F299344

General Info

Members Datasets Scaffolds Average Seq Length
194 116 189 276

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0000630|Ga0500616_0000630_3550_4560
Length 336
Sequence MAIDMETSMCVRATDGWSDPPGSASGTYSHGLVRAPAADLRSTGASIPSGQRTHLWGRGSLVKADAFRFDGKRALVVGGATGMGAAAAELVQELGAEVVVMDHAEVTLAGAKAIKVDLRDRASIDAAVDECGGPIDALFSCAGAADGTPGIEKINFIGHRHLIDRAIDQGYLGRGSSIAMISSAAGLAWEKHLPEIKEYLATPDFDAAVAWIDAHPGKADYMWSKETLCAYVASQALPMLQRGIRINAILPGPTDTPLAQANADLWLAFGSDYRASAGIEASRPDEQAGPLVFLCSDAAAYLNGVTIITDAGYVSSGITGTFPDATPVVDFLYGRY

Samples

Sample ID Description Type Environment
1 2671180195 Frankia sp. CcI49 Isolate Nodule
2 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
3 2773857922 Frankia sp. CcI49 Isolate Nodule
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
6 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
7 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
11 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
12 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
13 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
14 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
15 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
24 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
25 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
26 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
27 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
31 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
34 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
35 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
36 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
37 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
38 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
39 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
40 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
41 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
42 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
43 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
44 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
45 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
46 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
47 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
48 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
49 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
50 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
51 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
52 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
53 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
54 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
55 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
56 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
57 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
58 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
59 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
60 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
61 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
62 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
63 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
64 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
65 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
66 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
67 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
68 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
69 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
70 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
71 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
72 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
73 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
74 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
75 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
76 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
87 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
88 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
89 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
90 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
91 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
92 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
93 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
94 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
95 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
96 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
97 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
98 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
99 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
100 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
101 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
102 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
103 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
104 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
