F299114

General Info

Members Datasets Scaffolds Average Seq Length
194 140 180 395

Family's Representative Sequence

Representative Sequence 3300046522|Ga0495643_0025973|Ga0495643_0025973_2018_3277
Length 419
Sequence LLSFCSFNGDDQPLKITTLILTLLLAISFPSKNSFGQAPVPTIHFDFYGDVIEFPFDRSSVVNFPGPLSGQAIQAFYKGVSKTDYQPILKALLSYKEQNKPDDWLFYQLIRKTAQQISPKADNYQRYTLYKWFFLSKSGYDATLAIGNDRLLFYVQCDENIYNIPFRMRDGKQYVCLNYHDYGSIDFEKEKFSEIAISNPDTHTPFSYKITQLPGFSPGDYVEKDISFSYNQTDYHFKVKLNPQVKAIFANYPVVDYESYFNTPLSKETYSSLIPSLKKYIKGMSTKDGVDYLMRFTRYAFLFKPDVENFGSEKRLTPEQTLLYDQSDCEDRAALFFCLVKEIYDLPMVVLSYPKHVTIAVKFDKPVGTPIVYNGNRYSVCEPTPQKTDLNVGQQLPELKHTAYEIVYAYTPKENAPHK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2738541278 Niastella sp. CF465 Isolate Unclassified
4 2738541302 Pedobacter sp. CF074 Isolate Unclassified
5 2739367651 Pedobacter sp. OK291 Isolate Unclassified
6 2818991437 Pedobacter terrae 518 Isolate Unclassified
7 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
8 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
9 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
10 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
11 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
12 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
13 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
14 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
15 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
77 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
78 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
109 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
110 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
111 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
114 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
115 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
116 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
117 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
118 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
121 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
122 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
132 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
133 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
134 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
135 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
136 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
137 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
138 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
139 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
140 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.78
Metatranscriptomes 0
Isolates 7.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.76
Nodule 0
Rhizoplane 0.52
Rhizosphere 82.99
Stem 0
Stem Tuber 0
Unclassified 7.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2389364 2162886007 Bacteria 2917
2 rootH1_10028029 3300003316 Bacteria 14529
3 rootL2_10284176 3300003322 Bacteria 6033
4 rootH1_10003446 3300003323 Bacteria 6523
5 rootH1_10039709 3300003323 Bacteria 14334
