F299379

General Info

Members Datasets Scaffolds Average Seq Length
194 140 190 134

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221598|2644000360
Length 155
Sequence PKAPADPIDARMVRKLADILTDTGLSEIEVECDGLKIRVAKTLTSAPIQYAPAPAPVAAVAAPIAAPAGEAPAPERRKGDVVNSPMVGTVYLQPQPDSPAFVKVGDMVSAGQTLLIVEAMKTMNPIPAPKAGKVVEIIVEDAQPVEFGEPLVVIE

Samples

Sample ID Description Type Environment
1 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
2 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
3 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
4 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
46 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
78 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
85 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
86 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
99 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
100 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
101 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
102 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
105 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
106 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
107 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
110 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
111 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
112 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
113 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
114 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
115 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
116 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
121 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
130 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
136 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
137 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
138 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
139 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
140 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.94
Metatranscriptomes 0
Isolates 2.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.67
Nodule 0
Rhizoplane 3.61
Rhizosphere 82.99
Stem 0
Stem Tuber 0
Unclassified 7.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055531_10037083 3300003794 Bacteria 1489
2 Ga0070683_100841984 3300005329 Bacteria 880
3 Ga0070683_101370266 3300005329 Bacteria 680
4 Ga0068868_100498769 3300005338 Bacteria 1066
5 Ga0070660_100232122 3300005339 Bacteria 1501
6 Ga0070689_100657749 3300005340 Bacteria 912
7 Ga0070694_100958939 3300005444 Bacteria 708
8 Ga0070678_100071789 3300005456 Bacteria 2592
9 Ga0070678_101409126 3300005456 Bacteria 651
10 Ga0070681_10026596 3300005458 Bacteria 5815
11 Ga0070698_101281960 3300005471 Bacteria 683
12 Ga0068853_100755111 3300005539 Bacteria 930
13 Ga0068855_100049752 3300005563 Bacteria 4942
14 Ga0068855_102285477 3300005563 Bacteria 541
15 Ga0070664_100122447 3300005564 Bacteria 2278
16 Ga0070664_101246193 3300005564 Bacteria 702
17 Ga0068856_100516550 3300005614 Bacteria 1216
18 Ga0068856_101119224 3300005614 Bacteria 805
19 Ga0068852_100331164 3300005616 Bacteria 1482
20 Ga0068864_100007323 3300005618 Bacteria 9081
21 Ga0068864_100196170 3300005618 Bacteria 1853
22 Ga0068864_100678866 3300005618 Bacteria 1005
23 Ga0068866_10155645 3300005718 Bacteria 1328
24 Ga0068863_100090191 3300005841 Bacteria 2907
25 Ga0068863_101016690 3300005841 Bacteria 832
26 Ga0068863_101161116 3300005841 Bacteria 777
27 Ga0068858_100611386 3300005842 Bacteria 1058
28 Ga0068862_100092658 3300005844 Bacteria 2634