105 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
106 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
107 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
108 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
109 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
110 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
111 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
112 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
113 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
114 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
115 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
116 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.91
Metatranscriptomes 0.52
Isolates 2.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.31
Nodule 2.58
Rhizoplane 5.67
Rhizosphere 79.9
Stem 0
Stem Tuber 0
Unclassified 1.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100516246 3300005329 Bacteria 1142
2 Ga0070683_100607123 3300005329 Bacteria 1047
3 Ga0070683_100798061 3300005329 Bacteria 905
4 Ga0070662_100062707 3300005457 Bacteria 2717
5 Ga0070697_100161043 3300005536 Bacteria 1896
6 Ga0081455_10033705 3300005937 Bacteria 4598
7 Ga0081455_10044704 3300005937 Bacteria 3860
8 Ga0081455_10126576 3300005937 Bacteria 2004
9 Ga0081538_10038220 3300005981 Bacteria 3101
10 Ga0081539_10005431 3300005985 Bacteria 13012
11 Ga0075365_10075386 3300006038 Bacteria 2276
12 Ga0075365_10137566 3300006038 Bacteria 1694
13 Ga0075363_100011087 3300006048 Bacteria 4305
14 Ga0075364_10190129 3300006051 Unclassified 1390
15 Ga0075362_10139288 3300006177 Bacteria 1159
16 Ga0075367_10006712 3300006178 Bacteria 5839
17 Ga0075367_10054543 3300006178 Bacteria 2370
18 Ga0075370_10074938 3300006353 Bacteria 1940
19 Ga0075428_100001913 3300006844 Bacteria 22346
20 Ga0075428_100028817 3300006844 Bacteria 6145
21 Ga0075428_100073058 3300006844 Bacteria 3745
22 Ga0075428_100123272 3300006844 Bacteria 2821
23 Ga0075428_100125904 3300006844 Bacteria 2788
24 Ga0075428_100700883 3300006844 Bacteria 1079
25 Ga0075430_100002699 3300006846 Bacteria 14820
26 Ga0075430_100006032 3300006846 Bacteria 10218
27 Ga0075430_100058457 3300006846 Bacteria 3241
28 Ga0075431_100003831 3300006847 Bacteria 14622
29 Ga0075431_100025687 3300006847 Bacteria 6036
30 Ga0075431_100117428 3300006847 Bacteria 2745
31 Ga0075431_100730378 3300006847 Bacteria 966
32 Ga0075429_100002040 3300006880 Bacteria 16815
33 Ga0075429_100026576 3300006880 Bacteria 5027
34 Ga0075429_100056639 3300006880 Bacteria 3412
35 Ga0075429_100344911 3300006880 Bacteria 1304
36 Ga0111539_10001540 3300009094 Bacteria 30701
37 Ga0111539_10499545 3300009094 Bacteria 1417
38 Ga0111539_10535048 3300009094 Bacteria 1365
39 Ga0111539_10800110 3300009094 Bacteria 1097
40 Ga0105245_10043941 3300009098 Bacteria 3987
41 Ga0114129_10057828 3300009147 Bacteria 5425
42 Ga0114129_10121618 3300009147 Bacteria 3592
43 Ga0114129_10182185 3300009147 Bacteria 2857
44 Ga0114129_10294260 3300009147 Bacteria 2166
45 Ga0105242_10023287 3300009176 Bacteria 4882
46 Ga0157378_10028391 3300013297 Bacteria 4936
47 Ga0206351_10176629 3300020077 Bacteria 1221
48 Ga0213876_10059147 3300021384 Bacteria 2023
49 Ga0207681_10056452 3300025923 Bacteria 2679
50 Ga0207687_10019995 3300025927 Bacteria 4441
51 Ga0207691_10064910 3300025940 Bacteria 3306
52 Ga0207428_10004278 3300027907 Bacteria 13659
53 Ga0268265_10106820 3300028380 Bacteria 2275
54 Ga0268264_10124558 3300028381 Bacteria 2276
55 Ga0265339_10064121 3300031249 Bacteria 1972
56 Ga0265327_10001231 3300031251 Bacteria 34376
57 Ga0265327_10006782 3300031251 Bacteria 9036
58 Ga0316579_10176395 3300031691 Bacteria 1033
59 Ga0265314_10275699 3300031711 Bacteria 954
60 Ga0316578_10266066 3300031728 Bacteria 1028
61 Ga0316577_10176434 3300031733 Bacteria 1206
62 Ga0307410_10169806 3300031852 Bacteria 1642
63 Ga0316574_0007117 3300035398 Bacteria 6111
64 Ga0316574_0065132 3300035398 Bacteria 2294
65 Ga0316574_0118514 3300035398 Bacteria 1699
66 Ga0316582_0169319 3300036647 Bacteria 1482
67 Ga0316584_0003670 3300036712 Bacteria 10045
68 Ga0316584_0533268 3300036712 Bacteria 821
69 Ga0436365_1874182 3300039437 Bacteria 3914
70 Ga0436362_0176990 3300039453 Bacteria 3556
71 Ga0439434_0058548 3300042435 Bacteria 1202
72 Ga0466961_0064134 3300044693 Bacteria 2335
73 Ga0466963_0026548 3300044694 Bacteria 3705
74 Ga0466963_0344506 3300044694 Bacteria 1049
75 Ga0466957_0345455 3300044842 Bacteria 1008
76 Ga0466958_0103046 3300045836 Bacteria 1776
77 Ga0466967_0285820 3300045976 Bacteria 1583
78 Ga0495651_0008984 3300046462 Bacteria 7671
79 Ga0495639_0040301 3300046475 Bacteria 2101
80 Ga0495608_0061301 3300046511 Bacteria 2474
81 Ga0495628_0134408 3300046516 Bacteria 1891
82 Ga0495628_0315814 3300046516 Bacteria 1154
83 Ga0495587_0024797 3300046536 Bacteria 3672
84 Ga0495621_0007080 3300046539 Bacteria 3306
85 Ga0495645_0286334 3300046543 Bacteria 1082
86 Ga0495667_0010205 3300046559 Bacteria 6355
87 Ga0495635_0105622 3300046663 Bacteria 1924