6 rootH1_10063784 3300003323 Bacteria 5898
7 JGI25160J50197_1000526 3300003354 Bacteria 22136
8 Ga0055530_10001196 3300003791 Bacteria 20072
9 Ga0065714_10006210 3300005288 Bacteria 6325
10 Ga0065714_10072525 3300005288 Bacteria 3351
11 Ga0065704_10002065 3300005289 Bacteria 9384
12 Ga0065715_10180414 3300005293 Bacteria 1427
13 Ga0070676_10064220 3300005328 Bacteria 2188
14 Ga0070683_100051439 3300005329 Bacteria 3815
15 Ga0070683_100162706 3300005329 Bacteria 2117
16 Ga0070690_100037188 3300005330 Unclassified 3067
17 Ga0068869_100025977 3300005334 Unclassified 4072
18 Ga0068869_100142622 3300005334 Bacteria 1851
19 Ga0070666_10032345 3300005335 Bacteria 3455
20 Ga0070666_10095057 3300005335 Bacteria 2050
21 Ga0068868_100029343 3300005338 Unclassified 4212
22 Ga0070689_100032618 3300005340 Bacteria 3962
23 Ga0070668_100016616 3300005347 Bacteria 5501
24 Ga0070669_100028409 3300005353 Bacteria 4028
25 Ga0070671_100076124 3300005355 Unclassified 2804
26 Ga0070674_100180079 3300005356 Bacteria 1618
27 Ga0070673_100009858 3300005364 Bacteria 6435
28 Ga0070673_100112720 3300005364 Bacteria 2258
29 Ga0070688_100005108 3300005365 Bacteria 6880
30 Ga0070667_100067989 3300005367 Unclassified 3031
31 Ga0070667_100212216 3300005367 Bacteria 1721
32 Ga0070678_100059290 3300005456 Unclassified 2812
33 Ga0070662_100001739 3300005457 Bacteria 13401
34 Ga0068867_100049246 3300005459 Unclassified 3101
35 Ga0068867_100165175 3300005459 Bacteria 1749
36 Ga0070685_10009395 3300005466 Bacteria 5051
37 Ga0070685_10154954 3300005466 Bacteria 1455
38 Ga0070699_100189793 3300005518 Unclassified 1825
39 Ga0070672_100046745 3300005543 Bacteria 3355
40 Ga0070686_100052569 3300005544 Bacteria 2598
41 Ga0070686_100073042 3300005544 Bacteria 2251
42 Ga0070665_100034022 3300005548 Bacteria 5125
43 Ga0070664_100065214 3300005564 Unclassified 3107
44 Ga0068859_100093645 3300005617 Unclassified 3056
45 Ga0068861_100008253 3300005719 Bacteria 7165
46 Ga0068861_100065377 3300005719 Bacteria 2801
47 Ga0068863_100037367 3300005841 Bacteria 4623
48 Ga0068858_100037894 3300005842 Bacteria 4471
49 Ga0068858_100195382 3300005842 Bacteria 1912
50 Ga0068862_100028791 3300005844 Bacteria 4679
51 Ga0068862_100133410 3300005844 Bacteria 2199
52 Ga0068862_100280355 3300005844 Unclassified 1527
53 Ga0068871_100010639 3300006358 Bacteria 6724
54 Ga0068871_100136947 3300006358 Bacteria 2080
55 Ga0075428_100014085 3300006844 Bacteria 8897
56 Ga0075428_100015489 3300006844 Bacteria 8453
57 Ga0075430_100006557 3300006846 Bacteria 9817
58 Ga0075430_100045122 3300006846 Unclassified 3724
59 Ga0075431_100040115 3300006847 Unclassified 4824
60 Ga0075431_100118637 3300006847 Unclassified 2730
61 Ga0075429_100009084 3300006880 Bacteria 8632
62 Ga0075429_100059203 3300006880 Unclassified 3336
63 Ga0097620_100093642 3300006931 Unclassified 3056
64 Ga0111539_10025483 3300009094 Bacteria 7251
65 Ga0105247_10037826 3300009101 Unclassified 2944
66 Ga0114129_10011528 3300009147 Bacteria 12590
67 Ga0114129_10272231 3300009147 Unclassified 2265
68 Ga0105243_10000011 3300009148 Bacteria 312350
