F299379
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 194 | 140 | 190 | 134 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2643221598|2644000360 |
| Length | 155 |
| Sequence | PKAPADPIDARMVRKLADILTDTGLSEIEVECDGLKIRVAKTLTSAPIQYAPAPAPVAAVAAPIAAPAGEAPAPERRKGDVVNSPMVGTVYLQPQPDSPAFVKVGDMVSAGQTLLIVEAMKTMNPIPAPKAGKVVEIIVEDAQPVEFGEPLVVIE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 2 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 3 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 4 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 5 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 15 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 16 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 18 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 19 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 20 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 21 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 22 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 23 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 24 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 25 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 26 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 27 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 44 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 45 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 46 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 78 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 79 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 80 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 81 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 82 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 83 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 84 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 85 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 86 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 87 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 88 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 89 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 90 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 91 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 92 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 93 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 94 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 95 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 96 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 97 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 98 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 99 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 100 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 101 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 102 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 103 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 124 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 125 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 126 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 127 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 128 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 129 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 130 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 131 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 132 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 133 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 134 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 136 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 137 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 138 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 139 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 140 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.94 |
| Metatranscriptomes | 0 |
| Isolates | 2.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.67 |
| Nodule | 0 |
| Rhizoplane | 3.61 |
| Rhizosphere | 82.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055531_10037083 | 3300003794 | Bacteria | 1489 |
| 2 | Ga0070683_100841984 | 3300005329 | Bacteria | 880 |
| 3 | Ga0070683_101370266 | 3300005329 | Bacteria | 680 |
| 4 | Ga0068868_100498769 | 3300005338 | Bacteria | 1066 |
| 5 | Ga0070660_100232122 | 3300005339 | Bacteria | 1501 |
| 6 | Ga0070689_100657749 | 3300005340 | Bacteria | 912 |
| 7 | Ga0070694_100958939 | 3300005444 | Bacteria | 708 |
| 8 | Ga0070678_100071789 | 3300005456 | Bacteria | 2592 |
| 9 | Ga0070678_101409126 | 3300005456 | Bacteria | 651 |
| 10 | Ga0070681_10026596 | 3300005458 | Bacteria | 5815 |
| 11 | Ga0070698_101281960 | 3300005471 | Bacteria | 683 |
| 12 | Ga0068853_100755111 | 3300005539 | Bacteria | 930 |
| 13 | Ga0068855_100049752 | 3300005563 | Bacteria | 4942 |
| 14 | Ga0068855_102285477 | 3300005563 | Bacteria | 541 |
| 15 | Ga0070664_100122447 | 3300005564 | Bacteria | 2278 |
| 16 | Ga0070664_101246193 | 3300005564 | Bacteria | 702 |
| 17 | Ga0068856_100516550 | 3300005614 | Bacteria | 1216 |
| 18 | Ga0068856_101119224 | 3300005614 | Bacteria | 805 |
| 19 | Ga0068852_100331164 | 3300005616 | Bacteria | 1482 |
| 20 | Ga0068864_100007323 | 3300005618 | Bacteria | 9081 |
| 21 | Ga0068864_100196170 | 3300005618 | Bacteria | 1853 |
| 22 | Ga0068864_100678866 | 3300005618 | Bacteria | 1005 |
| 23 | Ga0068866_10155645 | 3300005718 | Bacteria | 1328 |
| 24 | Ga0068863_100090191 | 3300005841 | Bacteria | 2907 |
| 25 | Ga0068863_101016690 | 3300005841 | Bacteria | 832 |
| 26 | Ga0068863_101161116 | 3300005841 | Bacteria | 777 |
| 27 | Ga0068858_100611386 | 3300005842 | Bacteria | 1058 |
| 28 | Ga0068862_100092658 | 3300005844 | Bacteria | 2634 |
| 29 | Ga0075363_100061199 | 3300006048 | Bacteria | 2028 |
| 30 | Ga0075362_10076948 | 3300006177 | Bacteria | 1532 |
| 31 | Ga0068865_100002935 | 3300006881 | Bacteria | 10167 |
| 32 | Ga0105250_10238801 | 3300009092 | Bacteria | 774 |
| 33 | Ga0105240_10024963 | 3300009093 | Bacteria | 7867 |
| 34 | Ga0105240_10177718 | 3300009093 | Bacteria | 2515 |
| 35 | Ga0105240_10584807 | 3300009093 | Bacteria | 1231 |
| 36 | Ga0105240_11359942 | 3300009093 | Bacteria | 747 |
| 37 | Ga0105245_10393622 | 3300009098 | Bacteria | 1383 |
| 38 | Ga0105248_10837307 | 3300009177 | Bacteria | 1038 |
| 39 | Ga0105237_10711906 | 3300009545 | Bacteria | 1011 |
| 40 | Ga0105238_10036393 | 3300009551 | Bacteria | 5003 |
| 41 | Ga0105249_10486933 | 3300009553 | Bacteria | 1277 |
| 42 | Ga0105239_11368000 | 3300010375 | Bacteria | 817 |
| 43 | Ga0157373_10489385 | 3300013100 | Bacteria | 888 |
| 44 | Ga0157369_10298149 | 3300013105 | Bacteria | 1677 |
| 45 | Ga0157374_10169253 | 3300013296 | Bacteria | 2130 |
| 46 | Ga0163162_11567556 | 3300013306 | Bacteria | 751 |
| 47 | Ga0157375_10134351 | 3300013308 | Bacteria | 2596 |
| 48 | Ga0157375_10388814 | 3300013308 | Bacteria | 1562 |
| 49 | Ga0163163_10394698 | 3300014325 | Bacteria | 1442 |
| 50 | Ga0157379_11030498 | 3300014968 | Bacteria | 786 |
| 51 | Ga0163161_10318128 | 3300017792 | Bacteria | 1229 |
| 52 | Ga0213872_10009974 | 3300021361 | Bacteria | 4533 |
| 53 | Ga0213876_10484668 | 3300021384 | Bacteria | 658 |
| 54 | Ga0209026_1000527 | 3300025250 | Bacteria | 26703 |
| 55 | Ga0209257_1000807 | 3300025304 | Bacteria | 45532 |
| 56 | Ga0207680_10241455 | 3300025903 | Bacteria | 1245 |
| 57 | Ga0207654_10176013 | 3300025911 | Bacteria | 1393 |
| 58 | Ga0207707_10012529 | 3300025912 | Bacteria | 7372 |
| 59 | Ga0207695_10006160 | 3300025913 | Bacteria | 15637 |
| 60 | Ga0207695_10016645 | 3300025913 | Bacteria | 8594 |
| 61 | Ga0207695_10458735 | 3300025913 | Bacteria | 1157 |
| 62 | Ga0207671_10962542 | 3300025914 | Bacteria | 673 |
| 63 | Ga0207649_10513471 | 3300025920 | Bacteria | 913 |
| 64 | Ga0207694_10215362 | 3300025924 | Bacteria | 1565 |
