F299110

General Info

Members Datasets Scaffolds Average Seq Length
194 122 194 168

Family's Representative Sequence

Representative Sequence 3300046517|Ga0495630_0000408|Ga0495630_0000408_19058_19603
Length 181
Sequence VSARALIAFLAVCAVLGLLVYGLASKGSSRIAVGDPVPDRPLPYLSGGKGDGRIADYRGDWVLVNLWASWCGPCRREAPVLERFYRRFRRQGVTVVGINVEDNEADARAFLSEFQPSYPELRSRGAERSEAFGATGVPENYLVDPHGRLALPIVGPVDEEILTREVVPLIGTEVPVVGSKG

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
33 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
60 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
61 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
62 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
63 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
64 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
65 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
66 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
67 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
68 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
69 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
70 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
71 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
72 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
73 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
74 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
75 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
76 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
77 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
78 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
79 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
80 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
81 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
82 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
83 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
84 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
85 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
86 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
87 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
88 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
89 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
90 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
91 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
92 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
93 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
94 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
95 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
96 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
97 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
98 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
99 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
100 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
101 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
102 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
103 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
104 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
108 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
109 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
114 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
115 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
116 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
117 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
118 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
119 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
120 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
121 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
122 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.89
Rhizosphere 86.08
Stem 0
Stem Tuber 0
Unclassified 1.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000237 3300001977 Bacteria 7629
2 Ga0070683_100076359 3300005329 Bacteria 3131
3 Ga0070683_100149814 3300005329 Bacteria 2212
4 Ga0070677_10000004 3300005333 Bacteria 81101
5 Ga0070680_100113897 3300005336 Bacteria 2253
6 Ga0070682_100000013 3300005337 Bacteria 254641
7 Ga0070674_100000008 3300005356 Bacteria 143844
8 Ga0070674_100000029 3300005356 Bacteria 69489
9 Ga0070673_100018841 3300005364 Bacteria 4945
10 Ga0070714_100265778 3300005435 Bacteria 1590
11 Ga0070678_100410811 3300005456 Bacteria 1178