29 Ga0075363_100061199 3300006048 Bacteria 2028
30 Ga0075362_10076948 3300006177 Bacteria 1532
31 Ga0068865_100002935 3300006881 Bacteria 10167
32 Ga0105250_10238801 3300009092 Bacteria 774
33 Ga0105240_10024963 3300009093 Bacteria 7867
34 Ga0105240_10177718 3300009093 Bacteria 2515
35 Ga0105240_10584807 3300009093 Bacteria 1231
36 Ga0105240_11359942 3300009093 Bacteria 747
37 Ga0105245_10393622 3300009098 Bacteria 1383
38 Ga0105248_10837307 3300009177 Bacteria 1038
39 Ga0105237_10711906 3300009545 Bacteria 1011
40 Ga0105238_10036393 3300009551 Bacteria 5003
41 Ga0105249_10486933 3300009553 Bacteria 1277
42 Ga0105239_11368000 3300010375 Bacteria 817
43 Ga0157373_10489385 3300013100 Bacteria 888
44 Ga0157369_10298149 3300013105 Bacteria 1677
45 Ga0157374_10169253 3300013296 Bacteria 2130
46 Ga0163162_11567556 3300013306 Bacteria 751
47 Ga0157375_10134351 3300013308 Bacteria 2596
48 Ga0157375_10388814 3300013308 Bacteria 1562
49 Ga0163163_10394698 3300014325 Bacteria 1442
50 Ga0157379_11030498 3300014968 Bacteria 786
51 Ga0163161_10318128 3300017792 Bacteria 1229
52 Ga0213872_10009974 3300021361 Bacteria 4533
53 Ga0213876_10484668 3300021384 Bacteria 658
54 Ga0209026_1000527 3300025250 Bacteria 26703
55 Ga0209257_1000807 3300025304 Bacteria 45532
56 Ga0207680_10241455 3300025903 Bacteria 1245
57 Ga0207654_10176013 3300025911 Bacteria 1393
58 Ga0207707_10012529 3300025912 Bacteria 7372
59 Ga0207695_10006160 3300025913 Bacteria 15637
60 Ga0207695_10016645 3300025913 Bacteria 8594
61 Ga0207695_10458735 3300025913 Bacteria 1157
62 Ga0207671_10962542 3300025914 Bacteria 673
63 Ga0207649_10513471 3300025920 Bacteria 913
64 Ga0207694_10215362 3300025924 Bacteria 1565
65 Ga0207687_10326325 3300025927 Bacteria 1244
66 Ga0207644_10017128 3300025931 Bacteria 4887
67 Ga0207644_10022189 3300025931 Bacteria 4335
68 Ga0207690_10146152 3300025932 Bacteria 1748
69 Ga0207706_10084419 3300025933 Bacteria 2792
70 Ga0207686_10680065 3300025934 Bacteria 816
71 Ga0207670_10379308 3300025936 Bacteria 1126
72 Ga0207704_10008396 3300025938 Bacteria 4937
73 Ga0207711_10031211 3300025941 Bacteria 4497
74 Ga0207711_11001719 3300025941 Bacteria 775
75 Ga0207689_10584304 3300025942 Bacteria 939
76 Ga0207689_10633056 3300025942 Bacteria 901
77 Ga0207679_10124237 3300025945 Bacteria 2060
78 Ga0207679_10247065 3300025945 Bacteria 1515
79 Ga0207679_10452311 3300025945 Bacteria 1139
80 Ga0207667_10019205 3300025949 Bacteria 7642
81 Ga0207667_10090164 3300025949 Bacteria 3169
82 Ga0207667_10162853 3300025949 Bacteria 2294
83 Ga0207651_10100012 3300025960 Bacteria 2149
84 Ga0207677_10332252 3300026023 Bacteria 1267
85 Ga0207639_10903371 3300026041 Bacteria 825
86 Ga0207678_10296797 3300026067 Bacteria 1388
87 Ga0207702_10474308 3300026078 Bacteria 1217
88 Ga0207641_10084043 3300026088 Bacteria 2770
89 Ga0207641_10296198 3300026088 Bacteria 1526
90 Ga0207641_10575290 3300026088 Bacteria 1101
91 Ga0207676_10026738 3300026095 Bacteria 4291
92 Ga0207675_102266252 3300026118 Bacteria 557
93 Ga0207683_10101009 3300026121 Bacteria 2575
94 Ga0207683_10697399 3300026121 Bacteria 941
95 Ga0207698_11059209 3300026142 Bacteria 823
96 Ga0268266_11030123 3300028379 Bacteria 796
97 Ga0268265_10041957 3300028380 Bacteria 3391
98 Ga0268265_10861096 3300028380 Bacteria 887
99 Ga0307517_10094005 3300028786 Bacteria 2425
100 Ga0307511_10038842 3300030521 Bacteria 4078
101 Ga0265327_10000190 3300031251 Bacteria 130086
102 Ga0265327_10029919 3300031251 Bacteria 3088
103 Ga0307513_10000856 3300031456 Bacteria 44279
104 Ga0307513_10006523 3300031456 Bacteria 15243