| 65 | Ga0207687_10326325 | 3300025927 | Bacteria | 1244 |
| 66 | Ga0207644_10017128 | 3300025931 | Bacteria | 4887 |
| 67 | Ga0207644_10022189 | 3300025931 | Bacteria | 4335 |
| 68 | Ga0207690_10146152 | 3300025932 | Bacteria | 1748 |
| 69 | Ga0207706_10084419 | 3300025933 | Bacteria | 2792 |
| 70 | Ga0207686_10680065 | 3300025934 | Bacteria | 816 |
| 71 | Ga0207670_10379308 | 3300025936 | Bacteria | 1126 |
| 72 | Ga0207704_10008396 | 3300025938 | Bacteria | 4937 |
| 73 | Ga0207711_10031211 | 3300025941 | Bacteria | 4497 |
| 74 | Ga0207711_11001719 | 3300025941 | Bacteria | 775 |
| 75 | Ga0207689_10584304 | 3300025942 | Bacteria | 939 |
| 76 | Ga0207689_10633056 | 3300025942 | Bacteria | 901 |
| 77 | Ga0207679_10124237 | 3300025945 | Bacteria | 2060 |
| 78 | Ga0207679_10247065 | 3300025945 | Bacteria | 1515 |
| 79 | Ga0207679_10452311 | 3300025945 | Bacteria | 1139 |
| 80 | Ga0207667_10019205 | 3300025949 | Bacteria | 7642 |
| 81 | Ga0207667_10090164 | 3300025949 | Bacteria | 3169 |
| 82 | Ga0207667_10162853 | 3300025949 | Bacteria | 2294 |
| 83 | Ga0207651_10100012 | 3300025960 | Bacteria | 2149 |
| 84 | Ga0207677_10332252 | 3300026023 | Bacteria | 1267 |
| 85 | Ga0207639_10903371 | 3300026041 | Bacteria | 825 |
| 86 | Ga0207678_10296797 | 3300026067 | Bacteria | 1388 |
| 87 | Ga0207702_10474308 | 3300026078 | Bacteria | 1217 |
| 88 | Ga0207641_10084043 | 3300026088 | Bacteria | 2770 |
| 89 | Ga0207641_10296198 | 3300026088 | Bacteria | 1526 |
| 90 | Ga0207641_10575290 | 3300026088 | Bacteria | 1101 |
| 91 | Ga0207676_10026738 | 3300026095 | Bacteria | 4291 |
| 92 | Ga0207675_102266252 | 3300026118 | Bacteria | 557 |
| 93 | Ga0207683_10101009 | 3300026121 | Bacteria | 2575 |
| 94 | Ga0207683_10697399 | 3300026121 | Bacteria | 941 |
| 95 | Ga0207698_11059209 | 3300026142 | Bacteria | 823 |
| 96 | Ga0268266_11030123 | 3300028379 | Bacteria | 796 |
| 97 | Ga0268265_10041957 | 3300028380 | Bacteria | 3391 |
| 98 | Ga0268265_10861096 | 3300028380 | Bacteria | 887 |
| 99 | Ga0307517_10094005 | 3300028786 | Bacteria | 2425 |
| 100 | Ga0307511_10038842 | 3300030521 | Bacteria | 4078 |
| 101 | Ga0265327_10000190 | 3300031251 | Bacteria | 130086 |
| 102 | Ga0265327_10029919 | 3300031251 | Bacteria | 3088 |
| 103 | Ga0307513_10000856 | 3300031456 | Bacteria | 44279 |
| 104 | Ga0307513_10006523 | 3300031456 | Bacteria | 15243 |
| 105 | Ga0307516_10002854 | 3300031730 | Bacteria | 22744 |
| 106 | Ga0307413_10034682 | 3300031824 | Bacteria | 2886 |
| 107 | Ga0307414_10047503 | 3300032004 | Bacteria | 2954 |
| 108 | Ga0307411_10299416 | 3300032005 | Bacteria | 1289 |
| 109 | Ga0307510_10282715 | 3300033180 | Bacteria | 1129 |
| 110 | Ga0373936_0010319 | 3300035113 | Bacteria | 3524 |
| 111 | Ga0373955_0747167 | 3300035172 | Bacteria | 601 |
| 112 | Ga0373931_0193182 | 3300035691 | Bacteria | 1212 |
| 113 | Ga0373935_0108812 | 3300035692 | Bacteria | 1837 |
| 114 | Ga0373927_0011513 | 3300035695 | Bacteria | 5893 |
| 115 | Ga0373925_0002384 | 3300037068 | Bacteria | 15073 |
| 116 | Ga0395899_0000539 | 3300037312 | Bacteria | 41240 |
| 117 | Ga0395899_0124945 | 3300037312 | Bacteria | 1840 |
| 118 | Ga0395900_0000009 | 3300037418 | Bacteria | 476249 |
| 119 | Ga0395900_0037240 | 3300037418 | Bacteria | 5017 |
| 120 | Ga0395900_0723594 | 3300037418 | Bacteria | 927 |
| 121 | Ga0395898_0015851 | 3300037466 | Bacteria | 7722 |
| 122 | Ga0395898_0049001 | 3300037466 | Bacteria | 4141 |
| 123 | Ga0395898_0062239 | 3300037466 | Bacteria | 3624 |
| 124 | Ga0395905_0017330 | 3300037471 | Bacteria | 6839 |
| 125 | Ga0395905_0146442 | 3300037471 | Bacteria | 2222 |
| 126 | Ga0395905_0214846 | 3300037471 | Bacteria | 1801 |
| 127 | Ga0395905_0263629 | 3300037471 | Bacteria | 1608 |
| 128 | Ga0395905_0278035 | 3300037471 | Bacteria | 1560 |
| 129 | Ga0395905_0382960 | 3300037471 | Bacteria | 1300 |
| 130 | Ga0395901_0000007 | 3300038443 | Bacteria | 497408 |