88 Ga0495657_0019493 3300046675 Bacteria 4892
89 Ga0495647_0054740 3300046681 Bacteria 1560
90 Ga0495613_0140912 3300046689 Bacteria 1723
91 Ga0495680_0036029 3300047322 Bacteria 3978
92 Ga0495680_0058515 3300047322 Bacteria 2978
93 Ga0495680_0123114 3300047322 Bacteria 1913
94 Ga0495675_0021762 3300047444 Bacteria 4085
95 Ga0495614_0029097 3300048089 Bacteria 2378
96 Ga0496102_0212025 3300048905 Bacteria 1826
97 Ga0496104_0096336 3300048907 Bacteria 2831
98 Ga0496104_0751486 3300048907 Bacteria 882
99 Ga0496105_0412131 3300048908 Bacteria 1071
100 Ga0496106_0158710 3300048909 Bacteria 1788
101 Ga0496109_0325443 3300048912 Bacteria 1451
102 Ga0496110_0027717 3300048913 Bacteria 4858
103 Ga0496111_0104307 3300048914 Bacteria 2086
104 Ga0496114_0076316 3300048917 Bacteria 2824
105 Ga0496114_0561926 3300048917 Bacteria 1008
106 Ga0496115_0071148 3300048918 Bacteria 2821
107 Ga0496126_0000027 3300048929 Bacteria 396518
108 Ga0501032_0217273 3300049569 Bacteria 1245
109 Ga0501033_0000295 3300049570 Bacteria 47954
110 Ga0501033_0005999 3300049570 Bacteria 9532
111 Ga0501034_0000806 3300049571 Bacteria 46584
112 Ga0501034_0012450 3300049571 Bacteria 8785
113 Ga0501034_0213781 3300049571 Bacteria 1883
114 Ga0501036_0144888 3300049572 Bacteria 2004
115 Ga0501037_0018405 3300049573 Bacteria 5149
116 Ga0501041_0052663 3300049577 Bacteria 2481
117 Ga0501043_0034055 3300049579 Bacteria 4007
118 Ga0501046_0015905 3300049580 Bacteria 6310
119 Ga0501047_0004635 3300049581 Bacteria 12936
120 Ga0501048_0030750 3300049582 Bacteria 3886
121 Ga0501067_0177520 3300049583 Bacteria 1186
122 Ga0501068_0006602 3300049584 Bacteria 6401
123 Ga0501068_0058580 3300049584 Bacteria 2337
124 Ga0501069_0000043 3300049585 Bacteria 77795
125 Ga0501069_0014154 3300049585 Bacteria 4259
126 Ga0501069_0015930 3300049585 Bacteria 4031
127 Ga0501070_0000298 3300049586 Bacteria 46144
128 Ga0501070_0000942 3300049586 Bacteria 26254
129 Ga0501070_0016480 3300049586 Bacteria 6209
130 Ga0501070_0039279 3300049586 Bacteria 3948
131 Ga0501071_0003348 3300049587 Bacteria 10017
132 Ga0501072_0081336 3300049588 Bacteria 2567
133 Ga0501073_0000790 3300049589 Bacteria 22536
134 Ga0501073_0003297 3300049589 Bacteria 12127
135 Ga0501073_0137839 3300049589 Bacteria 1691
136 Ga0501074_0001020 3300049590 Bacteria 18229
137 Ga0501074_0163073 3300049590 Bacteria 1592
138 Ga0501075_0244829 3300049591 Bacteria 1367
139 Ga0501080_0001976 3300049742 Bacteria 17683
140 Ga0501080_0011102 3300049742 Bacteria 8243
141 Ga0501080_0033963 3300049742 Bacteria 4762
142 Ga0501080_0064408 3300049742 Bacteria 3409
143 Ga0501080_0130752 3300049742 Bacteria 2324
144 Ga0501081_0109958 3300049743 Bacteria 1955
145 Ga0501083_0001107 3300049744 Bacteria 18047
146 Ga0501083_0023171 3300049744 Bacteria 4308
147 Ga0501083_0087390 3300049744 Bacteria 2061
148 Ga0501044_0004373 3300049823 Bacteria 15815
149 Ga0501044_0062149 3300049823 Bacteria 3818
150 nmdc:mga03n38_82512_c1 3300050490 Unclassified 1513
151 nmdc:mga00v17_174002_c1 3300050491 Bacteria 1389
152 nmdc:mga00v17_8205_c1 3300050491 Bacteria 5614
153 nmdc:mga00v17_92539_c1 3300050491 Bacteria 1901
154 nmdc:mga0yw44_261994_c1 3300050492 Bacteria 1152
155 nmdc:mga0yw44_6815_c1 3300050492 Bacteria 5554
156 nmdc:mga04h51_40614_c1 3300050495 Bacteria 1517
157 nmdc:mga07m45_198117_c1 3300050496 Bacteria 1168
158 nmdc:mga05p37_155276_c1 3300050507 Bacteria 2797
159 nmdc:mga05p37_344420_c1 3300050507 Bacteria 1756
160 nmdc:mga05p37_77591_c1 3300050507 Bacteria 4090
161 nmdc:mga05p37_783708_c1 3300050507 Bacteria 1046
162 nmdc:mga05p37_913_c1 3300050507 Bacteria 33348
163 nmdc:mga09592_1473_c1 3300050508 Bacteria 18914
164 nmdc:mga09592_196719_c1 3300050508 Bacteria 1745
165 nmdc:mga09592_594_c1 3300050508 Bacteria 27417
166 nmdc:mga09592_82628_c1 3300050508 Bacteria 2737
167 nmdc:mga0qj67_104055_c1 3300050509 Bacteria 2290
168 nmdc:mga0qj67_1880_c1 3300050509 Bacteria 14892
169 nmdc:mga0qj67_283_c1 3300050509 Bacteria 35322
170 nmdc:mga06r32_44137_c1 3300050510 Bacteria 4244
171 nmdc:mga06r32_5515_c1 3300050510 Bacteria 11400
172 nmdc:mga06r32_585448_c1 3300050510 Bacteria 1088
173 nmdc:mga06r32_7652_c1 3300050510 Bacteria 9715
174 nmdc:mga08y16_184296_c1 3300050511 Bacteria 2167
175 nmdc:mga08y16_204239_c1 3300050511 Bacteria 2047
176 nmdc:mga08y16_358035_c1 3300050511 Bacteria 1498
177 nmdc:mga08y16_562047_c1 3300050511 Bacteria 1153
178 nmdc:mga08y16_584675_c1 3300050511 Bacteria 1127
179 Ga0495595_0013218 3300053084 Bacteria 3485
180 Ga0495595_0227213 3300053084 Bacteria 932
181 Ga0500566_0000083 3300053094 Bacteria 46619
182 Ga0500568_0000037 3300053139 Bacteria 135208
183 Ga0500616_0000630 3300053153 Bacteria 42795
184 Ga0500616_0005696 3300053153 Bacteria 8396
185 Ga0501084_0009774 3300054114 Bacteria 7931
186 Ga0590075_033003 3300059424 Bacteria 1314
187 Ga0590077_017398 3300059426 Bacteria 1512
188 Ga0501082_0033753 3300060353 Bacteria 4414
189 Ga0501082_0845200 3300060353 Bacteria 801