105 Ga0307516_10002854 3300031730 Bacteria 22744
106 Ga0307413_10034682 3300031824 Bacteria 2886
107 Ga0307414_10047503 3300032004 Bacteria 2954
108 Ga0307411_10299416 3300032005 Bacteria 1289
109 Ga0307510_10282715 3300033180 Bacteria 1129
110 Ga0373936_0010319 3300035113 Bacteria 3524
111 Ga0373955_0747167 3300035172 Bacteria 601
112 Ga0373931_0193182 3300035691 Bacteria 1212
113 Ga0373935_0108812 3300035692 Bacteria 1837
114 Ga0373927_0011513 3300035695 Bacteria 5893
115 Ga0373925_0002384 3300037068 Bacteria 15073
116 Ga0395899_0000539 3300037312 Bacteria 41240
117 Ga0395899_0124945 3300037312 Bacteria 1840
118 Ga0395900_0000009 3300037418 Bacteria 476249
119 Ga0395900_0037240 3300037418 Bacteria 5017
120 Ga0395900_0723594 3300037418 Bacteria 927
121 Ga0395898_0015851 3300037466 Bacteria 7722
122 Ga0395898_0049001 3300037466 Bacteria 4141
123 Ga0395898_0062239 3300037466 Bacteria 3624
124 Ga0395905_0017330 3300037471 Bacteria 6839
125 Ga0395905_0146442 3300037471 Bacteria 2222
126 Ga0395905_0214846 3300037471 Bacteria 1801
127 Ga0395905_0263629 3300037471 Bacteria 1608
128 Ga0395905_0278035 3300037471 Bacteria 1560
129 Ga0395905_0382960 3300037471 Bacteria 1300
130 Ga0395901_0000007 3300038443 Bacteria 497408
131 Ga0395901_0217972 3300038443 Bacteria 1995
132 Ga0395901_0263309 3300038443 Bacteria 1794
133 Ga0436365_0221080 3300039437 Bacteria 694
134 Ga0436365_1124659 3300039437 Bacteria 2853
135 Ga0436361_0988746 3300039447 Bacteria 563
136 Ga0436361_0992091 3300039447 Bacteria 7726
137 Ga0436361_1011731 3300039447 Bacteria 710
138 Ga0439431_0024093 3300041997 Bacteria 1479
139 Ga0466963_0207219 3300044694 Bacteria 1372
140 Ga0466960_0057997 3300044901 Bacteria 1890
141 Ga0466959_0012451 3300045049 Bacteria 6148
142 Ga0495592_0097343 3300046454 Bacteria 2102
143 Ga0495629_0065446 3300046459 Bacteria 2537
144 Ga0495651_0468227 3300046462 Bacteria 812
145 Ga0495583_0074995 3300046506 Bacteria 1480
146 Ga0495583_0087502 3300046506 Bacteria 1346
147 Ga0495620_0027011 3300046515 Bacteria 2692
148 Ga0495620_0077197 3300046515 Bacteria 1353
149 Ga0495630_0193448 3300046517 Bacteria 1552
150 Ga0495643_0001946 3300046522 Bacteria 17374
151 Ga0495644_0031853 3300046523 Bacteria 1993
152 Ga0495642_0134164 3300046528 Bacteria 1067
153 Ga0495654_0031793 3300046530 Bacteria 2678
154 Ga0495609_0018131 3300046538 Bacteria 3265
155 Ga0495597_0024312 3300046542 Bacteria 2797
156 Ga0495622_0004662 3300046557 Bacteria 6354
157 Ga0495668_0059985 3300046616 Bacteria 2099
158 Ga0495668_0102333 3300046616 Bacteria 1567
159 Ga0495668_0177284 3300046616 Bacteria 1168
160 Ga0495625_0193566 3300046660 Bacteria 1345
161 Ga0495669_0000003 3300046684 Bacteria 267741
162 Ga0495669_0032850 3300046684 Bacteria 2282
163 Ga0495672_0072687 3300047320 Bacteria 1942
164 Ga0495687_072276 3300047443 Bacteria 1379
165 Ga0495677_0148270 3300047445 Bacteria 903
166 Ga0495686_0003811 3300047472 Bacteria 12799
167 Ga0495686_0241342 3300047472 Bacteria 1019
168 Ga0495686_0478010 3300047472 Bacteria 659
169 Ga0496102_0222071 3300048905 Bacteria 1781
170 Ga0496109_0072895 3300048912 Bacteria 3155
171 Ga0496110_0657046 3300048913 Bacteria 948
172 Ga0496111_0109958 3300048914 Bacteria 2030
173 Ga0496112_0045576 3300048915 Bacteria 4299
174 Ga0496112_0071875 3300048915 Bacteria 3420
175 Ga0496115_0087884 3300048918 Bacteria 2537
176 Ga0496125_0327403 3300048928 Bacteria 926
177 Ga0501033_0332612 3300049570 Bacteria 1066
178 Ga0501034_0576140 3300049571 Bacteria 1033
179 Ga0501047_0009420 3300049581 Bacteria 9227
180 Ga0501047_0472279 3300049581 Bacteria 1082