69 Ga0105242_10001554 3300009176 Bacteria 18062
70 Ga0105242_10017786 3300009176 Bacteria 5546
71 Ga0105242_10181178 3300009176 Bacteria 1859
72 Ga0105249_10004183 3300009553 Bacteria 12460
73 Ga0105249_10040361 3300009553 Unclassified 4239
74 Ga0105249_10078668 3300009553 Unclassified 3060
75 Ga0105249_10252817 3300009553 Bacteria 1748
76 Ga0105239_10139349 3300010375 Bacteria 2702
77 Ga0157373_10117348 3300013100 Bacteria 1870
78 Ga0157371_10000276 3300013102 Bacteria 69547
79 Ga0157370_10050563 3300013104 Bacteria 3972
80 Ga0157369_10000040 3300013105 Bacteria 183469
81 Ga0157378_10054794 3300013297 Unclassified 3551
82 Ga0157378_10392129 3300013297 Bacteria 1366
83 Ga0163162_10029237 3300013306 Bacteria 5453
84 Ga0163162_10058817 3300013306 Bacteria 3874
85 Ga0157372_10008461 3300013307 Bacteria 10923
86 Ga0157372_10159076 3300013307 Bacteria 2610
87 Ga0157375_10000954 3300013308 Bacteria 25069
88 Ga0157375_10018960 3300013308 Bacteria 6246
89 Ga0157375_10033287 3300013308 Bacteria 4896
90 Ga0157375_10146209 3300013308 Bacteria 2495
91 Ga0163163_10023592 3300014325 Bacteria 5840
92 Ga0182008_10000363 3300014497 Bacteria 35337
93 Ga0157376_10017950 3300014969 Bacteria 5411
94 Ga0157376_10067932 3300014969 Bacteria 3016
95 Ga0182006_1000872 3300015261 Bacteria 20250
96 Ga0182006_1001491 3300015261 Bacteria 14053
97 Ga0182007_10000003 3300015262 Bacteria 548244
98 Ga0183373_1001 3300015682 Bacteria 1410374
99 Ga0163161_10003536 3300017792 Bacteria 10928
100 Ga0163161_10010337 3300017792 Bacteria 6462
101 Ga0163161_10014088 3300017792 Bacteria 5567
102 Ga0163161_10045422 3300017792 Unclassified 3168
103 Ga0163161_10048592 3300017792 Bacteria 3064
104 Ga0209676_1000008 3300025292 Bacteria 991778
105 Ga0209050_1000055 3300025298 Bacteria 339254
106 Ga0207426_1000052 3300025302 Bacteria 389825
107 Ga0207680_10006170 3300025903 Bacteria 5783
108 Ga0207645_10005822 3300025907 Bacteria 8889
109 Ga0207706_10001783 3300025933 Bacteria 21149
110 Ga0207706_10010149 3300025933 Bacteria 8619
111 Ga0207686_10191055 3300025934 Bacteria 1460
112 Ga0207670_10143357 3300025936 Unclassified 1764
113 Ga0207704_10216335 3300025938 Bacteria 1414
114 Ga0207691_10003740 3300025940 Bacteria 14756
115 Ga0207689_10002652 3300025942 Bacteria 16551
116 Ga0207689_10008385 3300025942 Bacteria 9001
117 Ga0207689_10194541 3300025942 Bacteria 1673
118 Ga0207679_10087260 3300025945 Unclassified 2402
119 Ga0207651_10144281 3300025960 Bacteria 1844
120 Ga0207712_10031473 3300025961 Bacteria 3574
121 Ga0207668_10007431 3300025972 Bacteria 6515
122 Ga0207641_10039456 3300026088 Bacteria 3949
123 Ga0207648_10006561 3300026089 Bacteria 11558
124 Ga0207648_10029860 3300026089 Bacteria 4834
125 Ga0207675_100000272 3300026118 Bacteria 49071
126 Ga0207675_100001610 3300026118 Bacteria 22621
127 Ga0207675_100009478 3300026118 Bacteria 9113
128 Ga0207698_10008451 3300026142 Bacteria 6516
129 Ga0268266_10123735 3300028379 Unclassified 2305
130 Ga0268265_10016726 3300028380 Bacteria 5046
131 Ga0268264_10227557 3300028381 Bacteria 1720
