F299245

General Info

Members Datasets Scaffolds Average Seq Length
194 137 388 291

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0084220|Ga0501036_0084220_968_1861
Length 257
Sequence MEASRAVLPVPGVKQIVADYVTLTKPRVQLLLLLTTITTMYVAGDPSVALVAITVVGGFLSAGGAGAFNHYYDRDIDAAMGRTSTRPVPAGRISPRAALIYAFALQAAGFIWYTLVYTVWLKRRSPQNIVIGGAAGAVPPLVGWAAVTGSIDPAALYLFAIVFYWTPPHFWALSLLMKDEYARVGVPMMPVVHGETETRRQIVLYTFLLTGLGAAFITLALRVQRRADRKSALRAYLFSLAYLAALFVAMVADAQLL

Samples

Sample ID Description Type Environment
1 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
44 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
67 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
68 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
69 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
70 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
71 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
78 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
85 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
88 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
94 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
95 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
96 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
97 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
98 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
99 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
100 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
101 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
102 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
105 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
108 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
109 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
110 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
111 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
120 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
125 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
126 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
130 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
131 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
132 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
133 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
134 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
135 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
136 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
137 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.55
Nodule 0
Rhizoplane 9.28
Rhizosphere 87.11
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501036_0084220 3300049572 Bacteria 2688
2 LJQas_1004858 3300000549 Bacteria 1730
3 Ga0070683_100070205 3300005329 Bacteria 3267
4 Ga0070683_100239317 3300005329 Bacteria 1726
5 Ga0070660_100103853 3300005339 Bacteria 2254
6 Ga0070669_100009959 3300005353 Bacteria 6761
7 Ga0070659_100000077 3300005366 Bacteria 76934
8 Ga0070659_100051653 3300005366 Bacteria 3232
9 Ga0070714_100015031 3300005435 Bacteria 6223
10 Ga0070714_100114917 3300005435 Bacteria 2388
11 Ga0070710_10000008 3300005437 Bacteria 198148
12 Ga0070705_100002297 3300005440 Bacteria 9655
13 Ga0070700_100082021 3300005441 Bacteria 2085
14 Ga0070663_100089612 3300005455 Bacteria 2277
15 Ga0070678_100154397 3300005456 Bacteria 1853
16 Ga0070678_100208135 3300005456 Bacteria 1619
17 Ga0070662_100256011 3300005457 Bacteria 1409
18 Ga0070684_100031005 3300005535 Bacteria 4548
19 Ga0070665_100113948 3300005548 Bacteria 2707
20 Ga0070664_100142753 3300005564 Bacteria 2109
21 Ga0068856_100435867 3300005614 Bacteria 1331
22 Ga0070702_100004143 3300005615 Bacteria 6588
23 Ga0068859_100414205 3300005617 Bacteria 1444
24 Ga0068861_100158097 3300005719 Bacteria 1867
25 Ga0081538_10002376 3300005981 Bacteria 18481
26 Ga0081538_10004230 3300005981 Bacteria 13314
27 Ga0081538_10026609 3300005981 Bacteria 4040
28 Ga0081539_10004197 3300005985 Bacteria 16280
29 Ga0081539_10009302 3300005985 Bacteria 8250
30 Ga0081539_10038037 3300005985 Bacteria 2857
31 Ga0081539_10073660 3300005985 Bacteria 1821