181 Ga0501048_0052952 3300049582 Bacteria 2888
182 Ga0501044_0397230 3300049823 Bacteria 1292
183 Ga0501044_0951005 3300049823 Bacteria 732
184 nmdc:mga03683_244601_c1 3300050489 Bacteria 832
185 nmdc:mga03n38_635666_c1 3300050490 Bacteria 610
186 nmdc:mga04h51_298932_c1 3300050495 Bacteria 655
187 Ga0500643_009345 3300053087 Bacteria 3752
188 Ga0500595_004337 3300053119 Bacteria 6385
189 Ga0500595_030170 3300053119 Bacteria 1831
190 Ga0500590_018369 3300053148 Bacteria 3617

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_101370266 Ga0070683_1013702661 116
2 3300045049 Ga0466959_0012451 Ga0466959_0012451_4908_5390 117
3 3300048918 Ga0496115_0087884 Ga0496115_0087884_380_853 117
4 3300050495 nmdc:mga04h51_298932_c1 nmdc:mga04h51_298932_c1_21_452 117
5 3300026078 Ga0207702_10474308 Ga0207702_104743082 118
6 3300047472 Ga0495686_0478010 Ga0495686_0478010_138_626 118
7 3300037312 Ga0395899_0000539 Ga0395899_0000539_30273_30758 122
8 3300037418 Ga0395900_0000009 Ga0395900_0000009_434749_435234 122
9 3300037466 Ga0395898_0015851 Ga0395898_0015851_1873_2358 122
10 3300037471 Ga0395905_0382960 Ga0395905_0382960_626_1111 122
11 3300038443 Ga0395901_0000007 Ga0395901_0000007_10483_10968 122
12 3300009093 Ga0105240_11359942 Ga0105240_113599422 123
13 3300037418 Ga0395900_0723594 Ga0395900_0723594_238_729 123
14 3300005841 Ga0068863_101016690 Ga0068863_1010166902 124
15 3300025924 Ga0207694_10215362 Ga0207694_102153623 124
16 3300026088 Ga0207641_10575290 Ga0207641_105752902 124
17 3300037471 Ga0395905_0017330 Ga0395905_0017330_6011_6499 124
18 3300013306 Ga0163162_11567556 Ga0163162_115675562 125
19 3300037471 Ga0395905_0146442 Ga0395905_0146442_873_1361 125
20 3300005841 Ga0068863_100090191 Ga0068863_1000901916 126
21 3300009092 Ga0105250_10238801 Ga0105250_102388012 126
22 3300009553 Ga0105249_10486933 Ga0105249_104869332 126
23 3300025250 Ga0209026_1000527 Ga0209026_100052713 126
24 3300025941 Ga0207711_11001719 Ga0207711_110017192 126
25 3300026088 Ga0207641_10084043 Ga0207641_100840432 126
26 3300037471 Ga0395905_0278035 Ga0395905_0278035_494_967 126
27 3300038443 Ga0395901_0263309 Ga0395901_0263309_955_1428 126
28 3300005444 Ga0070694_100958939 Ga0070694_1009589392 127
29 3300005458 Ga0070681_10026596 Ga0070681_100265967 127
30 3300005563 Ga0068855_102285477 Ga0068855_1022854771 127
31 3300005844 Ga0068862_100092658 Ga0068862_1000926584 127
32 3300013100 Ga0157373_10489385 Ga0157373_104893852 127
33 3300013105 Ga0157369_10298149 Ga0157369_102981492 127
34 3300025912 Ga0207707_10012529 Ga0207707_100125292 127
35 3300025913 Ga0207695_10006160 Ga0207695_100061606 127
36 3300025932 Ga0207690_10146152 Ga0207690_101461522 127
37 3300025949 Ga0207667_10019205 Ga0207667_100192055 127
38 3300028380 Ga0268265_10041957 Ga0268265_100419572 127
39 3300031251 Ga0265327_10000190 Ga0265327_1000019065 127
40 3300037312 Ga0395899_0124945 Ga0395899_0124945_1028_1510 127
41 3300037418 Ga0395900_0037240 Ga0395900_0037240_435_917 127
42 3300037466 Ga0395898_0062239 Ga0395898_0062239_1136_1618 127
43 3300038443 Ga0395901_0217972 Ga0395901_0217972_1261_1743 127
44 3300046684 Ga0495669_0032850 Ga0495669_0032850_423_908 127
45 3300053119 Ga0500595_030170 Ga0500595_030170_1134_1625 127
46 3300005564 Ga0070664_100122447 Ga0070664_1001224472 128
47 3300021384 Ga0213876_10484668 Ga0213876_104846681 128
48 3300025945 Ga0207679_10452311 Ga0207679_104523112 128
49 3300037466 Ga0395898_0049001 Ga0395898_0049001_2830_3303 128
50 3300039437 Ga0436365_0221080 Ga0436365_0221080_131_613 128
51 3300044694 Ga0466963_0207219 Ga0466963_0207219_760_1248 128