132 Ga0307513_10142666 3300031456 Bacteria 2319
133 Ga0307513_10173658 3300031456 Bacteria 2029
134 Ga0307408_100001112 3300031548 Bacteria 20510
135 Ga0307408_100010033 3300031548 Bacteria 6241
136 Ga0307405_10000003 3300031731 Bacteria 569064
137 Ga0307407_10000030 3300031903 Bacteria 97416
138 Ga0307416_100000014 3300032002 Bacteria 249053
139 Ga0307416_100023593 3300032002 Bacteria 4468
140 Ga0307414_10062472 3300032004 Bacteria 2643
141 Ga0439439_0014563 3300041406 Bacteria 1916
142 Ga0439449_0003026 3300042007 Bacteria 6561
143 Ga0439449_0014527 3300042007 Bacteria 2960
144 Ga0439457_001017 3300042014 Bacteria 8455
145 Ga0466972_0000143 3300044658 Bacteria 58694
146 Ga0466957_0000072 3300044842 Bacteria 39660
147 Ga0466957_0101137 3300044842 Unclassified 1817
148 Ga0495650_0014345 3300046471 Bacteria 4131
149 Ga0495606_0041884 3300046507 Bacteria 3068
150 Ga0495610_0000855 3300046512 Bacteria 28428
151 Ga0495637_0012358 3300046520 Bacteria 4087
152 Ga0495643_0025973 3300046522 Bacteria 3310
153 Ga0495633_0062986 3300046558 Bacteria 1736
154 Ga0495668_0000616 3300046616 Bacteria 43040
155 Ga0495672_0017390 3300047320 Bacteria 4810
156 Ga0495686_0000436 3300047472 Bacteria 64423
157 Ga0495686_0035858 3300047472 Bacteria 3185
158 Ga0495686_0049834 3300047472 Unclassified 2633
159 Ga0496110_0074539 3300048913 Unclassified 3014
160 Ga0501047_0012849 3300049581 Bacteria 7934
161 Ga0501225_0012649 3300049705 Bacteria 2368
162 Ga0501044_0028492 3300049823 Bacteria 5895
163 nmdc:mga05p37_10621_c1 3300050507 Bacteria 10923
164 nmdc:mga05p37_235617_c1 3300050507 Unclassified 2203
165 nmdc:mga09592_9887_c1 3300050508 Bacteria 7758
166 nmdc:mga0qj67_82553_c1 3300050509 Unclassified 2577
167 nmdc:mga06r32_122827_c2 3300050510 Unclassified 1998
168 nmdc:mga08y16_51279_c1 3300050511 Bacteria 4317
169 Ga0500578_0000961 3300053086 Bacteria 31954
170 Ga0500578_0064871 3300053086 Bacteria 2329
171 Ga0500583_0000009 3300053092 Bacteria 160749
172 Ga0500583_0000505 3300053092 Bacteria 11990
173 Ga0500556_0045638 3300053104 Unclassified 1564
174 Ga0500562_000027 3300053108 Bacteria 100118
175 Ga0500642_0004417 3300053130 Bacteria 4398
176 Ga0500568_0020537 3300053139 Bacteria 2855
177 Ga0500589_014196 3300053147 Bacteria 3527
178 Ga0500616_0022083 3300053153 Bacteria 3558
179 Ga0500627_0002684 3300053158 Bacteria 5329
180 Ga0500645_028749 3300053730 Bacteria 1681

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300017792 Ga0163161_10014088 Ga0163161_100140883 318
2 3300042007 Ga0439449_0003026 Ga0439449_0003026_1149_2348 321
3 3300042014 Ga0439457_001017 Ga0439457_001017_1944_3143 321
4 3300053092 Ga0500583_0000505 Ga0500583_0000505_7696_8922 321
5 3300053147 Ga0500589_014196 Ga0500589_014196_1457_2683 321
6 3300005347 Ga0070668_100016616 Ga0070668_1000166163 322
7 3300005356 Ga0070674_100180079 Ga0070674_1001800791 322
8 3300003323 rootH1_10003446 rootH1_100034462 328
9 3300005719 Ga0068861_100065377 Ga0068861_1000653772 332
10 3300009176 Ga0105242_10181178 Ga0105242_101811782 332
11 3300025934 Ga0207686_10191055 Ga0207686_101910551 332