| 131 | Ga0395901_0217972 | 3300038443 | Bacteria | 1995 |
| 132 | Ga0395901_0263309 | 3300038443 | Bacteria | 1794 |
| 133 | Ga0436365_0221080 | 3300039437 | Bacteria | 694 |
| 134 | Ga0436365_1124659 | 3300039437 | Bacteria | 2853 |
| 135 | Ga0436361_0988746 | 3300039447 | Bacteria | 563 |
| 136 | Ga0436361_0992091 | 3300039447 | Bacteria | 7726 |
| 137 | Ga0436361_1011731 | 3300039447 | Bacteria | 710 |
| 138 | Ga0439431_0024093 | 3300041997 | Bacteria | 1479 |
| 139 | Ga0466963_0207219 | 3300044694 | Bacteria | 1372 |
| 140 | Ga0466960_0057997 | 3300044901 | Bacteria | 1890 |
| 141 | Ga0466959_0012451 | 3300045049 | Bacteria | 6148 |
| 142 | Ga0495592_0097343 | 3300046454 | Bacteria | 2102 |
| 143 | Ga0495629_0065446 | 3300046459 | Bacteria | 2537 |
| 144 | Ga0495651_0468227 | 3300046462 | Bacteria | 812 |
| 145 | Ga0495583_0074995 | 3300046506 | Bacteria | 1480 |
| 146 | Ga0495583_0087502 | 3300046506 | Bacteria | 1346 |
| 147 | Ga0495620_0027011 | 3300046515 | Bacteria | 2692 |
| 148 | Ga0495620_0077197 | 3300046515 | Bacteria | 1353 |
| 149 | Ga0495630_0193448 | 3300046517 | Bacteria | 1552 |
| 150 | Ga0495643_0001946 | 3300046522 | Bacteria | 17374 |
| 151 | Ga0495644_0031853 | 3300046523 | Bacteria | 1993 |
| 152 | Ga0495642_0134164 | 3300046528 | Bacteria | 1067 |
| 153 | Ga0495654_0031793 | 3300046530 | Bacteria | 2678 |
| 154 | Ga0495609_0018131 | 3300046538 | Bacteria | 3265 |
| 155 | Ga0495597_0024312 | 3300046542 | Bacteria | 2797 |
| 156 | Ga0495622_0004662 | 3300046557 | Bacteria | 6354 |
| 157 | Ga0495668_0059985 | 3300046616 | Bacteria | 2099 |
| 158 | Ga0495668_0102333 | 3300046616 | Bacteria | 1567 |
| 159 | Ga0495668_0177284 | 3300046616 | Bacteria | 1168 |
| 160 | Ga0495625_0193566 | 3300046660 | Bacteria | 1345 |
| 161 | Ga0495669_0000003 | 3300046684 | Bacteria | 267741 |
| 162 | Ga0495669_0032850 | 3300046684 | Bacteria | 2282 |
| 163 | Ga0495672_0072687 | 3300047320 | Bacteria | 1942 |
| 164 | Ga0495687_072276 | 3300047443 | Bacteria | 1379 |
| 165 | Ga0495677_0148270 | 3300047445 | Bacteria | 903 |
| 166 | Ga0495686_0003811 | 3300047472 | Bacteria | 12799 |
| 167 | Ga0495686_0241342 | 3300047472 | Bacteria | 1019 |
| 168 | Ga0495686_0478010 | 3300047472 | Bacteria | 659 |
| 169 | Ga0496102_0222071 | 3300048905 | Bacteria | 1781 |
| 170 | Ga0496109_0072895 | 3300048912 | Bacteria | 3155 |
| 171 | Ga0496110_0657046 | 3300048913 | Bacteria | 948 |
| 172 | Ga0496111_0109958 | 3300048914 | Bacteria | 2030 |
| 173 | Ga0496112_0045576 | 3300048915 | Bacteria | 4299 |
| 174 | Ga0496112_0071875 | 3300048915 | Bacteria | 3420 |
| 175 | Ga0496115_0087884 | 3300048918 | Bacteria | 2537 |
| 176 | Ga0496125_0327403 | 3300048928 | Bacteria | 926 |
| 177 | Ga0501033_0332612 | 3300049570 | Bacteria | 1066 |
| 178 | Ga0501034_0576140 | 3300049571 | Bacteria | 1033 |
| 179 | Ga0501047_0009420 | 3300049581 | Bacteria | 9227 |
| 180 | Ga0501047_0472279 | 3300049581 | Bacteria | 1082 |
| 181 | Ga0501048_0052952 | 3300049582 | Bacteria | 2888 |
| 182 | Ga0501044_0397230 | 3300049823 | Bacteria | 1292 |
| 183 | Ga0501044_0951005 | 3300049823 | Bacteria | 732 |
| 184 | nmdc:mga03683_244601_c1 | 3300050489 | Bacteria | 832 |
| 185 | nmdc:mga03n38_635666_c1 | 3300050490 | Bacteria | 610 |
| 186 | nmdc:mga04h51_298932_c1 | 3300050495 | Bacteria | 655 |
| 187 | Ga0500643_009345 | 3300053087 | Bacteria | 3752 |
| 188 | Ga0500595_004337 | 3300053119 | Bacteria | 6385 |
| 189 | Ga0500595_030170 | 3300053119 | Bacteria | 1831 |
| 190 | Ga0500590_018369 | 3300053148 | Bacteria | 3617 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005329 | Ga0070683_101370266 | Ga0070683_1013702661 | 116 |
| 2 | 3300045049 | Ga0466959_0012451 | Ga0466959_0012451_4908_5390 | 117 |
| 3 | 3300048918 | Ga0496115_0087884 | Ga0496115_0087884_380_853 | 117 |
| 4 | 3300050495 | nmdc:mga04h51_298932_c1 | nmdc:mga04h51_298932_c1_21_452 | 117 |