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300060353 Ga0501082_0845200 Ga0501082_0845200_20_727 234
2 3300009094 Ga0111539_10499545 Ga0111539_104995452 251
3 3300050511 nmdc:mga08y16_358035_c1 nmdc:mga08y16_358035_c1_374_1210 251
4 3300046663 Ga0495635_0105622 Ga0495635_0105622_1145_1909 252
5 3300049591 Ga0501075_0244829 Ga0501075_0244829_209_967 252
6 3300050511 nmdc:mga08y16_584675_c1 nmdc:mga08y16_584675_c1_341_1105 252
7 3300036712 Ga0316584_0533268 Ga0316584_0533268_19_801 253
8 3300049585 Ga0501069_0000043 Ga0501069_0000043_9519_10439 254
9 3300049586 Ga0501070_0000298 Ga0501070_0000298_10943_11863 254
10 3300049587 Ga0501071_0003348 Ga0501071_0003348_7860_8780 254
11 3300049742 Ga0501080_0011102 Ga0501080_0011102_3385_4305 254
12 3300035398 Ga0316574_0007117 Ga0316574_0007117_2949_3797 259
13 iso_pu_bacteria 2671180195 2671840298 270
14 iso_pu_bacteria 2687453743 2689990967 270
15 iso_pu_bacteria 2687453743 2689993587 270
16 iso_pu_bacteria 2687453743 2689994269 270
17 iso_pu_bacteria 2773857922 2774858454 270
18 3300028381 Ga0268264_10124558 Ga0268264_101245582 272
19 3300049570 Ga0501033_0000295 Ga0501033_0000295_22881_23714 272
20 3300005329 Ga0070683_100607123 Ga0070683_1006071231 273
21 3300005329 Ga0070683_100798061 Ga0070683_1007980611 273
22 3300005457 Ga0070662_100062707 Ga0070662_1000627072 273
23 3300005536 Ga0070697_100161043 Ga0070697_1001610432 273
24 3300005937 Ga0081455_10033705 Ga0081455_100337052 273
25 3300005937 Ga0081455_10044704 Ga0081455_100447044 273
26 3300005937 Ga0081455_10126576 Ga0081455_101265762 273
27 3300005981 Ga0081538_10038220 Ga0081538_100382202 273
28 3300006038 Ga0075365_10075386 Ga0075365_100753862 273
29 3300006844 Ga0075428_100001913 Ga0075428_10000191313 273
30 3300006844 Ga0075428_100028817 Ga0075428_1000288175 273
31 3300006844 Ga0075428_100073058 Ga0075428_1000730581 273
32 3300006844 Ga0075428_100123272 Ga0075428_1001232723 273
33 3300006844 Ga0075428_100125904 Ga0075428_1001259042 273
34 3300006844 Ga0075428_100700883 Ga0075428_1007008832 273
35 3300006846 Ga0075430_100002699 Ga0075430_1000026993 273
36 3300006846 Ga0075430_100006032 Ga0075430_1000060328 273
37 3300006846 Ga0075430_100058457 Ga0075430_1000584573 273
38 3300006847 Ga0075431_100003831 Ga0075431_10000383110 273
39 3300006847 Ga0075431_100025687 Ga0075431_1000256873 273
40 3300006847 Ga0075431_100117428 Ga0075431_1001174282 273
41 3300006847 Ga0075431_100730378 Ga0075431_1007303781 273
42 3300006880 Ga0075429_100002040 Ga0075429_1000020403 273
43 3300006880 Ga0075429_100026576 Ga0075429_1000265762 273
44 3300006880 Ga0075429_100056639 Ga0075429_1000566393 273
45 3300006880 Ga0075429_100344911 Ga0075429_1003449112 273
46 3300009094 Ga0111539_10001540 Ga0111539_1000154013 273
47 3300009094 Ga0111539_10535048 Ga0111539_105350482 273
48 3300009094 Ga0111539_10800110 Ga0111539_108001102 273
49 3300009098 Ga0105245_10043941 Ga0105245_100439414 273
50 3300009147 Ga0114129_10057828 Ga0114129_100578285 273
51 3300009147 Ga0114129_10121618 Ga0114129_101216182 273
52 3300009147 Ga0114129_10182185 Ga0114129_101821852 273