32 Ga0070717_10000004 3300006028 Bacteria 365525
33 Ga0075432_10061416 3300006058 Bacteria 1339
34 Ga0070712_100000008 3300006175 Bacteria 149644
35 Ga0070712_100004280 3300006175 Bacteria 8789
36 Ga0075428_100038608 3300006844 Bacteria 5255
37 Ga0075434_100499955 3300006871 Bacteria 1237
38 Ga0075429_100108166 3300006880 Bacteria 2430
39 Ga0097620_100414229 3300006931 Bacteria 1444
40 Ga0105240_10049726 3300009093 Bacteria 5290
41 Ga0111539_10015116 3300009094 Bacteria 9619
42 Ga0105245_10404147 3300009098 Bacteria 1366
43 Ga0114129_10003887 3300009147 Bacteria 21074
44 Ga0105243_10025695 3300009148 Bacteria 4503
45 Ga0105249_10151325 3300009553 Bacteria 2234
46 Ga0105239_10081204 3300010375 Bacteria 3568
47 Ga0105239_10311591 3300010375 Bacteria 1774
48 Ga0105246_10030063 3300011119 Bacteria 3584
49 Ga0105246_10169314 3300011119 Bacteria 1671
50 Ga0157370_10008201 3300013104 Bacteria 11287
51 Ga0157378_10697900 3300013297 Bacteria 1034
52 Ga0157372_10106867 3300013307 Bacteria 3202
53 Ga0157376_10570630 3300014969 Bacteria 1122
54 Ga0206354_10458062 3300020081 Bacteria 1525
55 Ga0213875_10000050 3300021388 Bacteria 143822
56 Ga0207426_1015614 3300025302 Bacteria 2750
57 Ga0207692_10000034 3300025898 Bacteria 45780
58 Ga0207688_10168046 3300025901 Bacteria 1303
59 Ga0207699_10327619 3300025906 Bacteria 1076
60 Ga0207643_10050570 3300025908 Bacteria 2357
61 Ga0207693_10000002 3300025915 Bacteria 304011
62 Ga0207693_10036526 3300025915 Bacteria 3873
63 Ga0207662_10044447 3300025918 Bacteria 2622
64 Ga0207657_10067594 3300025919 Bacteria 3039
65 Ga0207657_10085523 3300025919 Bacteria 2641
66 Ga0207681_10007138 3300025923 Bacteria 6850
67 Ga0207681_10039483 3300025923 Bacteria 3135
68 Ga0207664_10000006 3300025929 Bacteria 408702
69 Ga0207664_10020786 3300025929 Bacteria 4871
70 Ga0207644_10205723 3300025931 Bacteria 1554
71 Ga0207690_10000017 3300025932 Bacteria 243513
72 Ga0207709_10059536 3300025935 Bacteria 2378
73 Ga0207670_10138547 3300025936 Bacteria 1792
74 Ga0207661_10415757 3300025944 Bacteria 1221
75 Ga0207679_10023653 3300025945 Bacteria 4204
76 Ga0207651_10437462 3300025960 Bacteria 1120
77 Ga0207678_10135796 3300026067 Bacteria 2099
78 Ga0207678_10152098 3300026067 Bacteria 1976
79 Ga0207708_10021955 3300026075 Bacteria 4817
80 Ga0207648_10086777 3300026089 Bacteria 2730
81 Ga0207683_10282486 3300026121 Bacteria 1517
82 Ga0207698_10384109 3300026142 Bacteria 1337
83 Ga0265326_10000016 3300028558 Bacteria 154674
84 Ga0265334_10000076 3300028573 Bacteria 71688
85 Ga0265318_10040813 3300028577 Bacteria 1766
86 Ga0265336_10016495 3300028666 Bacteria 2415
87 Ga0265324_10002766 3300029957 Bacteria 8700
88 Ga0265327_10028454 3300031251 Bacteria 3197
89 Ga0307406_10039094 3300031901 Bacteria 2941
90 Ga0307407_10012462 3300031903 Bacteria 4086
91 Ga0307412_10116794 3300031911 Bacteria 1914
92 Ga0307409_100016951 3300031995 Bacteria 4839
93 Ga0307409_100653749 3300031995 Bacteria 1045
94 Ga0307416_100018784 3300032002 Bacteria 4882
95 Ga0307416_100055118 3300032002 Bacteria 3199
96 Ga0307416_100130708 3300032002 Bacteria 2259
97 Ga0307414_10343624 3300032004 Bacteria 1278
98 Ga0307411_10183191 3300032005 Bacteria 1592
99 Ga0307415_100012089 3300032126 Bacteria 4976
100 Ga0307415_100237626 3300032126 Bacteria 1472
101 Ga0307415_100280477 3300032126 Bacteria 1370
102 Ga0395898_0070496 3300037466 Bacteria 3379
103 Ga0395898_0132998 3300037466 Bacteria 2382
104 Ga0395898_0294162 3300037466 Bacteria 1549
105 Ga0395905_0426560 3300037471 Bacteria 1223
106 Ga0436364_0750607 3300037853 Bacteria 104121
107 Ga0395901_0263710 3300038443 Bacteria 1793
108 Ga0439440_0028763 3300042993 Bacteria 1299
109 Ga0466965_0175593 3300044683 Bacteria 1129
110 Ga0466963_0009797 3300044694 Bacteria 5781
111 Ga0466963_0017056 3300044694 Bacteria 4523
112 Ga0466963_0030546 3300044694 Bacteria 3478
113 Ga0466964_0070567 3300044706 Bacteria 1476
114 Ga0466968_0022033 3300044735 Bacteria 2586
115 Ga0466957_0047862 3300044842 Bacteria 2598
116 Ga0466957_0188001 3300044842 Bacteria 1352