| 5 | 3300026078 | Ga0207702_10474308 | Ga0207702_104743082 | 118 |
| 6 | 3300047472 | Ga0495686_0478010 | Ga0495686_0478010_138_626 | 118 |
| 7 | 3300037312 | Ga0395899_0000539 | Ga0395899_0000539_30273_30758 | 122 |
| 8 | 3300037418 | Ga0395900_0000009 | Ga0395900_0000009_434749_435234 | 122 |
| 9 | 3300037466 | Ga0395898_0015851 | Ga0395898_0015851_1873_2358 | 122 |
| 10 | 3300037471 | Ga0395905_0382960 | Ga0395905_0382960_626_1111 | 122 |
| 11 | 3300038443 | Ga0395901_0000007 | Ga0395901_0000007_10483_10968 | 122 |
| 12 | 3300009093 | Ga0105240_11359942 | Ga0105240_113599422 | 123 |
| 13 | 3300037418 | Ga0395900_0723594 | Ga0395900_0723594_238_729 | 123 |
| 14 | 3300005841 | Ga0068863_101016690 | Ga0068863_1010166902 | 124 |
| 15 | 3300025924 | Ga0207694_10215362 | Ga0207694_102153623 | 124 |
| 16 | 3300026088 | Ga0207641_10575290 | Ga0207641_105752902 | 124 |
| 17 | 3300037471 | Ga0395905_0017330 | Ga0395905_0017330_6011_6499 | 124 |
| 18 | 3300013306 | Ga0163162_11567556 | Ga0163162_115675562 | 125 |
| 19 | 3300037471 | Ga0395905_0146442 | Ga0395905_0146442_873_1361 | 125 |
| 20 | 3300005841 | Ga0068863_100090191 | Ga0068863_1000901916 | 126 |
| 21 | 3300009092 | Ga0105250_10238801 | Ga0105250_102388012 | 126 |
| 22 | 3300009553 | Ga0105249_10486933 | Ga0105249_104869332 | 126 |
| 23 | 3300025250 | Ga0209026_1000527 | Ga0209026_100052713 | 126 |
| 24 | 3300025941 | Ga0207711_11001719 | Ga0207711_110017192 | 126 |
| 25 | 3300026088 | Ga0207641_10084043 | Ga0207641_100840432 | 126 |
| 26 | 3300037471 | Ga0395905_0278035 | Ga0395905_0278035_494_967 | 126 |
| 27 | 3300038443 | Ga0395901_0263309 | Ga0395901_0263309_955_1428 | 126 |
| 28 | 3300005444 | Ga0070694_100958939 | Ga0070694_1009589392 | 127 |
| 29 | 3300005458 | Ga0070681_10026596 | Ga0070681_100265967 | 127 |
| 30 | 3300005563 | Ga0068855_102285477 | Ga0068855_1022854771 | 127 |
| 31 | 3300005844 | Ga0068862_100092658 | Ga0068862_1000926584 | 127 |
| 32 | 3300013100 | Ga0157373_10489385 | Ga0157373_104893852 | 127 |
| 33 | 3300013105 | Ga0157369_10298149 | Ga0157369_102981492 | 127 |
| 34 | 3300025912 | Ga0207707_10012529 | Ga0207707_100125292 | 127 |
| 35 | 3300025913 | Ga0207695_10006160 | Ga0207695_100061606 | 127 |
| 36 | 3300025932 | Ga0207690_10146152 | Ga0207690_101461522 | 127 |
| 37 | 3300025949 | Ga0207667_10019205 | Ga0207667_100192055 | 127 |
| 38 | 3300028380 | Ga0268265_10041957 | Ga0268265_100419572 | 127 |
| 39 | 3300031251 | Ga0265327_10000190 | Ga0265327_1000019065 | 127 |
| 40 | 3300037312 | Ga0395899_0124945 | Ga0395899_0124945_1028_1510 | 127 |
| 41 | 3300037418 | Ga0395900_0037240 | Ga0395900_0037240_435_917 | 127 |
| 42 | 3300037466 | Ga0395898_0062239 | Ga0395898_0062239_1136_1618 | 127 |
| 43 | 3300038443 | Ga0395901_0217972 | Ga0395901_0217972_1261_1743 | 127 |
| 44 | 3300046684 | Ga0495669_0032850 | Ga0495669_0032850_423_908 | 127 |
| 45 | 3300053119 | Ga0500595_030170 | Ga0500595_030170_1134_1625 | 127 |
| 46 | 3300005564 | Ga0070664_100122447 | Ga0070664_1001224472 | 128 |
| 47 | 3300021384 | Ga0213876_10484668 | Ga0213876_104846681 | 128 |
| 48 | 3300025945 | Ga0207679_10452311 | Ga0207679_104523112 | 128 |
| 49 | 3300037466 | Ga0395898_0049001 | Ga0395898_0049001_2830_3303 | 128 |
| 50 | 3300039437 | Ga0436365_0221080 | Ga0436365_0221080_131_613 | 128 |
| 51 | 3300044694 | Ga0466963_0207219 | Ga0466963_0207219_760_1248 | 128 |
| 52 | 3300047472 | Ga0495686_0003811 | Ga0495686_0003811_3956_4447 | 128 |
| 53 | 3300049570 | Ga0501033_0332612 | Ga0501033_0332612_255_752 | 128 |
| 54 | 3300049581 | Ga0501047_0472279 | Ga0501047_0472279_256_747 | 128 |
| 55 | 3300049582 | Ga0501048_0052952 | Ga0501048_0052952_848_1336 | 128 |
| 56 | iso_pu_bacteria | 2643221598 | 2644000360 | 128 |
| 57 | iso_pu_bacteria | 2643221614 | 2644084871 | 128 |
| 58 | iso_pu_bacteria | 2643221661 | 2644342423 | 128 |
| 59 | iso_pu_bacteria | 2643221666 | 2644365723 | 128 |
| 60 | 3300005456 | Ga0070678_101409126 | Ga0070678_1014091261 | 129 |