53 3300009147 Ga0114129_10294260 Ga0114129_102942602 273
54 3300009176 Ga0105242_10023287 Ga0105242_100232874 273
55 3300013297 Ga0157378_10028391 Ga0157378_100283913 273
56 3300020077 Ga0206351_10176629 Ga0206351_101766292 273
57 3300021384 Ga0213876_10059147 Ga0213876_100591472 273
58 3300025923 Ga0207681_10056452 Ga0207681_100564522 273
59 3300025927 Ga0207687_10019995 Ga0207687_100199953 273
60 3300027907 Ga0207428_10004278 Ga0207428_1000427811 273
61 3300028380 Ga0268265_10106820 Ga0268265_101068202 273
62 3300031249 Ga0265339_10064121 Ga0265339_100641211 273
63 3300031251 Ga0265327_10001231 Ga0265327_1000123131 273
64 3300031711 Ga0265314_10275699 Ga0265314_102756991 273
65 3300039437 Ga0436365_1874182 Ga0436365_1874182_2542_3369 273
66 3300039453 Ga0436362_0176990 Ga0436362_0176990_685_1509 273
67 3300042435 Ga0439434_0058548 Ga0439434_0058548_236_1063 273
68 3300044693 Ga0466961_0064134 Ga0466961_0064134_57_890 273
69 3300044694 Ga0466963_0026548 Ga0466963_0026548_1921_2760 273
70 3300044694 Ga0466963_0344506 Ga0466963_0344506_64_897 273
71 3300044842 Ga0466957_0345455 Ga0466957_0345455_52_885 273
72 3300045836 Ga0466958_0103046 Ga0466958_0103046_96_929 273
73 3300045976 Ga0466967_0285820 Ga0466967_0285820_245_1081 273
74 3300046462 Ga0495651_0008984 Ga0495651_0008984_3598_4422 273
75 3300046475 Ga0495639_0040301 Ga0495639_0040301_677_1501 273
76 3300046511 Ga0495608_0061301 Ga0495608_0061301_1049_1873 273
77 3300046516 Ga0495628_0134408 Ga0495628_0134408_563_1387 273
78 3300046516 Ga0495628_0315814 Ga0495628_0315814_77_907 273
79 3300046536 Ga0495587_0024797 Ga0495587_0024797_414_1238 273
80 3300046539 Ga0495621_0007080 Ga0495621_0007080_260_1084 273
81 3300046543 Ga0495645_0286334 Ga0495645_0286334_88_912 273
82 3300046559 Ga0495667_0010205 Ga0495667_0010205_435_1259 273
83 3300046675 Ga0495657_0019493 Ga0495657_0019493_1590_2414 273
84 3300046681 Ga0495647_0054740 Ga0495647_0054740_403_1227 273
85 3300046689 Ga0495613_0140912 Ga0495613_0140912_162_986 273
86 3300047322 Ga0495680_0036029 Ga0495680_0036029_674_1498 273
87 3300047322 Ga0495680_0058515 Ga0495680_0058515_362_1192 273
88 3300047322 Ga0495680_0123114 Ga0495680_0123114_304_1131 273
89 3300047444 Ga0495675_0021762 Ga0495675_0021762_100_924 273
90 3300048089 Ga0495614_0029097 Ga0495614_0029097_399_1223 273
91 3300048905 Ga0496102_0212025 Ga0496102_0212025_63_893 273
92 3300048907 Ga0496104_0096336 Ga0496104_0096336_588_1415 273
93 3300048908 Ga0496105_0412131 Ga0496105_0412131_147_977 273
94 3300048909 Ga0496106_0158710 Ga0496106_0158710_102_926 273
95 3300048912 Ga0496109_0325443 Ga0496109_0325443_200_1027 273
96 3300048913 Ga0496110_0027717 Ga0496110_0027717_3368_4198 273
97 3300048917 Ga0496114_0561926 Ga0496114_0561926_166_996 273
98 3300048918 Ga0496115_0071148 Ga0496115_0071148_1930_2757 273
99 3300048929 Ga0496126_0000027 Ga0496126_0000027_381576_382403 273
100 3300049571 Ga0501034_0000806 Ga0501034_0000806_2042_2869 273
101 3300049573 Ga0501037_0018405 Ga0501037_0018405_3541_4368 273
102 3300049577 Ga0501041_0052663 Ga0501041_0052663_1116_1946 273