12 Ga0070681_10119226 3300005458 Bacteria 2575
13 Ga0070681_10514594 3300005458 Bacteria 1110
14 Ga0070679_100001522 3300005530 Bacteria 20653
15 Ga0070679_100448193 3300005530 Bacteria 1235
16 Ga0070684_100001272 3300005535 Bacteria 18055
17 Ga0070684_100191381 3300005535 Bacteria 1862
18 Ga0068853_100009812 3300005539 Bacteria 7725
19 Ga0068853_100394343 3300005539 Bacteria 1295
20 Ga0070665_100000106 3300005548 Bacteria 157315
21 Ga0068855_100466711 3300005563 Bacteria 1376
22 Ga0068856_100013668 3300005614 Bacteria 7849
23 Ga0068866_10000001 3300005718 Bacteria 519680
24 Ga0068866_10000237 3300005718 Bacteria 25933
25 Ga0068863_100157517 3300005841 Bacteria 2175
26 Ga0068858_100000216 3300005842 Bacteria 62188
27 Ga0068860_100029239 3300005843 Bacteria 5300
28 Ga0081540_1000139 3300005983 Bacteria 76578
29 Ga0081540_1105630 3300005983 Bacteria 1202
30 Ga0070715_10000001 3300006163 Bacteria 693690
31 Ga0105240_11320200 3300009093 Unclassified 760
32 Ga0105245_10000016 3300009098 Bacteria 204372
33 Ga0105245_10000454 3300009098 Bacteria 37583
34 Ga0105245_11972545 3300009098 Bacteria 637
35 Ga0105243_10049067 3300009148 Bacteria 3330
36 Ga0105242_10045025 3300009176 Bacteria 3575
37 Ga0105238_10000011 3300009551 Bacteria 261080
38 Ga0105249_10000068 3300009553 Bacteria 148594
39 Ga0157370_10325966 3300013104 Bacteria 1416
40 Ga0157374_10007133 3300013296 Bacteria 9519
41 Ga0157374_10195629 3300013296 Bacteria 1979
42 Ga0157375_10002277 3300013308 Bacteria 16605
43 Ga0157375_10441073 3300013308 Bacteria 1468
44 Ga0163161_10000035 3300017792 Bacteria 155979
45 Ga0207682_10000031 3300025893 Bacteria 57806
46 Ga0207642_10000002 3300025899 Bacteria 658166
47 Ga0207642_10000122 3300025899 Bacteria 21318
48 Ga0207685_10000036 3300025905 Bacteria 65666
49 Ga0207707_10286394 3300025912 Bacteria 1426
50 Ga0207695_10747741 3300025913 Bacteria 858
51 Ga0207663_10002248 3300025916 Bacteria 9233
52 Ga0207649_10834103 3300025920 Bacteria 721
53 Ga0207652_10005524 3300025921 Bacteria 10249
54 Ga0207694_10000004 3300025924 Bacteria 967075
55 Ga0207687_10000018 3300025927 Bacteria 236159
56 Ga0207687_10004954 3300025927 Bacteria 8836
57 Ga0207664_10203328 3300025929 Bacteria 1711
58 Ga0207686_10005949 3300025934 Bacteria 6551
59 Ga0207709_10142495 3300025935 Bacteria 1649
60 Ga0207669_10000004 3300025937 Bacteria 196828
61 Ga0207669_10000012 3300025937 Bacteria 138242
62 Ga0207661_10004878 3300025944 Bacteria 9402
63 Ga0207661_10031614 3300025944 Bacteria 4092
64 Ga0207661_10111441 3300025944 Bacteria 2315
65 Ga0207667_10140347 3300025949 Bacteria 2488
66 Ga0207651_10010923 3300025960 Bacteria 5056
67 Ga0207712_10000007 3300025961 Bacteria 539589
68 Ga0207703_10000023 3300026035 Bacteria 222018
69 Ga0207703_10000152 3300026035 Bacteria 79658
70 Ga0207639_10004799 3300026041 Bacteria 9122
71 Ga0207639_10133432 3300026041 Bacteria 2059
72 Ga0207702_10003484 3300026078 Bacteria 14344
73 Ga0207641_10204663 3300026088 Bacteria 1822
74 Ga0207648_10000872 3300026089 Bacteria 33984
75 Ga0207683_10359186 3300026121 Bacteria 1338
76 Ga0207683_10771551 3300026121 Unclassified 892
77 Ga0268266_10000047 3300028379 Bacteria 310996
78 Ga0268264_10006655 3300028381 Bacteria 9721
79 Ga0307511_10099173 3300030521 Bacteria 1924
80 Ga0373955_0393033 3300035172 Bacteria 842
81 Ga0373937_0011426 3300036401 Bacteria 7793
82 Ga0373937_0616955 3300036401 Bacteria 1029
83 Ga0373937_0744040 3300036401 Bacteria 928
84 Ga0466967_0253089 3300045976 Bacteria 1683
85 Ga0466967_0809695 3300045976 Bacteria 930
86 Ga0495592_0018404 3300046454 Bacteria 5312
87 Ga0495603_0001695 3300046455 Bacteria 12959
88 Ga0495629_0058165 3300046459 Bacteria 2703
89 Ga0495629_0075439 3300046459 Bacteria 2355
90 Ga0495641_0000044 3300046461 Bacteria 77415
91 Ga0495641_0015299 3300046461 Bacteria 4104
92 Ga0495653_0094722 3300046463 Bacteria 2175
93 Ga0495653_0184452 3300046463 Bacteria 1429
94 Ga0495639_0156300 3300046475 Bacteria 1102
95 Ga0495662_0000061 3300046476 Bacteria 37295
96 Ga0495664_0097143 3300046477 Bacteria 1773
97 Ga0495594_0000003 3300046499 Bacteria 199267
98 Ga0495608_0001531 3300046511 Bacteria 16466
99 Ga0495608_0005242 3300046511 Bacteria 9263
100 Ga0495618_0000594 3300046514 Bacteria 25841
101 Ga0495620_0000144 3300046515 Bacteria 58204
102 Ga0495620_0075178 3300046515 Bacteria 1375
103 Ga0495628_0002033 3300046516 Bacteria 18335