| 61 | 3300005563 | Ga0068855_100049752 | Ga0068855_1000497523 | 129 |
| 62 | 3300009093 | Ga0105240_10584807 | Ga0105240_105848072 | 129 |
| 63 | 3300009545 | Ga0105237_10711906 | Ga0105237_107119062 | 129 |
| 64 | 3300010375 | Ga0105239_11368000 | Ga0105239_113680002 | 129 |
| 65 | 3300025914 | Ga0207671_10962542 | Ga0207671_109625422 | 129 |
| 66 | 3300025949 | Ga0207667_10090164 | Ga0207667_100901644 | 129 |
| 67 | 3300026067 | Ga0207678_10296797 | Ga0207678_102967972 | 129 |
| 68 | 3300039437 | Ga0436365_1124659 | Ga0436365_1124659_1770_2258 | 129 |
| 69 | 3300046517 | Ga0495630_0193448 | Ga0495630_0193448_405_902 | 129 |
| 70 | 3300046684 | Ga0495669_0000003 | Ga0495669_0000003_149582_150049 | 129 |
| 71 | 3300049581 | Ga0501047_0009420 | Ga0501047_0009420_926_1408 | 129 |
| 72 | 3300049823 | Ga0501044_0951005 | Ga0501044_0951005_123_605 | 129 |
| 73 | 3300009098 | Ga0105245_10393622 | Ga0105245_103936222 | 130 |
| 74 | 3300025913 | Ga0207695_10458735 | Ga0207695_104587352 | 130 |
| 75 | 3300025927 | Ga0207687_10326325 | Ga0207687_103263252 | 130 |
| 76 | 3300026121 | Ga0207683_10697399 | Ga0207683_106973992 | 130 |
| 77 | 3300037471 | Ga0395905_0263629 | Ga0395905_0263629_367_861 | 130 |
| 78 | 3300047320 | Ga0495672_0072687 | Ga0495672_0072687_1188_1676 | 130 |
| 79 | 3300047472 | Ga0495686_0241342 | Ga0495686_0241342_162_650 | 130 |
| 80 | 3300048928 | Ga0496125_0327403 | Ga0496125_0327403_202_675 | 130 |
| 81 | 3300005329 | Ga0070683_100841984 | Ga0070683_1008419842 | 131 |
| 82 | 3300006881 | Ga0068865_100002935 | Ga0068865_1000029355 | 131 |
| 83 | 3300009093 | Ga0105240_10177718 | Ga0105240_101777182 | 131 |
| 84 | 3300009177 | Ga0105248_10837307 | Ga0105248_108373072 | 131 |
| 85 | 3300013308 | Ga0157375_10388814 | Ga0157375_103888144 | 131 |
| 86 | 3300021361 | Ga0213872_10009974 | Ga0213872_100099742 | 131 |
| 87 | 3300025934 | Ga0207686_10680065 | Ga0207686_106800652 | 131 |
| 88 | 3300025938 | Ga0207704_10008396 | Ga0207704_100083967 | 131 |
| 89 | 3300025942 | Ga0207689_10584304 | Ga0207689_105843042 | 131 |
| 90 | 3300025945 | Ga0207679_10124237 | Ga0207679_101242372 | 131 |
| 91 | 3300025949 | Ga0207667_10162853 | Ga0207667_101628534 | 131 |
| 92 | 3300025960 | Ga0207651_10100012 | Ga0207651_101000122 | 131 |
| 93 | 3300031456 | Ga0307513_10000856 | Ga0307513_100008567 | 131 |
| 94 | 3300031730 | Ga0307516_10002854 | Ga0307516_1000285413 | 131 |
| 95 | 3300033180 | Ga0307510_10282715 | Ga0307510_102827152 | 131 |
| 96 | 3300035692 | Ga0373935_0108812 | Ga0373935_0108812_588_1061 | 131 |
| 97 | 3300039447 | Ga0436361_0988746 | Ga0436361_0988746_39_521 | 131 |
| 98 | 3300039447 | Ga0436361_0992091 | Ga0436361_0992091_1886_2368 | 131 |
| 99 | 3300039447 | Ga0436361_1011731 | Ga0436361_1011731_81_563 | 131 |
| 100 | 3300041997 | Ga0439431_0024093 | Ga0439431_0024093_440_931 | 131 |
| 101 | 3300046462 | Ga0495651_0468227 | Ga0495651_0468227_15_512 | 131 |
| 102 | 3300048915 | Ga0496112_0071875 | Ga0496112_0071875_1781_2266 | 131 |
| 103 | 3300050489 | nmdc:mga03683_244601_c1 | nmdc:mga03683_244601_c1_13_498 | 131 |
| 104 | 3300005338 | Ga0068868_100498769 | Ga0068868_1004987692 | 132 |
| 105 | 3300005339 | Ga0070660_100232122 | Ga0070660_1002321222 | 132 |
| 106 | 3300005456 | Ga0070678_100071789 | Ga0070678_1000717894 | 132 |
| 107 | 3300005539 | Ga0068853_100755111 | Ga0068853_1007551111 | 132 |
| 108 | 3300005564 | Ga0070664_101246193 | Ga0070664_1012461932 | 132 |
| 109 | 3300005614 | Ga0068856_100516550 | Ga0068856_1005165502 | 132 |
| 110 | 3300005614 | Ga0068856_101119224 | Ga0068856_1011192241 | 132 |
| 111 | 3300005618 | Ga0068864_100007323 | Ga0068864_1000073236 | 132 |
| 112 | 3300005618 | Ga0068864_100196170 | Ga0068864_1001961702 | 132 |
| 113 | 3300005841 | Ga0068863_101161116 | Ga0068863_1011611161 | 132 |
| 114 | 3300005842 | Ga0068858_100611386 | Ga0068858_1006113862 | 132 |