12 3300025942 Ga0207689_10002652 Ga0207689_1000265213 332
13 3300026118 Ga0207675_100009478 Ga0207675_1000094783 332
14 3300053086 Ga0500578_0064871 Ga0500578_0064871_466_1665 334
15 3300031456 Ga0307513_10142666 Ga0307513_101426661 337
16 3300031456 Ga0307513_10173658 Ga0307513_101736581 337
17 3300053092 Ga0500583_0000009 Ga0500583_0000009_1586_2785 339
18 3300044842 Ga0466957_0101137 Ga0466957_0101137_254_1453 342
19 3300009147 Ga0114129_10011528 Ga0114129_100115284 344
20 3300050507 nmdc:mga05p37_10621_c1 nmdc:mga05p37_10621_c1_2164_3375 344
21 3300053153 Ga0500616_0022083 Ga0500616_0022083_1125_2324 347
22 3300003323 rootH1_10039709 rootH1_100397096 348
23 3300005844 Ga0068862_100133410 Ga0068862_1001334101 348
24 3300009553 Ga0105249_10252817 Ga0105249_102528172 348
25 3300013307 Ga0157372_10008461 Ga0157372_100084614 349
26 3300046616 Ga0495668_0000616 Ga0495668_0000616_26386_27585 350
27 3300053104 Ga0500556_0045638 Ga0500556_0045638_283_1482 350
28 3300053158 Ga0500627_0002684 Ga0500627_0002684_1811_2974 350
29 3300049705 Ga0501225_0012649 Ga0501225_0012649_218_1396 351
30 iso_pu_bacteria 2932082852 2932086650 357
31 2162886007 SwRhRL2b_contig_2389364 SwRhRL2b_0255.00007710 358
32 3300003316 rootH1_10028029 rootH1_100280293 358
33 3300003322 rootL2_10284176 rootL2_102841764 358
34 3300003323 rootH1_10063784 rootH1_100637843 358
35 3300003354 JGI25160J50197_1000526 JGI25160J50197_100052611 358
36 3300003791 Ga0055530_10001196 Ga0055530_100011963 358
37 3300005288 Ga0065714_10006210 Ga0065714_100062106 358
38 3300005288 Ga0065714_10072525 Ga0065714_100725253 358
39 3300005289 Ga0065704_10002065 Ga0065704_100020652 358
40 3300005293 Ga0065715_10180414 Ga0065715_101804141 358
41 3300005328 Ga0070676_10064220 Ga0070676_100642202 358
42 3300005329 Ga0070683_100051439 Ga0070683_1000514393 358
43 3300005329 Ga0070683_100162706 Ga0070683_1001627062 358
44 3300005330 Ga0070690_100037188 Ga0070690_1000371882 358
45 3300005334 Ga0068869_100025977 Ga0068869_1000259772 358
46 3300005334 Ga0068869_100142622 Ga0068869_1001426221 358
47 3300005335 Ga0070666_10032345 Ga0070666_100323453 358
48 3300005335 Ga0070666_10095057 Ga0070666_100950571 358
49 3300005338 Ga0068868_100029343 Ga0068868_1000293431 358
50 3300005340 Ga0070689_100032618 Ga0070689_1000326183 358
51 3300005353 Ga0070669_100028409 Ga0070669_1000284093 358
52 3300005355 Ga0070671_100076124 Ga0070671_1000761241 358
53 3300005364 Ga0070673_100009858 Ga0070673_1000098584 358
54 3300005364 Ga0070673_100112720 Ga0070673_1001127202 358
55 3300005365 Ga0070688_100005108 Ga0070688_1000051083 358
56 3300005367 Ga0070667_100067989 Ga0070667_1000679891 358
57 3300005367 Ga0070667_100212216 Ga0070667_1002122162 358
58 3300005456 Ga0070678_100059290 Ga0070678_1000592902 358
59 3300005457 Ga0070662_100001739 Ga0070662_10000173910 358
60 3300005459 Ga0068867_100049246 Ga0068867_1000492462 358
61 3300005459 Ga0068867_100165175 Ga0068867_1001651752 358
62 3300005466 Ga0070685_10009395 Ga0070685_100093953 358
63 3300005466 Ga0070685_10154954 Ga0070685_101549542 358