103 3300049583 Ga0501067_0177520 Ga0501067_0177520_128_955 273
104 3300049584 Ga0501068_0006602 Ga0501068_0006602_3723_4550 273
105 3300049584 Ga0501068_0058580 Ga0501068_0058580_923_1750 273
106 3300049585 Ga0501069_0014154 Ga0501069_0014154_2343_3170 273
107 3300049586 Ga0501070_0000942 Ga0501070_0000942_713_1540 273
108 3300049586 Ga0501070_0016480 Ga0501070_0016480_1521_2348 273
109 3300049588 Ga0501072_0081336 Ga0501072_0081336_1649_2476 273
110 3300049589 Ga0501073_0000790 Ga0501073_0000790_417_1244 273
111 3300049589 Ga0501073_0003297 Ga0501073_0003297_7971_8798 273
112 3300049589 Ga0501073_0137839 Ga0501073_0137839_150_977 273
113 3300049590 Ga0501074_0001020 Ga0501074_0001020_12942_13769 273
114 3300049590 Ga0501074_0163073 Ga0501074_0163073_490_1320 273
115 3300049742 Ga0501080_0001976 Ga0501080_0001976_7808_8635 273
116 3300049742 Ga0501080_0064408 Ga0501080_0064408_1726_2553 273
117 3300049742 Ga0501080_0130752 Ga0501080_0130752_712_1539 273
118 3300049743 Ga0501081_0109958 Ga0501081_0109958_956_1786 273
119 3300049744 Ga0501083_0001107 Ga0501083_0001107_2471_3298 273
120 3300049744 Ga0501083_0023171 Ga0501083_0023171_202_1029 273
121 3300049744 Ga0501083_0087390 Ga0501083_0087390_827_1654 273
122 3300050490 nmdc:mga03n38_82512_c1 nmdc:mga03n38_82512_c1_634_1461 273
123 3300050507 nmdc:mga05p37_155276_c1 nmdc:mga05p37_155276_c1_612_1457 273
124 3300050507 nmdc:mga05p37_344420_c1 nmdc:mga05p37_344420_c1_370_1197 273
125 3300050507 nmdc:mga05p37_77591_c1 nmdc:mga05p37_77591_c1_1903_2733 273
126 3300050507 nmdc:mga05p37_783708_c1 nmdc:mga05p37_783708_c1_99_926 273
127 3300050507 nmdc:mga05p37_913_c1 nmdc:mga05p37_913_c1_10924_11754 273
128 3300050508 nmdc:mga09592_1473_c1 nmdc:mga09592_1473_c1_4195_5040 273
129 3300050508 nmdc:mga09592_196719_c1 nmdc:mga09592_196719_c1_869_1693 273
130 3300050508 nmdc:mga09592_594_c1 nmdc:mga09592_594_c1_20921_21751 273
131 3300050508 nmdc:mga09592_82628_c1 nmdc:mga09592_82628_c1_1816_2643 273
132 3300050509 nmdc:mga0qj67_104055_c1 nmdc:mga0qj67_104055_c1_289_1113 273
133 3300050509 nmdc:mga0qj67_1880_c1 nmdc:mga0qj67_1880_c1_7487_8332 273
134 3300050509 nmdc:mga0qj67_283_c1 nmdc:mga0qj67_283_c1_6364_7194 273
135 3300050510 nmdc:mga06r32_44137_c1 nmdc:mga06r32_44137_c1_975_1802 273
136 3300050510 nmdc:mga06r32_5515_c1 nmdc:mga06r32_5515_c1_4903_5733 273
137 3300050510 nmdc:mga06r32_585448_c1 nmdc:mga06r32_585448_c1_225_1052 273
138 3300050510 nmdc:mga06r32_7652_c1 nmdc:mga06r32_7652_c1_3313_4158 273
139 3300050511 nmdc:mga08y16_184296_c1 nmdc:mga08y16_184296_c1_350_1177 273
140 3300050511 nmdc:mga08y16_204239_c1 nmdc:mga08y16_204239_c1_1066_1914 273
141 3300050511 nmdc:mga08y16_562047_c1 nmdc:mga08y16_562047_c1_46_963 273
142 3300053084 Ga0495595_0013218 Ga0495595_0013218_269_1093 273
143 3300053094 Ga0500566_0000083 Ga0500566_0000083_31194_32018 273
144 3300053139 Ga0500568_0000037 Ga0500568_0000037_10758_11588 273
145 3300053153 Ga0500616_0005696 Ga0500616_0005696_4975_5832 273
146 3300054114 Ga0501084_0009774 Ga0501084_0009774_3129_3956 273