| 115 | 3300009093 | Ga0105240_10024963 | Ga0105240_100249639 | 132 |
| 116 | 3300009551 | Ga0105238_10036393 | Ga0105238_100363935 | 132 |
| 117 | 3300013296 | Ga0157374_10169253 | Ga0157374_101692534 | 132 |
| 118 | 3300013308 | Ga0157375_10134351 | Ga0157375_101343512 | 132 |
| 119 | 3300014325 | Ga0163163_10394698 | Ga0163163_103946981 | 132 |
| 120 | 3300014968 | Ga0157379_11030498 | Ga0157379_110304982 | 132 |
| 121 | 3300017792 | Ga0163161_10318128 | Ga0163161_103181281 | 132 |
| 122 | 3300025903 | Ga0207680_10241455 | Ga0207680_102414552 | 132 |
| 123 | 3300025911 | Ga0207654_10176013 | Ga0207654_101760131 | 132 |
| 124 | 3300025913 | Ga0207695_10016645 | Ga0207695_100166459 | 132 |
| 125 | 3300025920 | Ga0207649_10513471 | Ga0207649_105134712 | 132 |
| 126 | 3300025931 | Ga0207644_10017128 | Ga0207644_100171287 | 132 |
| 127 | 3300025931 | Ga0207644_10022189 | Ga0207644_100221892 | 132 |
| 128 | 3300025933 | Ga0207706_10084419 | Ga0207706_100844192 | 132 |
| 129 | 3300025941 | Ga0207711_10031211 | Ga0207711_100312113 | 132 |
| 130 | 3300025942 | Ga0207689_10633056 | Ga0207689_106330561 | 132 |
| 131 | 3300025945 | Ga0207679_10247065 | Ga0207679_102470652 | 132 |
| 132 | 3300026023 | Ga0207677_10332252 | Ga0207677_103322522 | 132 |
| 133 | 3300026088 | Ga0207641_10296198 | Ga0207641_102961982 | 132 |
| 134 | 3300026095 | Ga0207676_10026738 | Ga0207676_100267384 | 132 |
| 135 | 3300026118 | Ga0207675_102266252 | Ga0207675_1022662521 | 132 |
| 136 | 3300026121 | Ga0207683_10101009 | Ga0207683_101010092 | 132 |
| 137 | 3300028379 | Ga0268266_11030123 | Ga0268266_110301232 | 132 |
| 138 | 3300028380 | Ga0268265_10861096 | Ga0268265_108610962 | 132 |
| 139 | 3300028786 | Ga0307517_10094005 | Ga0307517_100940052 | 132 |
| 140 | 3300031251 | Ga0265327_10029919 | Ga0265327_100299194 | 132 |
| 141 | 3300031824 | Ga0307413_10034682 | Ga0307413_100346825 | 132 |
| 142 | 3300032004 | Ga0307414_10047503 | Ga0307414_100475032 | 132 |
| 143 | 3300032005 | Ga0307411_10299416 | Ga0307411_102994162 | 132 |
| 144 | 3300035113 | Ga0373936_0010319 | Ga0373936_0010319_874_1365 | 132 |
| 145 | 3300035172 | Ga0373955_0747167 | Ga0373955_0747167_35_529 | 132 |
| 146 | 3300035691 | Ga0373931_0193182 | Ga0373931_0193182_694_1185 | 132 |
| 147 | 3300035695 | Ga0373927_0011513 | Ga0373927_0011513_1316_1792 | 132 |
| 148 | 3300037068 | Ga0373925_0002384 | Ga0373925_0002384_9287_9763 | 132 |
| 149 | 3300044901 | Ga0466960_0057997 | Ga0466960_0057997_981_1469 | 132 |
| 150 | 3300046454 | Ga0495592_0097343 | Ga0495592_0097343_384_878 | 132 |
| 151 | 3300046506 | Ga0495583_0087502 | Ga0495583_0087502_260_748 | 132 |
| 152 | 3300046523 | Ga0495644_0031853 | Ga0495644_0031853_1114_1602 | 132 |
| 153 | 3300046528 | Ga0495642_0134164 | Ga0495642_0134164_407_823 | 132 |
| 154 | 3300046616 | Ga0495668_0102333 | Ga0495668_0102333_992_1480 | 132 |
| 155 | 3300047445 | Ga0495677_0148270 | Ga0495677_0148270_89_577 | 132 |
| 156 | 3300048905 | Ga0496102_0222071 | Ga0496102_0222071_294_782 | 132 |
| 157 | 3300048912 | Ga0496109_0072895 | Ga0496109_0072895_588_1076 | 132 |
| 158 | 3300048913 | Ga0496110_0657046 | Ga0496110_0657046_178_666 | 132 |
| 159 | 3300048914 | Ga0496111_0109958 | Ga0496111_0109958_233_721 | 132 |
| 160 | 3300048915 | Ga0496112_0045576 | Ga0496112_0045576_226_714 | 132 |
| 161 | 3300049571 | Ga0501034_0576140 | Ga0501034_0576140_187_681 | 132 |
| 162 | 3300049823 | Ga0501044_0397230 | Ga0501044_0397230_453_950 | 132 |
| 163 | 3300053087 | Ga0500643_009345 | Ga0500643_009345_2016_2504 | 132 |
| 164 | 3300005340 | Ga0070689_100657749 | Ga0070689_1006577492 | 133 |
| 165 | 3300005471 | Ga0070698_101281960 | Ga0070698_1012819601 | 133 |
| 166 | 3300005616 | Ga0068852_100331164 | Ga0068852_1003311644 | 133 |
| 167 | 3300005618 | Ga0068864_100678866 | Ga0068864_1006788662 | 133 |
| 168 | 3300005718 | Ga0068866_10155645 | Ga0068866_101556454 | 133 |
| 169 | 3300006048 | Ga0075363_100061199 | Ga0075363_1000611993 | 133 |