117 Ga0466960_0158553 3300044901 Bacteria 1214
118 Ga0466959_0032942 3300045049 Bacteria 3835
119 Ga0466959_0328893 3300045049 Bacteria 1044
120 Ga0466967_0005108 3300045976 Bacteria 9017
121 Ga0466967_0017762 3300045976 Bacteria 5661
122 Ga0466967_0042845 3300045976 Bacteria 3914
123 Ga0466967_0060153 3300045976 Bacteria 3365
124 Ga0466967_0069761 3300045976 Bacteria 3142
125 Ga0466967_0149568 3300045976 Bacteria 2181
126 Ga0466967_0598779 3300045976 Bacteria 1088
127 Ga0466967_0910052 3300045976 Bacteria 875
128 Ga0466967_1053256 3300045976 Bacteria 810
129 Ga0495650_0000035 3300046471 Bacteria 403799
130 Ga0495644_0086651 3300046523 Bacteria 1181
131 Ga0495676_0012422 3300047321 Bacteria 7672
132 Ga0495677_0077884 3300047445 Bacteria 1241
133 Ga0496101_0001403 3300048904 Bacteria 14427
134 Ga0496101_0329753 3300048904 Bacteria 1198
135 Ga0496103_0067626 3300048906 Bacteria 2232
136 Ga0496103_0265890 3300048906 Bacteria 1103
137 Ga0496104_0406465 3300048907 Bacteria 1274
138 Ga0496105_0007457 3300048908 Bacteria 8469
139 Ga0496107_0068643 3300048910 Bacteria 2573
140 Ga0496107_0084650 3300048910 Bacteria 2314
141 Ga0496108_0115570 3300048911 Bacteria 2298
142 Ga0496109_0075365 3300048912 Bacteria 3102
143 Ga0496110_0094443 3300048913 Bacteria 2678
144 Ga0496111_0125364 3300048914 Bacteria 1898
145 Ga0496112_0002127 3300048915 Bacteria 15727
146 Ga0496112_0202073 3300048915 Bacteria 1946
147 Ga0496113_0005605 3300048916 Bacteria 7855
148 Ga0496113_0047949 3300048916 Bacteria 3177
149 Ga0496113_0167543 3300048916 Bacteria 1739
150 Ga0496115_0134302 3300048918 Bacteria 2040
151 Ga0496121_0005844 3300048924 Bacteria 15592
152 Ga0496124_0181996 3300048927 Bacteria 1616
153 Ga0501031_0156807 3300049568 Bacteria 1488
154 Ga0501036_0017858 3300049572 Bacteria 5939
155 Ga0501036_0107822 3300049572 Bacteria 2355
156 Ga0501038_0098342 3300049574 Bacteria 2440
157 Ga0501038_0122656 3300049574 Bacteria 2141
158 Ga0501038_0129904 3300049574 Bacteria 2070
159 Ga0501039_0008006 3300049575 Bacteria 8054
160 Ga0501040_0007522 3300049576 Bacteria 7044
161 Ga0501041_0050290 3300049577 Bacteria 2540
162 Ga0501041_0102363 3300049577 Bacteria 1773
163 Ga0501042_0054478 3300049578 Bacteria 2853
164 Ga0501046_0313826 3300049580 Bacteria 1143
165 Ga0501048_0146738 3300049582 Bacteria 1668
166 Ga0501067_0106028 3300049583 Bacteria 1562
167 Ga0501069_0195662 3300049585 Bacteria 1171
168 Ga0501070_0013883 3300049586 Bacteria 6783
169 Ga0501071_0078603 3300049587 Bacteria 2411
170 Ga0501072_0016071 3300049588 Bacteria 5740
171 Ga0501072_0030136 3300049588 Bacteria 4241
172 Ga0501072_0127893 3300049588 Bacteria 2024
173 Ga0501074_0097091 3300049590 Bacteria 2109
174 Ga0501075_0030020 3300049591 Bacteria 4023
175 Ga0501075_0058543 3300049591 Bacteria 2902
176 Ga0501075_0242034 3300049591 Bacteria 1375
177 Ga0501076_0130238 3300049592 Bacteria 2040
178 Ga0501081_0027482 3300049743 Bacteria 3838
179 Ga0501081_0042560 3300049743 Bacteria 3113
180 Ga0501045_0016417 3300049824 Bacteria 5258
181 Ga0501045_0026852 3300049824 Bacteria 4144
182 nmdc:mga09592_14022_c1 3300050508 Bacteria 6543
183 nmdc:mga0n895_114819_c1 3300050512 Bacteria 2710
184 nmdc:mga0n895_122722_c1 3300050512 Bacteria 2619
185 nmdc:mga08x19_298636_c1 3300050514 Bacteria 1118
186 Ga0495601_0325518 3300053077 Bacteria 1001
187 Ga0500641_0000873 3300053096 Bacteria 10782
188 Ga0500616_0003052 3300053153 Bacteria 13174
189 Ga0501082_0009295 3300060353 Bacteria 8474
190 Ga0501082_0102176 3300060353 Bacteria 2480
191 Ga0501082_0310673 3300060353 Bacteria 1373
192 Ga0466962_0002406 3300061719 Bacteria 8876
193 Ga0466962_0084669 3300061719 Bacteria 1517
194 Ga0530510_0028835 3300061734 Bacteria 3981
195 Ga0501036_0084220
196 LJQas_1004858
197 Ga0070683_100070205
198 Ga0070683_100239317
199 Ga0070660_100103853
200 Ga0070669_100009959
201 Ga0070659_100000077
202 Ga0070659_100051653
203 Ga0070714_100015031
204 Ga0070714_100114917
205 Ga0070710_10000008
206 Ga0070705_100002297
207 Ga0070700_100082021
208 Ga0070663_100089612
209 Ga0070678_100154397
210 Ga0070678_100208135