64 3300005518 Ga0070699_100189793 Ga0070699_1001897931 358
65 3300005543 Ga0070672_100046745 Ga0070672_1000467453 358
66 3300005544 Ga0070686_100052569 Ga0070686_1000525692 358
67 3300005544 Ga0070686_100073042 Ga0070686_1000730421 358
68 3300005548 Ga0070665_100034022 Ga0070665_1000340222 358
69 3300005564 Ga0070664_100065214 Ga0070664_1000652142 358
70 3300005617 Ga0068859_100093645 Ga0068859_1000936451 358
71 3300005719 Ga0068861_100008253 Ga0068861_1000082535 358
72 3300005841 Ga0068863_100037367 Ga0068863_1000373671 358
73 3300005842 Ga0068858_100037894 Ga0068858_1000378942 358
74 3300005842 Ga0068858_100195382 Ga0068858_1001953822 358
75 3300005844 Ga0068862_100028791 Ga0068862_1000287913 358
76 3300005844 Ga0068862_100280355 Ga0068862_1002803551 358
77 3300006358 Ga0068871_100010639 Ga0068871_1000106394 358
78 3300006358 Ga0068871_100136947 Ga0068871_1001369472 358
79 3300006844 Ga0075428_100014085 Ga0075428_1000140853 358
80 3300006844 Ga0075428_100015489 Ga0075428_1000154892 358
81 3300006846 Ga0075430_100006557 Ga0075430_1000065575 358
82 3300006846 Ga0075430_100045122 Ga0075430_1000451223 358
83 3300006847 Ga0075431_100040115 Ga0075431_1000401153 358
84 3300006847 Ga0075431_100118637 Ga0075431_1001186372 358
85 3300006880 Ga0075429_100009084 Ga0075429_1000090842 358
86 3300006880 Ga0075429_100059203 Ga0075429_1000592033 358
87 3300006931 Ga0097620_100093642 Ga0097620_1000936423 358
88 3300009094 Ga0111539_10025483 Ga0111539_100254834 358
89 3300009101 Ga0105247_10037826 Ga0105247_100378262 358
90 3300009147 Ga0114129_10272231 Ga0114129_102722312 358
91 3300009148 Ga0105243_10000011 Ga0105243_1000001168 358
92 3300009176 Ga0105242_10001554 Ga0105242_100015544 358
93 3300009176 Ga0105242_10017786 Ga0105242_100177863 358
94 3300009553 Ga0105249_10004183 Ga0105249_100041836 358
95 3300009553 Ga0105249_10040361 Ga0105249_100403613 358
96 3300009553 Ga0105249_10078668 Ga0105249_100786683 358
97 3300010375 Ga0105239_10139349 Ga0105239_101393492 358
98 3300013100 Ga0157373_10117348 Ga0157373_101173482 358
99 3300013102 Ga0157371_10000276 Ga0157371_1000027655 358
100 3300013104 Ga0157370_10050563 Ga0157370_100505634 358
101 3300013105 Ga0157369_10000040 Ga0157369_10000040162 358
102 3300013297 Ga0157378_10054794 Ga0157378_100547943 358
103 3300013297 Ga0157378_10392129 Ga0157378_103921291 358
104 3300013306 Ga0163162_10029237 Ga0163162_100292373 358
105 3300013306 Ga0163162_10058817 Ga0163162_100588173 358
106 3300013307 Ga0157372_10159076 Ga0157372_101590762 358
107 3300013308 Ga0157375_10000954 Ga0157375_100009543 358
108 3300013308 Ga0157375_10018960 Ga0157375_100189603 358
109 3300013308 Ga0157375_10033287 Ga0157375_100332872 358
110 3300013308 Ga0157375_10146209 Ga0157375_101462092 358
111 3300014325 Ga0163163_10023592 Ga0163163_100235923 358
112 3300014497 Ga0182008_10000363 Ga0182008_1000036310 358
113 3300014969 Ga0157376_10017950 Ga0157376_100179503 358
114 3300014969 Ga0157376_10067932 Ga0157376_100679322 358
115 3300015261 Ga0182006_1000872 Ga0182006_100087214 358
116 3300015261 Ga0182006_1001491 Ga0182006_100149110 358