147 3300059424 Ga0590075_033003 Ga0590075_033003_251_1078 273
148 3300059426 Ga0590077_017398 Ga0590077_017398_521_1348 273
149 3300060353 Ga0501082_0033753 Ga0501082_0033753_962_1789 273
150 3300006038 Ga0075365_10137566 Ga0075365_101375661 274
151 3300006048 Ga0075363_100011087 Ga0075363_1000110872 274
152 3300006051 Ga0075364_10190129 Ga0075364_101901292 274
153 3300006177 Ga0075362_10139288 Ga0075362_101392881 274
154 3300006178 Ga0075367_10006712 Ga0075367_100067122 274
155 3300006178 Ga0075367_10054543 Ga0075367_100545432 274
156 3300006353 Ga0075370_10074938 Ga0075370_100749382 274
157 3300031691 Ga0316579_10176395 Ga0316579_101763951 274
158 3300031728 Ga0316578_10266066 Ga0316578_102660661 274
159 3300031733 Ga0316577_10176434 Ga0316577_101764342 274
160 3300031852 Ga0307410_10169806 Ga0307410_101698062 274
161 3300035398 Ga0316574_0065132 Ga0316574_0065132_69_896 274
162 3300035398 Ga0316574_0118514 Ga0316574_0118514_199_1050 274
163 3300036647 Ga0316582_0169319 Ga0316582_0169319_396_1223 274
164 3300036712 Ga0316584_0003670 Ga0316584_0003670_7993_8820 274
165 3300048907 Ga0496104_0751486 Ga0496104_0751486_23_868 274
166 3300048917 Ga0496114_0076316 Ga0496114_0076316_510_1355 274
167 3300049570 Ga0501033_0005999 Ga0501033_0005999_946_1818 274
168 3300049571 Ga0501034_0213781 Ga0501034_0213781_914_1741 274
169 3300049585 Ga0501069_0015930 Ga0501069_0015930_3067_3894 274
170 3300049823 Ga0501044_0004373 Ga0501044_0004373_12219_13091 274
171 3300050491 nmdc:mga00v17_174002_c1 nmdc:mga00v17_174002_c1_57_884 274
172 3300050491 nmdc:mga00v17_8205_c1 nmdc:mga00v17_8205_c1_1997_2824 274
173 3300050491 nmdc:mga00v17_92539_c1 nmdc:mga00v17_92539_c1_277_1104 274
174 3300050492 nmdc:mga0yw44_261994_c1 nmdc:mga0yw44_261994_c1_304_1131 274
175 3300050492 nmdc:mga0yw44_6815_c1 nmdc:mga0yw44_6815_c1_2680_3507 274
176 3300050495 nmdc:mga04h51_40614_c1 nmdc:mga04h51_40614_c1_28_855 274
177 3300050496 nmdc:mga07m45_198117_c1 nmdc:mga07m45_198117_c1_65_892 274
178 3300053153 Ga0500616_0000630 Ga0500616_0000630_3550_4560 274
179 3300005329 Ga0070683_100516246 Ga0070683_1005162461 275
180 3300005985 Ga0081539_10005431 Ga0081539_100054313 275
181 3300025940 Ga0207691_10064910 Ga0207691_100649101 275
182 3300031251 Ga0265327_10006782 Ga0265327_100067823 275
183 3300048914 Ga0496111_0104307 Ga0496111_0104307_325_1152 275
184 3300049569 Ga0501032_0217273 Ga0501032_0217273_25_852 275
185 3300049571 Ga0501034_0012450 Ga0501034_0012450_2165_2992 275
186 3300049572 Ga0501036_0144888 Ga0501036_0144888_116_943 275
187 3300049579 Ga0501043_0034055 Ga0501043_0034055_1102_1929 275
188 3300049580 Ga0501046_0015905 Ga0501046_0015905_644_1471 275
189 3300049581 Ga0501047_0004635 Ga0501047_0004635_11676_12503 275
190 3300049582 Ga0501048_0030750 Ga0501048_0030750_521_1348 275
191 3300049586 Ga0501070_0039279 Ga0501070_0039279_1223_2050 275
192 3300049742 Ga0501080_0033963 Ga0501080_0033963_1032_1859 275
193 3300049823 Ga0501044_0062149 Ga0501044_0062149_2377_3204 275
194 3300053084 Ga0495595_0227213 Ga0495595_0227213_26_853 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