211 Ga0070662_100256011
212 Ga0070684_100031005
213 Ga0070665_100113948
214 Ga0070664_100142753
215 Ga0068856_100435867
216 Ga0070702_100004143
217 Ga0068859_100414205
218 Ga0068861_100158097
219 Ga0081538_10002376
220 Ga0081538_10004230
221 Ga0081538_10026609
222 Ga0081539_10004197
223 Ga0081539_10009302
224 Ga0081539_10038037
225 Ga0081539_10073660
226 Ga0070717_10000004
227 Ga0075432_10061416
228 Ga0070712_100000008
229 Ga0070712_100004280
230 Ga0075428_100038608
231 Ga0075434_100499955
232 Ga0075429_100108166
233 Ga0097620_100414229
234 Ga0105240_10049726
235 Ga0111539_10015116
236 Ga0105245_10404147
237 Ga0114129_10003887
238 Ga0105243_10025695
239 Ga0105249_10151325
240 Ga0105239_10081204
241 Ga0105239_10311591
242 Ga0105246_10030063
243 Ga0105246_10169314
244 Ga0157370_10008201
245 Ga0157378_10697900
246 Ga0157372_10106867
247 Ga0157376_10570630
248 Ga0206354_10458062
249 Ga0213875_10000050
250 Ga0207426_1015614
251 Ga0207692_10000034
252 Ga0207688_10168046
253 Ga0207699_10327619
254 Ga0207643_10050570
255 Ga0207693_10000002
256 Ga0207693_10036526
257 Ga0207662_10044447
258 Ga0207657_10067594
259 Ga0207657_10085523
260 Ga0207681_10007138
261 Ga0207681_10039483
262 Ga0207664_10000006
263 Ga0207664_10020786
264 Ga0207644_10205723
265 Ga0207690_10000017
266 Ga0207709_10059536
267 Ga0207670_10138547
268 Ga0207661_10415757
269 Ga0207679_10023653
270 Ga0207651_10437462
271 Ga0207678_10135796
272 Ga0207678_10152098
273 Ga0207708_10021955
274 Ga0207648_10086777
275 Ga0207683_10282486
276 Ga0207698_10384109
277 Ga0265326_10000016
278 Ga0265334_10000076
279 Ga0265318_10040813
280 Ga0265336_10016495
281 Ga0265324_10002766
282 Ga0265327_10028454
283 Ga0307406_10039094
284 Ga0307407_10012462
285 Ga0307412_10116794
286 Ga0307409_100016951
287 Ga0307409_100653749
288 Ga0307416_100018784
289 Ga0307416_100055118
290 Ga0307416_100130708
291 Ga0307414_10343624
292 Ga0307411_10183191
293 Ga0307415_100012089
294 Ga0307415_100237626
295 Ga0307415_100280477
296 Ga0395898_0070496
297 Ga0395898_0132998
298 Ga0395898_0294162
299 Ga0395905_0426560
300 Ga0436364_0750607
301 Ga0395901_0263710
302 Ga0439440_0028763
303 Ga0466965_0175593
304 Ga0466963_0009797
305 Ga0466963_0017056
306 Ga0466963_0030546
307 Ga0466964_0070567
308 Ga0466968_0022033
309 Ga0466957_0047862
310 Ga0466957_0188001
311 Ga0466960_0158553
312 Ga0466959_0032942
313 Ga0466959_0328893
314 Ga0466967_0005108
315 Ga0466967_0017762
316 Ga0466967_0042845
317 Ga0466967_0060153
318 Ga0466967_0069761
319 Ga0466967_0149568
320 Ga0466967_0598779
321 Ga0466967_0910052
322 Ga0466967_1053256
323 Ga0495650_0000035
324 Ga0495644_0086651
325 Ga0495676_0012422
326 Ga0495677_0077884
327 Ga0496101_0001403
328 Ga0496101_0329753
329 Ga0496103_0067626
330 Ga0496103_0265890
331 Ga0496104_0406465
332 Ga0496105_0007457
333 Ga0496107_0068643
334 Ga0496107_0084650
335 Ga0496108_0115570
336 Ga0496109_0075365
337 Ga0496110_0094443
338 Ga0496111_0125364
339 Ga0496112_0002127
340 Ga0496112_0202073
341 Ga0496113_0005605
342 Ga0496113_0047949
343 Ga0496113_0167543
344 Ga0496115_0134302
345 Ga0496121_0005844
346 Ga0496124_0181996
347 Ga0501031_0156807
348 Ga0501036_0017858
349 Ga0501036_0107822
350 Ga0501038_0098342
351 Ga0501038_0122656
352 Ga0501038_0129904
353 Ga0501039_0008006
354 Ga0501040_0007522
355 Ga0501041_0050290
356 Ga0501041_0102363
357 Ga0501042_0054478
358 Ga0501046_0313826
359 Ga0501048_0146738
360 Ga0501067_0106028
361 Ga0501069_0195662
362 Ga0501070_0013883
363 Ga0501071_0078603
364 Ga0501072_0016071
365 Ga0501072_0030136
366 Ga0501072_0127893
367 Ga0501074_0097091
368 Ga0501075_0030020
369 Ga0501075_0058543
370 Ga0501075_0242034
371 Ga0501076_0130238
372 Ga0501081_0027482
373 Ga0501081_0042560
374 Ga0501045_0016417
375 Ga0501045_0026852
376 nmdc:mga09592_14022_c1
377 nmdc:mga0n895_114819_c1
378 nmdc:mga0n895_122722_c1
379 nmdc:mga08x19_298636_c1
380 Ga0495601_0325518
381 Ga0500641_0000873
382 Ga0500616_0003052
383 Ga0501082_0009295
384 Ga0501082_0102176
385 Ga0501082_0310673
386 Ga0466962_0002406
387 Ga0466962_0084669
388 Ga0530510_0028835