117 3300015262 Ga0182007_10000003 Ga0182007_10000003455 358
118 3300015682 Ga0183373_1001 Ga0183373_1001521 358
119 3300017792 Ga0163161_10003536 Ga0163161_100035362 358
120 3300017792 Ga0163161_10010337 Ga0163161_100103374 358
121 3300017792 Ga0163161_10045422 Ga0163161_100454223 358
122 3300017792 Ga0163161_10048592 Ga0163161_100485921 358
123 3300025292 Ga0209676_1000008 Ga0209676_1000008409 358
124 3300025298 Ga0209050_1000055 Ga0209050_10000553 358
125 3300025302 Ga0207426_1000052 Ga0207426_1000052245 358
126 3300025903 Ga0207680_10006170 Ga0207680_100061703 358
127 3300025907 Ga0207645_10005822 Ga0207645_100058223 358
128 3300025933 Ga0207706_10001783 Ga0207706_100017837 358
129 3300025933 Ga0207706_10010149 Ga0207706_100101494 358
130 3300025936 Ga0207670_10143357 Ga0207670_101433571 358
131 3300025938 Ga0207704_10216335 Ga0207704_102163351 358
132 3300025940 Ga0207691_10003740 Ga0207691_1000374011 358
133 3300025942 Ga0207689_10008385 Ga0207689_100083854 358
134 3300025942 Ga0207689_10194541 Ga0207689_101945412 358
135 3300025945 Ga0207679_10087260 Ga0207679_100872602 358
136 3300025960 Ga0207651_10144281 Ga0207651_101442812 358
137 3300025961 Ga0207712_10031473 Ga0207712_100314733 358
138 3300025972 Ga0207668_10007431 Ga0207668_100074314 358
139 3300026088 Ga0207641_10039456 Ga0207641_100394562 358
140 3300026089 Ga0207648_10006561 Ga0207648_100065613 358
141 3300026089 Ga0207648_10029860 Ga0207648_100298602 358
142 3300026118 Ga0207675_100000272 Ga0207675_10000027221 358
143 3300026118 Ga0207675_100001610 Ga0207675_10000161012 358
144 3300026142 Ga0207698_10008451 Ga0207698_100084513 358
145 3300028379 Ga0268266_10123735 Ga0268266_101237352 358
146 3300028380 Ga0268265_10016726 Ga0268265_100167263 358
147 3300028381 Ga0268264_10227557 Ga0268264_102275571 358
148 3300031548 Ga0307408_100001112 Ga0307408_1000011122 358
149 3300031548 Ga0307408_100010033 Ga0307408_1000100332 358
150 3300031731 Ga0307405_10000003 Ga0307405_10000003237 358
151 3300031903 Ga0307407_10000030 Ga0307407_1000003014 358
152 3300032002 Ga0307416_100000014 Ga0307416_10000001449 358
153 3300032002 Ga0307416_100023593 Ga0307416_1000235932 358
154 3300032004 Ga0307414_10062472 Ga0307414_100624722 358
155 3300041406 Ga0439439_0014563 Ga0439439_0014563_577_1743 358
156 3300042007 Ga0439449_0014527 Ga0439449_0014527_1527_2705 358
157 3300044658 Ga0466972_0000143 Ga0466972_0000143_20742_21941 358
158 3300044842 Ga0466957_0000072 Ga0466957_0000072_11648_12856 358
159 3300046471 Ga0495650_0014345 Ga0495650_0014345_55_1266 358
160 3300046507 Ga0495606_0041884 Ga0495606_0041884_1594_2748 358
161 3300046512 Ga0495610_0000855 Ga0495610_0000855_15387_16541 358
162 3300046520 Ga0495637_0012358 Ga0495637_0012358_627_1781 358
163 3300046522 Ga0495643_0025973 Ga0495643_0025973_2018_3277 358
164 3300046558 Ga0495633_0062986 Ga0495633_0062986_219_1373 358
165 3300047320 Ga0495672_0017390 Ga0495672_0017390_209_1411 358
166 3300047472 Ga0495686_0000436 Ga0495686_0000436_48888_50063 358
167 3300047472 Ga0495686_0035858 Ga0495686_0035858_606_1793 358
168 3300047472 Ga0495686_0049834 Ga0495686_0049834_260_1468 358
169 3300048913 Ga0496110_0074539 Ga0496110_0074539_59_1264 358
170 3300049581 Ga0501047_0012849 Ga0501047_0012849_2669_3868 358
171 3300049823 Ga0501044_0028492 Ga0501044_0028492_2407_3606 358
172 3300050507 nmdc:mga05p37_235617_c1 nmdc:mga05p37_235617_c1_395_1579 358
173 3300050508 nmdc:mga09592_9887_c1 nmdc:mga09592_9887_c1_5191_6396 358
174 3300050509 nmdc:mga0qj67_82553_c1 nmdc:mga0qj67_82553_c1_20_1225 358
175 3300050510 nmdc:mga06r32_122827_c2 nmdc:mga06r32_122827_c2_336_1541 358
176 3300050511 nmdc:mga08y16_51279_c1 nmdc:mga08y16_51279_c1_2882_4087 358
177 3300053086 Ga0500578_0000961 Ga0500578_0000961_11207_12373 358
178 3300053108 Ga0500562_000027 Ga0500562_000027_51311_52510 358
179 3300053130 Ga0500642_0004417 Ga0500642_0004417_2332_3531 358
180 3300053139 Ga0500568_0020537 Ga0500568_0020537_1087_2268 358
181 3300053730 Ga0500645_028749 Ga0500645_028749_164_1363 358
182 iso_pu_bacteria 2585427687 2586209111 358
183 iso_pu_bacteria 2738541278 2738725906 358
184 iso_pu_bacteria 2738541302 2738851955 358
185 iso_pu_bacteria 2739367651 2739590840 358
186 iso_pu_bacteria 2818991437 2819546495 358
187 iso_pu_bacteria 2842722452 2842725197 358
188 iso_pu_bacteria 2842909656 2842912471 358
189 iso_pu_bacteria 2896317667 2896319674 358
190 iso_pu_bacteria 2904445276 2904446655 358
191 iso_pu_bacteria 2929154850 2929158850 358
192 iso_pu_bacteria 2945997725 2946002118 358
193 iso_pu_bacteria 2954016120 2954019020 358
194 iso_pu_bacteria 3003233435 3003237488 358

Structural Annotation

Top 5 Hits

ID Description Score Start End
8j07-assembly1.cif.gz_7 96nm repeat of human respiratory doublet microtubule and associated axonemal complexes 0.6162 229 299
2ipx-assembly1.cif.gz_A human fibrillarin 0.6134 99 130
7mq8-assembly1.cif.gz_SC cryo-em structure of the human ssu processome, state pre-a1 0.6085 89 125
3id6-assembly1.cif.gz_C-2 crystal structure of sulfolobus solfataricus nop5 (1-262) and fibrillarin complex 0.6046 89 122
7uj4-assembly1.cif.gz_B inhibition of human menin by sndx-5613 0.6 210 337
ID Description Score Start End Superfamily
af_A0A286YDU8_996_1405_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.7382 221 330 3.10.620.30
3isrC01 Alpha Beta;Roll;C8orf32 fold; 0.709 215 330 3.10.620.30
2ipxA01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.7014 99 123 3.30.200.20
af_A0A0G2K9D9_1213_1631_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.6779 221 329 3.10.620.30
af_O53920_94_280_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.6528 221 330 3.10.620.30
ID Description Score Start End GO Terms
AF-A0A519ZBB0-F1-model_v4 Uncharacterized protein 0.996 274 358
AF-A0A369PZL1-F1-model_v4 Transglutaminase domain-containing protein 0.9882 5 358
AF-A0A519NX65-F1-model_v4 deleted 0.9854 47 358
AF-A0A4Q3EVC8-F1-model_v4 DUF3825 domain-containing protein 0.9821 3 287
AF-A0A258L2A3-F1-model_v4 Transglutaminase-like domain-containing protein 0.9816 148 356

Feature Viewer

pLDDT pTM Quality
92.16 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map