104 Ga0495628_0011925 3300046516 Bacteria 7331
105 Ga0495628_0056743 3300046516 Bacteria 3082
106 Ga0495628_0067393 3300046516 Bacteria 2795
107 Ga0495628_0369949 3300046516 Bacteria 1051
108 Ga0495628_0631418 3300046516 Bacteria 762
109 Ga0495630_0000408 3300046517 Bacteria 33471
110 Ga0495630_0000541 3300046517 Bacteria 27642
111 Ga0495637_0088856 3300046520 Bacteria 1222
112 Ga0495652_0332795 3300046529 Bacteria 1093
113 Ga0495640_0003352 3300046533 Bacteria 12891
114 Ga0495640_0322696 3300046533 Bacteria 956
115 Ga0495586_0451062 3300046535 Bacteria 741
116 Ga0495587_0300536 3300046536 Bacteria 898
117 Ga0495587_0376854 3300046536 Bacteria 789
118 Ga0495621_0133995 3300046539 Bacteria 965
119 Ga0495645_0012086 3300046543 Bacteria 6083
120 Ga0495645_0066803 3300046543 Bacteria 2597
121 Ga0495645_0093703 3300046543 Bacteria 2143
122 Ga0495622_0000133 3300046557 Bacteria 63562
123 Ga0495656_0072154 3300046615 Unclassified 1536
124 Ga0495634_0000247 3300046642 Bacteria 50931
125 Ga0495634_0013773 3300046642 Bacteria 5840
126 Ga0495634_0161613 3300046642 Bacteria 1412
127 Ga0495634_0237741 3300046642 Bacteria 1118
128 Ga0495635_0000016 3300046663 Bacteria 214088
129 Ga0495635_0026906 3300046663 Bacteria 4000
130 Ga0495657_0056231 3300046675 Bacteria 2621
131 Ga0495599_0002223 3300046678 Bacteria 11296
132 Ga0495647_0000008 3300046681 Bacteria 101193
133 Ga0495647_0001061 3300046681 Bacteria 8370
134 Ga0495669_0000211 3300046684 Bacteria 35387
135 Ga0495613_0000203 3300046689 Bacteria 58232
136 Ga0495613_0013203 3300046689 Bacteria 6138
137 Ga0495624_0008756 3300046690 Bacteria 7039
138 Ga0495649_0001624 3300046694 Bacteria 16726
139 Ga0495600_0000779 3300046809 Bacteria 16825
140 Ga0495600_0258914 3300046809 Bacteria 1105
141 Ga0495604_0000019 3300047317 Bacteria 175064
142 Ga0495604_0106185 3300047317 Bacteria 2054
143 Ga0495674_0709808 3300047319 Bacteria 789
144 Ga0495676_0001103 3300047321 Bacteria 22908
145 Ga0495680_0002092 3300047322 Bacteria 20739
146 Ga0495680_0130699 3300047322 Bacteria 1845
147 Ga0495680_0166387 3300047322 Bacteria 1599
148 Ga0495680_0399269 3300047322 Bacteria 949
149 Ga0495685_005972 3300047447 Bacteria 3977
150 Ga0495684_0155405 3300047471 Bacteria 1709
151 Ga0495684_0416752 3300047471 Bacteria 940
152 Ga0495684_0637784 3300047471 Bacteria 714
153 Ga0495593_0075161 3300047673 Bacteria 1752
154 Ga0495602_0011518 3300048088 Bacteria 9138
155 Ga0496100_0000002 3300048903 Bacteria 489057
156 Ga0496100_0000018 3300048903 Bacteria 162451
157 Ga0496101_0000001 3300048904 Bacteria 489057
158 Ga0496101_0000062 3300048904 Bacteria 126595
159 Ga0496104_0000009 3300048907 Bacteria 488055
160 Ga0496104_0538160 3300048907 Bacteria 1079
161 Ga0496105_0000007 3300048908 Bacteria 339658
162 Ga0496105_0294130 3300048908 Bacteria 1307
163 Ga0496106_0000061 3300048909 Bacteria 86524
164 Ga0496106_0000081 3300048909 Bacteria 76468
165 Ga0496106_0000145 3300048909 Bacteria 52447
166 Ga0496107_0000006 3300048910 Bacteria 258746
167 Ga0496107_0000013 3300048910 Bacteria 178284
168 Ga0496107_0161628 3300048910 Bacteria 1660
169 Ga0496107_0856868 3300048910 Unclassified 664
170 Ga0496108_0000001 3300048911 Bacteria 919044
171 Ga0496109_0000003 3300048912 Bacteria 420862
172 Ga0496110_0071815 3300048913 Bacteria 3070
173 Ga0496110_0157101 3300048913 Bacteria 2060
174 Ga0496111_0058519 3300048914 Bacteria 2790
175 Ga0496111_0222998 3300048914 Bacteria 1401
176 Ga0496112_0000003 3300048915 Bacteria 660147
177 Ga0496112_0124478 3300048915 Bacteria 2549
178 Ga0496112_0584533 3300048915 Bacteria 1049
179 Ga0496113_0007082 3300048916 Bacteria 7178
180 Ga0496125_0145752 3300048928 Bacteria 1637
181 Ga0501081_0107919 3300049743 Bacteria 1974
182 nmdc:mga0a205_540_c1 3300050515 Bacteria 29856
183 Ga0495601_0000326 3300053077 Bacteria 25282
184 Ga0495601_0193343 3300053077 Bacteria 1330
185 Ga0495612_0006007 3300053078 Bacteria 5002
186 Ga0495612_0008927 3300053078 Bacteria 4063
187 Ga0495612_0015974 3300053078 Bacteria 3008
188 Ga0495595_0000591 3300053084 Bacteria 13851
189 Ga0495619_0000025 3300053085 Bacteria 167905
190 Ga0495619_0001746 3300053085 Bacteria 14440
191 Ga0495619_0002364 3300053085 Bacteria 12403
192 Ga0495619_0038876 3300053085 Bacteria 3105
193 Ga0495619_0127281 3300053085 Bacteria 1749
194 Ga0495619_0517201 3300053085 Bacteria 820