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01040

UbiA

UbiA prenyltransferase family

32

116

0.94

PF01040

UbiA

UbiA prenyltransferase family

101

254

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bpu-assembly1.cif.gz_A structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes 0.8265 25 302
7bpu-assembly1.cif.gz_A structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes 0.8083 25 302
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.797 34 300
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.774 34 300
4tq4-assembly3.cif.gz_C structure of a ubia homolog from archaeoglobus fulgidus bound to dmapp and mg2+ 0.7305 27 298
ID Description Score Start End Superfamily
af_P0AEA5_14_182_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9725 40 201 1.10.357.140
af_P9WFR7_30_178_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9665 36 180 1.10.357.140
af_Q2G2B9_23_180_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9644 33 182 1.10.357.140
af_P0AEA5_183_296_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9637 206 301 1.20.1070.10
af_A4I0M3_131_276_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.961 35 179 1.10.357.140
ID Description Score Start End GO Terms
AF-A0A536NRM4-F1-model_v4 Heme o synthase (EC 2.5.1.141) 0.9974 57 301 GO:0005886
GO:0006783
GO:0008495
AF-A0A536XDR9-F1-model_v4 Protoheme IX farnesyltransferase (EC 2.5.1.141) (Heme B farnesyltransferase) (Heme O synthase) 0.9952 190 301 GO:0005886
GO:0006783
GO:0008495
AF-T0ZSU5-F1-model_v4 Protoheme IX farnesyltransferase (Heme B farnesyltransferase) 0.9922 60 230 GO:0005886
GO:0006783
GO:0008495
AF-A0A831XHC2-F1-model_v4 Heme o synthase (EC 2.5.1.141) 0.9896 98 304 GO:0005886
GO:0006783
GO:0008495
AF-A0A7V9N6V2-F1-model_v4 Protoheme IX farnesyltransferase (EC 2.5.1.141) (Heme B farnesyltransferase) (Heme O synthase) 0.9889 18 302 GO:0005886
GO:0008495
GO:0048034

Map