206

314

0.86

PF00106

adh_short

short chain dehydrogenase

72

202

0.84

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

74

207

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m1l-assembly1.cif.gz_A crystal structure of a c-terminal trunacted mutant of a putative ketoacyl reductase (fabg4) from mycobacterium tuberculosis h37rv at 2.5 angstrom resolution 0.8351 5 249
1uzm-assembly1.cif.gz_A-2 maba from mycobacterium tuberculosis 0.8348 11 252
1uzl-assembly1.cif.gz_A-2 maba from mycobacterium tuberculosis 0.8262 11 252
2ntn-assembly1.cif.gz_A-2 crystal structure of maba-c60v/g139a/s144l 0.8249 11 252
1uzm-assembly1.cif.gz_B-2 maba from mycobacterium tuberculosis 0.8223 11 252
ID Description Score Start End Superfamily
4emjA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8366 7 40 3.50.50.60
af_A0A0N7KIR0_69_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8267 6 126 3.40.50.720
af_P9WHH3_154_271_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8216 11 54 3.50.50.60
2fwmX00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8168 7 252 3.40.50.720
3m1lB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8159 2 249 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A800FA51-F1-model_v4 SDR family oxidoreductase 0.9869 7 260 GO:0016491
AF-A0A349SU54-F1-model_v4 Aldehyde dehydrogenase domain-containing protein 0.9831 1 274 GO:0016491
AF-A0A2D9TX30-F1-model_v4 Aldehyde dehydrogenase domain-containing protein 0.9819 1 275 GO:0016620
AF-A0A1A3AKX4-F1-model_v4 Short-chain dehydrogenase 0.9799 4 274 GO:0016491
AF-A0A800FA51-F1-model_v4 SDR family oxidoreductase 0.9792 7 260 GO:0016491

Feature Viewer

pLDDT pTM Quality
94.86 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map