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100149814 Ga0070683_1001498141 152
2 3300005535 Ga0070684_100001272 Ga0070684_10000127213 152
3 3300025944 Ga0207661_10031614 Ga0207661_100316141 152
4 3300048907 Ga0496104_0538160 Ga0496104_0538160_78_569 152
5 3300048908 Ga0496105_0294130 Ga0496105_0294130_536_1027 152
6 3300005329 Ga0070683_100076359 Ga0070683_1000763594 157
7 3300005337 Ga0070682_100000013 Ga0070682_10000001392 157
8 3300005356 Ga0070674_100000008 Ga0070674_10000000824 157
9 3300005535 Ga0070684_100191381 Ga0070684_1001913814 157
10 3300005539 Ga0068853_100009812 Ga0068853_10000981212 157
11 3300005614 Ga0068856_100013668 Ga0068856_1000136684 157
12 3300005718 Ga0068866_10000237 Ga0068866_100002378 157
13 3300009098 Ga0105245_11972545 Ga0105245_119725451 157
14 3300009148 Ga0105243_10049067 Ga0105243_100490674 157
15 3300009176 Ga0105242_10045025 Ga0105242_100450254 157
16 3300025899 Ga0207642_10000122 Ga0207642_1000012210 157
17 3300025920 Ga0207649_10834103 Ga0207649_108341032 157
18 3300025934 Ga0207686_10005949 Ga0207686_100059494 157
19 3300025935 Ga0207709_10142495 Ga0207709_101424952 157
20 3300025937 Ga0207669_10000004 Ga0207669_10000004184 157
21 3300025944 Ga0207661_10111441 Ga0207661_101114411 157
22 3300026041 Ga0207639_10004799 Ga0207639_100047997 157
23 3300026078 Ga0207702_10003484 Ga0207702_100034847 157
24 3300035172 Ga0373955_0393033 Ga0373955_0393033_107_622 157
25 3300036401 Ga0373937_0011426 Ga0373937_0011426_6353_6868 157
26 3300036401 Ga0373937_0616955 Ga0373937_0616955_21_536 157
27 3300046461 Ga0495641_0000044 Ga0495641_0000044_46518_47078 157
28 3300046463 Ga0495653_0184452 Ga0495653_0184452_547_1062 157
29 3300046516 Ga0495628_0011925 Ga0495628_0011925_5343_5858 157
30 3300046516 Ga0495628_0056743 Ga0495628_0056743_1955_2470 157
31 3300046535 Ga0495586_0451062 Ga0495586_0451062_58_573 157
32 3300046642 Ga0495634_0161613 Ga0495634_0161613_458_979 157
33 3300046809 Ga0495600_0258914 Ga0495600_0258914_201_716 157
34 3300047322 Ga0495680_0399269 Ga0495680_0399269_136_651 157
35 3300048913 Ga0496110_0071815 Ga0496110_0071815_148_663 157
36 3300048914 Ga0496111_0058519 Ga0496111_0058519_426_941 157
37 3300048915 Ga0496112_0584533 Ga0496112_0584533_145_660 157
38 3300053078 Ga0495612_0006007 Ga0495612_0006007_1998_2513 157
39 3300053085 Ga0495619_0038876 Ga0495619_0038876_2367_2882 157
40 3300053085 Ga0495619_0127281 Ga0495619_0127281_998_1513 157
41 3300005364 Ga0070673_100018841 Ga0070673_1000188414 158
42 3300005456 Ga0070678_100410811 Ga0070678_1004108112 158
43 3300005458 Ga0070681_10514594 Ga0070681_105145942 158
44 3300005530 Ga0070679_100448193 Ga0070679_1004481932 158
45 3300005548 Ga0070665_100000106 Ga0070665_100000106124 158
46 3300005842 Ga0068858_100000216 Ga0068858_10000021640 158
47 3300005843 Ga0068860_100029239 Ga0068860_1000292392 158
48 3300005983 Ga0081540_1000139 Ga0081540_100013979 158
49 3300005983 Ga0081540_1105630 Ga0081540_11056302 158
50 3300006163 Ga0070715_10000001 Ga0070715_10000001276 158