| 170 | 3300006177 | Ga0075362_10076948 | Ga0075362_100769482 | 133 |
| 171 | 3300025936 | Ga0207670_10379308 | Ga0207670_103793082 | 133 |
| 172 | 3300026041 | Ga0207639_10903371 | Ga0207639_109033712 | 133 |
| 173 | 3300026142 | Ga0207698_11059209 | Ga0207698_110592092 | 133 |
| 174 | 3300030521 | Ga0307511_10038842 | Ga0307511_100388426 | 133 |
| 175 | 3300031456 | Ga0307513_10006523 | Ga0307513_1000652311 | 133 |
| 176 | 3300037471 | Ga0395905_0214846 | Ga0395905_0214846_406_897 | 133 |
| 177 | 3300046459 | Ga0495629_0065446 | Ga0495629_0065446_1010_1501 | 133 |
| 178 | 3300046506 | Ga0495583_0074995 | Ga0495583_0074995_913_1410 | 133 |
| 179 | 3300046515 | Ga0495620_0027011 | Ga0495620_0027011_175_672 | 133 |
| 180 | 3300046515 | Ga0495620_0077197 | Ga0495620_0077197_115_612 | 133 |
| 181 | 3300046522 | Ga0495643_0001946 | Ga0495643_0001946_8039_8530 | 133 |
| 182 | 3300046530 | Ga0495654_0031793 | Ga0495654_0031793_1487_1978 | 133 |
| 183 | 3300046538 | Ga0495609_0018131 | Ga0495609_0018131_1634_2125 | 133 |
| 184 | 3300046542 | Ga0495597_0024312 | Ga0495597_0024312_1488_1979 | 133 |
| 185 | 3300046557 | Ga0495622_0004662 | Ga0495622_0004662_734_1225 | 133 |
| 186 | 3300046616 | Ga0495668_0059985 | Ga0495668_0059985_137_628 | 133 |
| 187 | 3300046616 | Ga0495668_0177284 | Ga0495668_0177284_373_855 | 133 |
| 188 | 3300046660 | Ga0495625_0193566 | Ga0495625_0193566_644_1135 | 133 |
| 189 | 3300047443 | Ga0495687_072276 | Ga0495687_072276_380_871 | 133 |
| 190 | 3300050490 | nmdc:mga03n38_635666_c1 | nmdc:mga03n38_635666_c1_116_598 | 133 |
| 191 | 3300053119 | Ga0500595_004337 | Ga0500595_004337_2534_3025 | 133 |
| 192 | 3300053148 | Ga0500590_018369 | Ga0500590_018369_2999_3490 | 133 |
| 193 | 3300003794 | Ga0055531_10037083 | Ga0055531_100370833 | 134 |
| 194 | 3300025304 | Ga0209257_1000807 | Ga0209257_100080714 | 134 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hr7-assembly1.cif.gz_B | crystal structure of biotin carboxyl carrier protein-biotin carboxylase complex from e.coli | 0.9872 | 58 | 134 |
| 5gu9-assembly1.cif.gz_A | structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138i mutant | 0.9747 | 59 | 134 |
| 5gua-assembly1.cif.gz_A | structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138y mutant | 0.965 | 59 | 134 |
| 2d5d-assembly1.cif.gz_A | structure of biotin carboxyl carrier protein (74val start) from pyrococcus horikoshi ot3 ligand free form ii | 0.955 | 59 | 134 |
| 2ejg-assembly1.cif.gz_C | crystal structure of the biotin protein ligase (mutation r48a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3 | 0.955 | 59 | 134 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1LWR8_198_274_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.989 | 58 | 133 | 2.40.50.100 |
| af_Q58628_489_566_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9687 | 60 | 133 | 2.40.50.100 |
| af_I1LWR8_198_274_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.964 | 58 | 133 | 2.40.50.100 |
| af_Q2FXX0_70_148_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9612 | 58 | 131 | 2.40.50.100 |
| af_P9WPQ1_4_71_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9559 | 60 | 134 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529W1G6-F1-model_v4 | Biotin carboxyl carrier protein of acetyl-CoA carboxylase | 1.003 | 60 | 134 |
GO:0003989
GO:0006633 GO:0009317 |
| AF-A0A507ZU19-F1-model_v4 | Biotin carboxyl carrier protein of acetyl-CoA carboxylase | 0.9979 | 58 | 134 |
GO:0003989
GO:0006633 GO:0009317 |
| AF-A0A399F3B0-F1-model_v4 | Biotin carboxyl carrier protein of acetyl-CoA carboxylase | 0.9963 | 59 | 134 |
GO:0003989
GO:0006633 GO:0009317 |
| AF-T0HBY7-F1-model_v4 | Biotin carboxyl carrier protein of acetyl-CoA carboxylase | 0.9953 | 58 | 134 |
GO:0003989
GO:0006633 GO:0009317 |
| AF-A0A4Y8MCD6-F1-model_v4 | deleted | 0.9924 | 59 | 134 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar