_100025843 3300005841 Bacteria 5602
40 Ga0068863_100133094 3300005841 Bacteria 2374
41 Ga0068863_100212711 3300005841 Bacteria 1862
42 Ga0068858_100135282 3300005842 Unclassified 2312
43 Ga0068858_100196601 3300005842 Bacteria 1906
44 Ga0068860_100118610 3300005843 Bacteria 2533
45 Ga0068862_100180960 3300005844 Unclassified 1892
46 Ga0070717_10111075 3300006028 Bacteria 2338
47 Ga0070715_10019337 3300006163 Unclassified 2611
48 Ga0070716_100076714 3300006173 Bacteria 1981
49 Ga0070716_100277592 3300006173 Bacteria 1155
50 Ga0070712_100129907 3300006175 Unclassified 1908
51 Ga0075433_10006249 3300006852 Bacteria 9401
52 Ga0075434_100252986 3300006871 Archaea 1781
53 Ga0075434_100340482 3300006871 Bacteria 1521
54 Ga0075436_100014154 3300006914 Bacteria 5460
55 Ga0097620_100144696 3300006931 Unclassified 2451
56 Ga0105240_10292196 3300009093 Bacteria 1868
57 Ga0105247_10040622 3300009101 Bacteria 2844
58 Ga0114129_10051571 3300009147 Archaea 5776
59 Ga0105242_10041893 3300009176 Unclassified 3695
60 Ga0105242_10414181 3300009176 Bacteria 1261
61 Ga0105248_10092584 3300009177 Bacteria 3404
62 Ga0105248_10221694 3300009177 Unclassified 2129
63 Ga0105237_10001986 3300009545 Bacteria 26023
64 Ga0105237_10192392 3300009545 Unclassified 2040
65 Ga0105249_10095039 3300009553 Unclassified 2794
66 Ga0157373_10026204 3300013100 Unclassified 4213
67 Ga0157374_10054354 3300013296 Bacteria 3735
68 Ga0157374_10099024 3300013296 Bacteria 2792
69 Ga0157378_10013341 3300013297 Bacteria 7182
70 Ga0163162_10023990 3300013306 Bacteria 6020
71 Ga0157372_10053278 3300013307 Bacteria 4509
72 Ga0157375_10018379 3300013308 Bacteria 6339
73 Ga0163163_10009985 3300014325 Bacteria 8511
74 Ga0157377_10085175 3300014745 Bacteria 1855
75 Ga0206350_11096870 3300020080 Archaea 1125
76 Ga0207425_1000415 3300025245 Bacteria 28739
77 Ga0209129_1000337 3300025258 Bacteria 40559
78 Ga0209564_1011664 3300025295 Bacteria 3912
79 Ga0209758_1000195 3300025297 Bacteria 133982
80 Ga0209758_1003265 3300025297 Bacteria 15035
81 Ga0209256_1006097 3300025299 Bacteria 6546
82 Ga0207426_1000893 3300025302 Bacteria 30173
83 Ga0209051_1020151 3300025303 Bacteria 2884
84 Ga0207697_10024624 3300025315 Bacteria 2464
85 Ga0207692_10065260 3300025898 Unclassified 1898
86 Ga0207647_10029082 3300025904 Bacteria 3581
87 Ga0207685_10023105 3300025905 Unclassified 2112
88 Ga0207684_10004947 3300025910 Bacteria 12435
89 Ga0207684_10038536 3300025910 Bacteria 4055
90 Ga0207671_10001381 3300025914 Bacteria 28250
91 Ga0207671_10250818 3300025914 Unclassified 1391
92 Ga0207693_10095563 3300025915 Bacteria 2330
93 Ga0207693_10140233 3300025915 Bacteria 1901
94 Ga0207663_10011581 3300025916 Unclassified 4741
95 Ga0207663_10105923 3300025916 Unclassified 1899
96 Ga0207662_10041986 3300025918 Unclassified 2694
97 Ga0207649_10000307 3300025920 Bacteria 37507
98 Ga0207646_10017554 3300025922 Bacteria 6692
99 Ga0207646_10045408 3300025922 Bacteria 3944
100 Ga0207659_10055871 3300025926 Bacteria 2825
101 Ga0207700_10138938 3300025928 Unclassified 1994
102 Ga0207664_10086255 3300025929 Bacteria 2564
103 Ga0207690_10099157 3300025932 Bacteria 2077
104 Ga0207670_10016908 3300025936 Bacteria 4397
105 Ga0207665_10090635 3300025939 Bacteria 2119
106 Ga0207665_10127530 3300025939 Bacteria 1803
107 Ga0207665_10188177 3300025939 Bacteria 1498
108 Ga0207691_10062745 3300025940 Bacteria 3371
109 Ga0207711_10072736 3300025941 Bacteria 2987
110 Ga0207711_10122734 3300025941 Unclassified 2321
111 Ga0207651_10175943 3300025960 Bacteria 1693
112 Ga0207712_10222790 3300025961 Unclassified 1509
113 Ga0207668_10241286 3300025972 Bacteria 1462
114 Ga0207703_10011295 3300026035 Bacteria 6944
115 Ga0207703_10071655 3300026035 Bacteria 2863
116 Ga0207678_10022711 3300026067 Bacteria 5494
117 Ga0207708_10303722 3300026075 Bacteria 1299
118 Ga0207702_10262952 3300026078 Bacteria 1625
119 Ga0207641_10032474 3300026088 Bacteria 4333
120 Ga0207648_10283710 3300026089 Unclassified 1481
121 Ga0207676_10228817 3300026095 Bacteria 1661
122 Ga0207683_10095236 3300026121 Bacteria 2654
123 Ga0268264_10070590 3300028381 Bacteria 2957
124 Ga0268264_10080510 3300028381 Bacteria 2781
125 Ga0268264_10240844 3300028381 Bacteria 1675
126 Ga0265327_10000087 3300031251 Bacteria 198174
127 Ga0265327_10000114 3300031251 Bacteria 174833
128 Ga0307509_10012465 3300031507 Bacteria 10167
129 Ga0307509_10126932 3300031507 Bacteria 2515
130 Ga0265314_10077655 3300031711 Bacteria 2202
131 Ga0307410_10286725 3300031852 Bacteria 1294
132 Ga0451807_0422351 3300041486 Unclassified 1875
133 Ga0451847_0562736 3300041503 Bacteria 1706
134 Ga0451853_1554842 3300041512 Bacteria 10570
135 Ga0439432_025573 3300042006 Unclassified 1936
136 Ga0453684_0001900 3300044712 Bacteria 54239
137 Ga0466967_0020733 3300045976 Bacteria 5321
138 Ga0495650_0080762 3300046471 Bacteria 1254
139 Ga0495607_0099242 3300046501 Bacteria 1562
140 Ga0495620_0011102 3300046515 Bacteria 4716
141 Ga0495632_0010869 3300046519 Bacteria 5354
142 Ga0495654_0027151 3300046530 Bacteria 2938
143 Ga0495597_0014861 3300046542 Bacteria 3701
144 Ga0495645_0204922 3300046543 Unclassified 1335
145 Ga0495668_0006580 3300046616 Bacteria 7583
146 Ga0495668_0044538 3300046616 Bacteria 2466
147 Ga0495625_0027269 3300046660 Bacteria 4303
148 Ga0495683_0056583 3300047323 Bacteria 1951
149 Ga0495687_084529 3300047443 Bacteria 1233
150 Ga0496100_0078674 3300048903 Bacteria 2220
151 Ga0496101_0220170 3300048904 Unclassified 1473
152 Ga0496101_0288879 3300048904 Bacteria 1283
153 Ga0496102_0107116 3300048905 Bacteria 2602
154 Ga0496106_0075541 3300048909 Bacteria 2581
155 Ga0496108_0012367 3300048911 Bacteria 6945
156 Ga0496109_0077982 3300048912 Bacteria 3049
157 Ga0496110_0117472 3300048913 Unclassified 2395
158 Ga0496112_0075321 3300048915 Bacteria 3338
159 Ga0496112_0318612 3300048915 Bacteria 1499
160 Ga0496113_0071636 3300048916 Bacteria 2636
161 Ga0496115_0142807 3300048918 Bacteria 1975
162 Ga0496125_0037583 3300048928 Bacteria 4207
163 Ga0496126_0037323 3300048929 Bacteria 4536
164 Ga0501039_0108910 3300049575 Archaea 2165
165 Ga0501243_000202 3300049675 Bacteria 7244
166 nmdc:mga05p37_78908_c1 3300050507 Archaea 4054
167 nmdc:mga0n895_117904_c1 3300050512 Archaea 2674
168 nmdc:mga0n895_195410_c1 3300050512 Bacteria 2054
169 nmdc:mga0n895_408673_c1 3300050512 Bacteria 1373
170 nmdc:mga08x19_26823_c1 3300050514 Bacteria 3598
171 nmdc:mga0a205_18615_c1 3300050515 Bacteria 6533
172 nmdc:mga0a205_49153_c1 3300050515 Archaea 4070
173 Ga0500641_0066576 3300053096 Bacteria 1509
174 Ga0500569_010193 3300053109 Bacteria 2205
175 Ga0500658_0003072 3300053134 Bacteria 6382
176 Ga0500616_0025821 3300053153 Bacteria 3257
177 Ga0500622_0001007 3300053156 Bacteria 23773

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006871 Ga0075434_100252986 Ga0075434_1002529861 302
2 3300020080 Ga0206350_11096870 Ga0206350_110968701 305
3 3300050515 nmdc:mga0a205_18615_c1 nmdc:mga0a205_18615_c1_5331_6290 308
4 3300026075 Ga0207708_10303722 Ga0207708_103037221 317
5 3300026095 Ga0207676_10228817 Ga0207676_102288172 318
6 3300005333 Ga0070677_10058963 Ga0070677_100589632 320
7 3300025940 Ga0207691_10062745 Ga0207691_100627452 320
8 3300025960 Ga0207651_10175943 Ga0207651_101759432 320
9 3300025972 Ga0207668_10241286 Ga0207668_102412861 320
10 3300028381 Ga0268264_10240844 Ga0268264_102408442 320
11 3300048929 Ga0496126_0037323 Ga0496126_0037323_1905_2942 322
12 3300005844 Ga0068862_100180960 Ga0068862_1001809601 326
13 3300041486 Ga0451807_0422351 Ga0451807_0422351_547_1542 329
14 3300045976 Ga0466967_0020733 Ga0466967_0020733_1953_2999 329
15 3300013100 Ga0157373_10026204 Ga0157373_100262044 330
16 3300031711 Ga0265314_10077655 Ga0265314_100776552 330
17 3300053156 Ga0500622_0001007 Ga0500622_0001007_386_1396 330
18 3300005440 Ga0070705_100005481 Ga0070705_1000054813 333
19 3300006852 Ga0075433_10006249 Ga0075433_100062495 333
20 3300049675 Ga0501243_000202 Ga0501243_000202_4012_5052 333
21 iso_pu_bacteria 2799112218 2799183078 333
22 3300031251 Ga0265327_10000114 Ga0265327_10000114113 334
23 3300006914 Ga0075436_100014154 Ga0075436_1000141544 335
24 3300013296 Ga0157374_10054354 Ga0157374_100543542 335
25 3300046543 Ga0495645_0204922 Ga0495645_0204922_189_1265 335
26 3300050514 nmdc:mga08x19_26823_c1 nmdc:mga08x19_26823_c1_669_1706 335
27 iso_pu_bacteria 2929239360 2929241481 336
28 3300005435 Ga0070714_100074880 Ga0070714_1000748804 338
29 3300005436 Ga0070713_100080320 Ga0070713_1000803204 338
30 3300005439 Ga0070711_100098546 Ga0070711_1000985463 338
31 3300005467 Ga0070706_100038392 Ga0070706_1000383922 338
32 3300005468 Ga0070707_100393711 Ga0070707_1003937111 338
33 3300005536 Ga0070697_100298631 Ga0070697_1002986311 338
34 3300006028 Ga0070717_10111075 Ga0070717_101110753 338
35 3300006163 Ga0070715_10019337 Ga0070715_100193373 338
36 3300006173 Ga0070716_100076714 Ga0070716_1000767142 338
37 3300025898 Ga0207692_10065260 Ga0207692_100652602 338
38 3300025905 Ga0207685_10023105 Ga0207685_100231052 338
39 3300025915 Ga0207693_10095563 Ga0207693_100955633 338
40 3300025916 Ga0207663_10105923 Ga0207663_101059231 338
41 3300025929 Ga0207664_10086255 Ga0207664_100862552 338
42 3300025961 Ga0207712_10222790 Ga0207712_102227902 338
43 3300005288 Ga0065714_10009248 Ga0065714_100092481 339
44 iso_pu_bacteria 2510065019 2510134546 339
45 iso_pu_bacteria 2513237085 2513574272 339
46 iso_pu_bacteria 2515154134 2515737779 339
47 iso_pu_bacteria 2585427526 2585525917 339
48 iso_pu_bacteria 2599185236 2599717768 339
49 iso_pu_bacteria 2775507049 2776910977 339
50 iso_pu_bacteria 2838661181 2838667405 339
51 iso_pu_bacteria 2842163707 2842163719 339
52 iso_pu_bacteria 2919100787 2919102237 339
53 iso_pu_bacteria 2923556063 2923561808 339
54 iso_pu_bacteria 2935901341 2935902820 339
55 iso_pu_bacteria 3005416602 3005416698 339
56 iso_pu_bacteria 8005307578 8005307590 339
57 iso_pu_bacteria 8005314921 8005320659 339
58 iso_pu_bacteria 8024479707 8024485335 339
59 3300003354 JGI25160J50197_1000557 JGI25160J50197_100055719 340
60 3300005353 Ga0070669_100077842 Ga0070669_1000778423 340
61 3300025302 Ga0207426_1000893 Ga0207426_100089326 340
62 3300031507 Ga0307509_10012465 Ga0307509_100124656 340
63 3300031507 Ga0307509_10126932 Ga0307509_101269322 340
64 3300046616 Ga0495668_0006580 Ga0495668_0006580_4226_5272 340
65 3300005445 Ga0070708_100027521 Ga0070708_1000275213 341
66 3300005466 Ga0070685_10073402 Ga0070685_100734022 341
67 3300005471 Ga0070698_100097588 Ga0070698_1000975882 341
68 3300005536 Ga0070697_100125881 Ga0070697_1001258813 341
69 3300005614 Ga0068856_100034744 Ga0068856_1000347444 341
70 3300005615 Ga0070702_100011108 Ga0070702_1000111085 341
71 3300005842 Ga0068858_100196601 Ga0068858_1001966012 341
72 3300009147 Ga0114129_10051571 Ga0114129_100515713 341
73 3300009176 Ga0105242_10041893 Ga0105242_100418934 341
74 3300013307 Ga0157372_10053278 Ga0157372_100532784 341
75 3300014325 Ga0163163_10009985 Ga0163163_100099852 341
76 3300025910 Ga0207684_10038536 Ga0207684_100385365 341
77 3300025922 Ga0207646_10017554 Ga0207646_100175545 341
78 3300025922 Ga0207646_10045408 Ga0207646_100454085 341
79 3300026078 Ga0207702_10262952 Ga0207702_102629521 341
80 3300026089 Ga0207648_10283710 Ga0207648_102837102 341
81 3300026121 Ga0207683_10095236 Ga0207683_100952362 341
82 3300031251 Ga0265327_10000087 Ga0265327_1000008724 341
83 3300049575 Ga0501039_0108910 Ga0501039_0108910_238_1284 341
84 3300050507 nmdc:mga05p37_78908_c1 nmdc:mga05p37_78908_c1_1214_2263 341
85 3300050512 nmdc:mga0n895_117904_c1 nmdc:mga0n895_117904_c1_1152_2201 341
86 3300050515 nmdc:mga0a205_49153_c1 nmdc:mga0a205_49153_c1_590_1639 341
87 3300031852 Ga0307410_10286725 Ga0307410_102867252 342
88 3300042006 Ga0439432_025573 Ga0439432_025573_137_1210 342
89 3300044712 Ga0453684_0001900 Ga0453684_0001900_26899_27999 342
90 3300053096 Ga0500641_0066576 Ga0500641_0066576_341_1372 342
91 3300002773 JGI25152J39213_1000836 JGI25152J39213_100083611 343
92 3300002774 JGI25150J39212_1002942 JGI25150J39212_10029424 343
93 3300005293 Ga0065715_10095973 Ga0065715_100959732 343
94 3300005293 Ga0065715_10200266 Ga0065715_102002662 343
95 3300005329 Ga0070683_100039521 Ga0070683_1000395216 343
96 3300005340 Ga0070689_100128630 Ga0070689_1001286302 343
97 3300005343 Ga0070687_100115354 Ga0070687_1001153542 343
98 3300005344 Ga0070661_100000391 Ga0070661_10000039123 343
99 3300005354 Ga0070675_100072617 Ga0070675_1000726174 343
100 3300005365 Ga0070688_100048835 Ga0070688_1000488354 343
101 3300005366 Ga0070659_100009665 Ga0070659_1000096654 343
102 3300005366 Ga0070659_100148719 Ga0070659_1001487192 343
103 3300005367 Ga0070667_100394138 Ga0070667_1003941382 343
104 3300005434 Ga0070709_10119220 Ga0070709_101192202 343
105 3300005444 Ga0070694_100110157 Ga0070694_1001101572 343
106 3300005471 Ga0070698_100054195 Ga0070698_1000541953 343
107 3300005535 Ga0070684_100031721 Ga0070684_1000317214 343
108 3300005535 Ga0070684_100367897 Ga0070684_1003678971 343
109 3300005545 Ga0070695_100130675 Ga0070695_1001306752 343
110 3300005549 Ga0070704_100050645 Ga0070704_1000506454 343
111 3300005617 Ga0068859_100144696 Ga0068859_1001446962 343
112 3300005841 Ga0068863_100025843 Ga0068863_1000258437 343
113 3300005841 Ga0068863_100133094 Ga0068863_1001330943 343
114 3300005841 Ga0068863_100212711 Ga0068863_1002127112 343
115 3300005842 Ga0068858_100135282 Ga0068858_1001352822 343
116 3300005843 Ga0068860_100118610 Ga0068860_1001186102 343
117 3300006173 Ga0070716_100277592 Ga0070716_1002775921 343
118 3300006175 Ga0070712_100129907 Ga0070712_1001299072 343
119 3300006871 Ga0075434_100340482 Ga0075434_1003404822 343
120 3300006931 Ga0097620_100144696 Ga0097620_1001446964 343
121 3300009093 Ga0105240_10292196 Ga0105240_102921962 343
122 3300009101 Ga0105247_10040622 Ga0105247_100406223 343
123 3300009176 Ga0105242_10414181 Ga0105242_104141812 343
124 3300009177 Ga0105248_10092584 Ga0105248_100925843 343
125 3300009177 Ga0105248_10221694 Ga0105248_102216943 343
126 3300009545 Ga0105237_10001986 Ga0105237_1000198624 343
127 3300009545 Ga0105237_10192392 Ga0105237_101923922 343
128 3300009553 Ga0105249_10095039 Ga0105249_100950393 343
129 3300013296 Ga0157374_10099024 Ga0157374_100990242 343
130 3300013297 Ga0157378_10013341 Ga0157378_100133415 343
131 3300013306 Ga0163162_10023990 Ga0163162_100239904 343
132 3300013308 Ga0157375_10018379 Ga0157375_100183791 343
133 3300014745 Ga0157377_10085175 Ga0157377_100851752 343
134 3300025245 Ga0207425_1000415 Ga0207425_100041513 343
135 3300025258 Ga0209129_1000337 Ga0209129_100033711 343
136 3300025295 Ga0209564_1011664 Ga0209564_10116643 343
137 3300025297 Ga0209758_1000195 Ga0209758_100019580 343
138 3300025297 Ga0209758_1003265 Ga0209758_10032655 343
139 3300025299 Ga0209256_1006097 Ga0209256_10060972 343
140 3300025303 Ga0209051_1020151 Ga0209051_10201513 343
141 3300025315 Ga0207697_10024624 Ga0207697_100246243 343
142 3300025904 Ga0207647_10029082 Ga0207647_100290823 343
143 3300025910 Ga0207684_10004947 Ga0207684_100049475 343
144 3300025914 Ga0207671_10001381 Ga0207671_1000138124 343
145 3300025914 Ga0207671_10250818 Ga0207671_102508182 343
146 3300025915 Ga0207693_10140233 Ga0207693_101402332 343
147 3300025916 Ga0207663_10011581 Ga0207663_100115812 343
148 3300025918 Ga0207662_10041986 Ga0207662_100419864 343
149 3300025920 Ga0207649_10000307 Ga0207649_1000030719 343
150 3300025926 Ga0207659_10055871 Ga0207659_100558714 343
151 3300025928 Ga0207700_10138938 Ga0207700_101389381 343
152 3300025932 Ga0207690_10099157 Ga0207690_100991572 343
153 3300025936 Ga0207670_10016908 Ga0207670_100169085 343
154 3300025939 Ga0207665_10090635 Ga0207665_100906353 343
155 3300025939 Ga0207665_10127530 Ga0207665_101275302 343
156 3300025939 Ga0207665_10188177 Ga0207665_101881772 343
157 3300025941 Ga0207711_10072736 Ga0207711_100727363 343
158 3300025941 Ga0207711_10122734 Ga0207711_101227342 343
159 3300026035 Ga0207703_10011295 Ga0207703_100112953 343
160 3300026035 Ga0207703_10071655 Ga0207703_100716553 343
161 3300026067 Ga0207678_10022711 Ga0207678_100227115 343
162 3300026088 Ga0207641_10032474 Ga0207641_100324743 343
163 3300028381 Ga0268264_10070590 Ga0268264_100705904 343
164 3300028381 Ga0268264_10080510 Ga0268264_100805103 343
165 3300041503 Ga0451847_0562736 Ga0451847_0562736_374_1405 343
166 3300041512 Ga0451853_1554842 Ga0451853_1554842_3965_4996 343
167 3300046471 Ga0495650_0080762 Ga0495650_0080762_11_1042 343
168 3300046501 Ga0495607_0099242 Ga0495607_0099242_153_1184 343
169 3300046515 Ga0495620_0011102 Ga0495620_0011102_3618_4649 343
170 3300046519 Ga0495632_0010869 Ga0495632_0010869_2652_3683 343
171 3300046530 Ga0495654_0027151 Ga0495654_0027151_1616_2647 343
172 3300046542 Ga0495597_0014861 Ga0495597_0014861_1612_2643 343
173 3300046616 Ga0495668_0044538 Ga0495668_0044538_1306_2337 343
174 3300046660 Ga0495625_0027269 Ga0495625_0027269_2968_3999 343
175 3300047323 Ga0495683_0056583 Ga0495683_0056583_322_1353 343
176 3300047443 Ga0495687_084529 Ga0495687_084529_114_1145 343
177 3300048903 Ga0496100_0078674 Ga0496100_0078674_652_1731 343
178 3300048904 Ga0496101_0220170 Ga0496101_0220170_84_1166 343
179 3300048904 Ga0496101_0288879 Ga0496101_0288879_131_1210 343
180 3300048905 Ga0496102_0107116 Ga0496102_0107116_548_1630 343
181 3300048909 Ga0496106_0075541 Ga0496106_0075541_652_1731 343
182 3300048911 Ga0496108_0012367 Ga0496108_0012367_254_1336 343
183 3300048912 Ga0496109_0077982 Ga0496109_0077982_1387_2469 343
184 3300048913 Ga0496110_0117472 Ga0496110_0117472_1055_2137 343
185 3300048915 Ga0496112_0075321 Ga0496112_0075321_284_1366 343
186 3300048915 Ga0496112_0318612 Ga0496112_0318612_138_1220 343
187 3300048916 Ga0496113_0071636 Ga0496113_0071636_879_1961 343
188 3300048918 Ga0496115_0142807 Ga0496115_0142807_326_1408 343
189 3300048928 Ga0496125_0037583 Ga0496125_0037583_780_1811 343
190 3300050512 nmdc:mga0n895_195410_c1 nmdc:mga0n895_195410_c1_220_1302 343
191 3300050512 nmdc:mga0n895_408673_c1 nmdc:mga0n895_408673_c1_144_1226 343
192 3300053109 Ga0500569_010193 Ga0500569_010193_107_1138 343
193 3300053134 Ga0500658_0003072 Ga0500658_0003072_1283_2314 343
194 3300053153 Ga0500616_0025821 Ga0500616_0025821_1785_2816 343

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

14

321

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i7g-assembly1.cif.gz_A crystal structure of monooxygenase from agrobacterium tumefaciens 0.9568 1 342
2i7g-assembly1.cif.gz_A crystal structure of monooxygenase from agrobacterium tumefaciens 0.9486 1 342
1luc-assembly1.cif.gz_A bacterial luciferase 0.8895 1 337
7bip-assembly1.cif.gz_B crystal structure of monooxygenase rslo1 from streptomyces bottropensis 0.8847 1 337
7bip-assembly1.cif.gz_B crystal structure of monooxygenase rslo1 from streptomyces bottropensis 0.8746 1 337
ID Description Score Start End Superfamily
af_Q2G136_3_353_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9597 1 342 3.20.20.30
2i7gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9546 1 342 3.20.20.30
2i7gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9463 1 342 3.20.20.30
af_Q2G136_3_353_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9461 1 342 3.20.20.30
6friA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8318 1 336 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A0Q4R497-F1-model_v4 Luciferase-like domain-containing protein 0.9856 1 105 GO:0004497
GO:0005829
GO:0016705
AF-H1S7G3-F1-model_v4 Oxidoreductase 0.9847 2 86 GO:0004497
GO:0005829
GO:0016705
AF-A0A0M8K769-F1-model_v4 Luciferase 0.9813 1 342 GO:0004497
GO:0005829
GO:0016705
AF-A0A421AYI2-F1-model_v4 Luciferase-like monooxygenase 0.9811 1 94 GO:0004497
GO:0005829
GO:0016705
AF-A0A535JPW7-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9795 1 280 GO:0004497
GO:0005829
GO:0016705

Feature Viewer

pLDDT pTM Quality
92.16 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map