51 3300009098 Ga0105245_10000454 Ga0105245_100004547 158
52 3300013296 Ga0157374_10195629 Ga0157374_101956293 158
53 3300025905 Ga0207685_10000036 Ga0207685_1000003663 158
54 3300025927 Ga0207687_10004954 Ga0207687_100049547 158
55 3300025944 Ga0207661_10004878 Ga0207661_100048788 158
56 3300025960 Ga0207651_10010923 Ga0207651_100109234 158
57 3300026035 Ga0207703_10000023 Ga0207703_10000023186 158
58 3300026121 Ga0207683_10359186 Ga0207683_103591863 158
59 3300026121 Ga0207683_10771551 Ga0207683_107715512 158
60 3300028379 Ga0268266_10000047 Ga0268266_10000047276 158
61 3300028381 Ga0268264_10006655 Ga0268264_100066554 158
62 3300046459 Ga0495629_0075439 Ga0495629_0075439_1604_2122 158
63 3300046461 Ga0495641_0015299 Ga0495641_0015299_942_1460 158
64 3300046475 Ga0495639_0156300 Ga0495639_0156300_166_687 158
65 3300046515 Ga0495620_0075178 Ga0495620_0075178_582_1100 158
66 3300046516 Ga0495628_0369949 Ga0495628_0369949_284_802 158
67 3300046529 Ga0495652_0332795 Ga0495652_0332795_416_934 158
68 3300046543 Ga0495645_0066803 Ga0495645_0066803_133_651 158
69 3300046642 Ga0495634_0013773 Ga0495634_0013773_3775_4293 158
70 3300046681 Ga0495647_0000008 Ga0495647_0000008_71863_72384 158
71 3300046694 Ga0495649_0001624 Ga0495649_0001624_4335_4856 158
72 3300047317 Ga0495604_0000019 Ga0495604_0000019_128601_129122 158
73 3300047317 Ga0495604_0106185 Ga0495604_0106185_1138_1659 158
74 3300047321 Ga0495676_0001103 Ga0495676_0001103_931_1452 158
75 3300047673 Ga0495593_0075161 Ga0495593_0075161_115_633 158
76 3300048088 Ga0495602_0011518 Ga0495602_0011518_2279_2800 158
77 3300048903 Ga0496100_0000018 Ga0496100_0000018_91579_92100 158
78 3300048904 Ga0496101_0000062 Ga0496101_0000062_101127_101648 158
79 3300048909 Ga0496106_0000081 Ga0496106_0000081_70047_70568 158
80 3300048909 Ga0496106_0000145 Ga0496106_0000145_32398_32919 158
81 3300048910 Ga0496107_0000006 Ga0496107_0000006_160502_161023 158
82 3300048910 Ga0496107_0856868 Ga0496107_0856868_58_579 158
83 3300048913 Ga0496110_0157101 Ga0496110_0157101_1474_1992 158
84 3300048914 Ga0496111_0222998 Ga0496111_0222998_291_809 158
85 3300048915 Ga0496112_0124478 Ga0496112_0124478_733_1251 158
86 3300049743 Ga0501081_0107919 Ga0501081_0107919_238_762 158
87 3300053077 Ga0495601_0000326 Ga0495601_0000326_19761_20279 158
88 3300053077 Ga0495601_0193343 Ga0495601_0193343_285_803 158
89 3300053078 Ga0495612_0015974 Ga0495612_0015974_870_1388 158
90 3300001977 JGI24746J21847_1000237 JGI24746J21847_10002376 159
91 3300005333 Ga0070677_10000004 Ga0070677_1000000435 159
92 3300005336 Ga0070680_100113897 Ga0070680_1001138971 159
93 3300005356 Ga0070674_100000029 Ga0070674_10000002921 159
94 3300005435 Ga0070714_100265778 Ga0070714_1002657783 159
95 3300005458 Ga0070681_10119226 Ga0070681_101192264 159
96 3300005530 Ga0070679_100001522 Ga0070679_10000152216 159
97 3300005539 Ga0068853_100394343 Ga0068853_1003943433 159
98 3300005563 Ga0068855_100466711 Ga0068855_1004667113 159
99 3300005718 Ga0068866_10000001 Ga0068866_10000001302 159
100 3300005841 Ga0068863_100157517 Ga0068863_1001575173 159
101 3300009093 Ga0105240_11320200 Ga0105240_113202001 159
102 3300009098 Ga0105245_10000016 Ga0105245_1000001658 159
103 3300009551 Ga0105238_10000011 Ga0105238_10000011120 159
104 3300009553 Ga0105249_10000068 Ga0105249_10000068141 159
105 3300013104 Ga0157370_10325966 Ga0157370_103259662 159
106 3300013296 Ga0157374_10007133 Ga0157374_100071335 159
107 3300013308 Ga0157375_10002277 Ga0157375_100022779 159
108 3300013308 Ga0157375_10441073 Ga0157375_104410732 159
109 3300017792 Ga0163161_10000035 Ga0163161_1000003523 159
110 3300025893 Ga0207682_10000031 Ga0207682_1000003132 159
111 3300025899 Ga0207642_10000002 Ga0207642_1000000222 159
112 3300025912 Ga0207707_10286394 Ga0207707_102863942 159
113 3300025913 Ga0207695_10747741 Ga0207695_107477412 159
114 3300025916 Ga0207663_10002248 Ga0207663_100022488 159
115 3300025921 Ga0207652_10005524 Ga0207652_100055246 159
116 3300025924 Ga0207694_10000004 Ga0207694_10000004503 159
117 3300025927 Ga0207687_10000018 Ga0207687_10000018166 159
118 3300025929 Ga0207664_10203328 Ga0207664_102033283 159
119 3300025937 Ga0207669_10000012 Ga0207669_10000012121 159
120 3300025949 Ga0207667_10140347 Ga0207667_101403473 159
121 3300025961 Ga0207712_10000007 Ga0207712_10000007294 159
122 3300026035 Ga0207703_10000152 Ga0207703_1000015213 159
123 3300026041 Ga0207639_10133432 Ga0207639_101334325 159
124 3300026088 Ga0207641_10204663 Ga0207641_102046633 159
125 3300026089 Ga0207648_10000872 Ga0207648_100008724 159
126 3300030521 Ga0307511_10099173 Ga0307511_100991733 159
127 3300036401 Ga0373937_0744040 Ga0373937_0744040_339_863 159
128 3300045976 Ga0466967_0253089 Ga0466967_0253089_986_1516 159
129 3300045976 Ga0466967_0809695 Ga0466967_0809695_110_634 159
130 3300046454 Ga0495592_0018404 Ga0495592_0018404_2834_3355 159
131 3300046455 Ga0495603_0001695 Ga0495603_0001695_7454_7975 159
132 3300046459 Ga0495629_0058165 Ga0495629_0058165_539_1060 159
133 3300046463 Ga0495653_0094722 Ga0495653_0094722_497_1018 159
134 3300046476 Ga0495662_0000061 Ga0495662_0000061_35449_35970 159
135 3300046477 Ga0495664_0097143 Ga0495664_0097143_94_615 159
136 3300046499 Ga0495594_0000003 Ga0495594_0000003_138516_139037 159
137 3300046511 Ga0495608_0001531 Ga0495608_0001531_7432_7953 159
138 3300046511 Ga0495608_0005242 Ga0495608_0005242_3012_3536 159
139 3300046514 Ga0495618_0000594 Ga0495618_0000594_25191_25712 159
140 3300046515 Ga0495620_0000144 Ga0495620_0000144_29539_30060 159
141 3300046516 Ga0495628_0002033 Ga0495628_0002033_1538_2059 159
142 3300046516 Ga0495628_0067393 Ga0495628_0067393_1526_2047 159
143 3300046516 Ga0495628_0631418 Ga0495628_0631418_110_637 159
144 3300046517 Ga0495630_0000408 Ga0495630_0000408_19058_19603 159
145 3300046517 Ga0495630_0000541 Ga0495630_0000541_15358_15879 159
146 3300046520 Ga0495637_0088856 Ga0495637_0088856_503_1024 159
147 3300046533 Ga0495640_0003352 Ga0495640_0003352_1893_2414 159
148 3300046533 Ga0495640_0322696 Ga0495640_0322696_274_819 159
149 3300046536 Ga0495587_0300536 Ga0495587_0300536_300_821 159
150 3300046536 Ga0495587_0376854 Ga0495587_0376854_105_629 159
151 3300046539 Ga0495621_0133995 Ga0495621_0133995_371_898 159
152 3300046543 Ga0495645_0012086 Ga0495645_0012086_4838_5359 159
153 3300046543 Ga0495645_0093703 Ga0495645_0093703_673_1194 159
154 3300046557 Ga0495622_0000133 Ga0495622_0000133_62446_62967 159
155 3300046615 Ga0495656_0072154 Ga0495656_0072154_82_603 159
156 3300046642 Ga0495634_0000247 Ga0495634_0000247_15019_15540 159
157 3300046642 Ga0495634_0237741 Ga0495634_0237741_453_974 159
158 3300046663 Ga0495635_0000016 Ga0495635_0000016_137258_137863 159
159 3300046663 Ga0495635_0026906 Ga0495635_0026906_1586_2110 159
160 3300046675 Ga0495657_0056231 Ga0495657_0056231_57_602 159
161 3300046678 Ga0495599_0002223 Ga0495599_0002223_3982_4503 159
162 3300046681 Ga0495647_0001061 Ga0495647_0001061_1880_2401 159
163 3300046684 Ga0495669_0000211 Ga0495669_0000211_5675_6196 159
164 3300046689 Ga0495613_0000203 Ga0495613_0000203_26762_27283 159
165 3300046689 Ga0495613_0013203 Ga0495613_0013203_472_993 159
166 3300046690 Ga0495624_0008756 Ga0495624_0008756_592_1113 159
167 3300046809 Ga0495600_0000779 Ga0495600_0000779_13708_14229 159
168 3300047319 Ga0495674_0709808 Ga0495674_0709808_186_731 159
169 3300047322 Ga0495680_0002092 Ga0495680_0002092_7126_7647 159
170 3300047322 Ga0495680_0130699 Ga0495680_0130699_217_738 159
171 3300047322 Ga0495680_0166387 Ga0495680_0166387_972_1496 159
172 3300047447 Ga0495685_005972 Ga0495685_005972_1124_1645 159
173 3300047471 Ga0495684_0155405 Ga0495684_0155405_164_685 159
174 3300047471 Ga0495684_0416752 Ga0495684_0416752_333_854 159
175 3300047471 Ga0495684_0637784 Ga0495684_0637784_122_667 159
176 3300048903 Ga0496100_0000002 Ga0496100_0000002_289496_290017 159
177 3300048904 Ga0496101_0000001 Ga0496101_0000001_289496_290017 159
178 3300048907 Ga0496104_0000009 Ga0496104_0000009_163241_163762 159
179 3300048908 Ga0496105_0000007 Ga0496105_0000007_324294_324815 159
180 3300048909 Ga0496106_0000061 Ga0496106_0000061_61225_61746 159
181 3300048910 Ga0496107_0000013 Ga0496107_0000013_116540_117061 159
182 3300048910 Ga0496107_0161628 Ga0496107_0161628_535_1062 159
183 3300048911 Ga0496108_0000001 Ga0496108_0000001_579019_579540 159
184 3300048912 Ga0496109_0000003 Ga0496109_0000003_253565_254086 159
185 3300048915 Ga0496112_0000003 Ga0496112_0000003_36591_37118 159
186 3300048916 Ga0496113_0007082 Ga0496113_0007082_3743_4270 159
187 3300048928 Ga0496125_0145752 Ga0496125_0145752_243_764 159
188 3300050515 nmdc:mga0a205_540_c1 nmdc:mga0a205_540_c1_13658_14182 159
189 3300053078 Ga0495612_0008927 Ga0495612_0008927_3468_3995 159
190 3300053084 Ga0495595_0000591 Ga0495595_0000591_5434_5955 159
191 3300053085 Ga0495619_0000025 Ga0495619_0000025_5462_5983 159
192 3300053085 Ga0495619_0001746 Ga0495619_0001746_1183_1707 159
193 3300053085 Ga0495619_0002364 Ga0495619_0002364_10990_11544 159
194 3300053085 Ga0495619_0517201 Ga0495619_0517201_17_538 159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

33

151

0.94

PF08534

Redoxin

Redoxin

32

167

0.94

PF13905

Thioredoxin_8

Thioredoxin-like

59

149

0.93

PF00085

Thioredoxin

Thioredoxin

51

143

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nmu-assembly2.cif.gz_B crystal structure of thiol-disulfide oxidoreductase from bacillus str. 'ames ancestor' 0.9242 16 155
1st9-assembly2.cif.gz_B crystal structure of a soluble domain of resa in the oxidised form 0.9152 21 147
4nmu-assembly2.cif.gz_B crystal structure of thiol-disulfide oxidoreductase from bacillus str. 'ames ancestor' 0.9118 16 155
2eiq-assembly1.cif.gz_A design of disulfide-linked thioredoxin dimers and multimers through analysis of crystal contacts 0.9091 45 149
2h19-assembly2.cif.gz_B crystal structure of resa cys77ala variant 0.9085 21 147
ID Description Score Start End Superfamily
1st9A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9149 20 147 3.40.30.10
3iosA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9041 26 147 3.40.30.10
4grfA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8972 16 155 3.40.30.10
af_Q9N357_1_108_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8967 40 148 3.40.30.10
1kngA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8917 21 157 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7Y5X2U9-F1-model_v4 TlpA family protein disulfide reductase 0.9646 20 148 GO:0016209
GO:0016491
AF-A0A538AFZ9-F1-model_v4 TlpA family protein disulfide reductase 0.9605 20 148 GO:0016020
GO:0016209
GO:0016491
AF-A0A535YDP2-F1-model_v4 TlpA family protein disulfide reductase 0.96 20 148 GO:0016209
GO:0016491
AF-A0A838V1L4-F1-model_v4 TlpA family protein disulfide reductase 0.9594 12 153 GO:0016209
GO:0016491
AF-A0A831TPP9-F1-model_v4 TlpA family protein disulfide reductase 0.958 20 157 GO:0016020
GO:0016209
GO:0016491

Feature Viewer

pLDDT pTM Quality
86.07 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map