52 3300047472 Ga0495686_0003811 Ga0495686_0003811_3956_4447 128
53 3300049570 Ga0501033_0332612 Ga0501033_0332612_255_752 128
54 3300049581 Ga0501047_0472279 Ga0501047_0472279_256_747 128
55 3300049582 Ga0501048_0052952 Ga0501048_0052952_848_1336 128
56 iso_pu_bacteria 2643221598 2644000360 128
57 iso_pu_bacteria 2643221614 2644084871 128
58 iso_pu_bacteria 2643221661 2644342423 128
59 iso_pu_bacteria 2643221666 2644365723 128
60 3300005456 Ga0070678_101409126 Ga0070678_1014091261 129
61 3300005563 Ga0068855_100049752 Ga0068855_1000497523 129
62 3300009093 Ga0105240_10584807 Ga0105240_105848072 129
63 3300009545 Ga0105237_10711906 Ga0105237_107119062 129
64 3300010375 Ga0105239_11368000 Ga0105239_113680002 129
65 3300025914 Ga0207671_10962542 Ga0207671_109625422 129
66 3300025949 Ga0207667_10090164 Ga0207667_100901644 129
67 3300026067 Ga0207678_10296797 Ga0207678_102967972 129
68 3300039437 Ga0436365_1124659 Ga0436365_1124659_1770_2258 129
69 3300046517 Ga0495630_0193448 Ga0495630_0193448_405_902 129
70 3300046684 Ga0495669_0000003 Ga0495669_0000003_149582_150049 129
71 3300049581 Ga0501047_0009420 Ga0501047_0009420_926_1408 129
72 3300049823 Ga0501044_0951005 Ga0501044_0951005_123_605 129
73 3300009098 Ga0105245_10393622 Ga0105245_103936222 130
74 3300025913 Ga0207695_10458735 Ga0207695_104587352 130
75 3300025927 Ga0207687_10326325 Ga0207687_103263252 130
76 3300026121 Ga0207683_10697399 Ga0207683_106973992 130
77 3300037471 Ga0395905_0263629 Ga0395905_0263629_367_861 130
78 3300047320 Ga0495672_0072687 Ga0495672_0072687_1188_1676 130
79 3300047472 Ga0495686_0241342 Ga0495686_0241342_162_650 130
80 3300048928 Ga0496125_0327403 Ga0496125_0327403_202_675 130
81 3300005329 Ga0070683_100841984 Ga0070683_1008419842 131
82 3300006881 Ga0068865_100002935 Ga0068865_1000029355 131
83 3300009093 Ga0105240_10177718 Ga0105240_101777182 131
84 3300009177 Ga0105248_10837307 Ga0105248_108373072 131
85 3300013308 Ga0157375_10388814 Ga0157375_103888144 131
86 3300021361 Ga0213872_10009974 Ga0213872_100099742 131
87 3300025934 Ga0207686_10680065 Ga0207686_106800652 131
88 3300025938 Ga0207704_10008396 Ga0207704_100083967 131
89 3300025942 Ga0207689_10584304 Ga0207689_105843042 131
90 3300025945 Ga0207679_10124237 Ga0207679_101242372 131
91 3300025949 Ga0207667_10162853 Ga0207667_101628534 131
92 3300025960 Ga0207651_10100012 Ga0207651_101000122 131
93 3300031456 Ga0307513_10000856 Ga0307513_100008567 131
94 3300031730 Ga0307516_10002854 Ga0307516_1000285413 131
95 3300033180 Ga0307510_10282715 Ga0307510_102827152 131
96 3300035692 Ga0373935_0108812 Ga0373935_0108812_588_1061 131
97 3300039447 Ga0436361_0988746 Ga0436361_0988746_39_521 131
98 3300039447 Ga0436361_0992091 Ga0436361_0992091_1886_2368 131
99 3300039447 Ga0436361_1011731 Ga0436361_1011731_81_563 131
100 3300041997 Ga0439431_0024093 Ga0439431_0024093_440_931 131
101 3300046462 Ga0495651_0468227 Ga0495651_0468227_15_512 131
102 3300048915 Ga0496112_0071875 Ga0496112_0071875_1781_2266 131
103 3300050489 nmdc:mga03683_244601_c1 nmdc:mga03683_244601_c1_13_498 131
104 3300005338 Ga0068868_100498769 Ga0068868_1004987692 132
105 3300005339 Ga0070660_100232122 Ga0070660_1002321222 132
106 3300005456 Ga0070678_100071789 Ga0070678_1000717894 132
107 3300005539 Ga0068853_100755111 Ga0068853_1007551111 132
108 3300005564 Ga0070664_101246193 Ga0070664_1012461932 132
109 3300005614 Ga0068856_100516550 Ga0068856_1005165502 132
110 3300005614 Ga0068856_101119224 Ga0068856_1011192241 132
111 3300005618 Ga0068864_100007323 Ga0068864_1000073236 132
112 3300005618 Ga0068864_100196170 Ga0068864_1001961702 132
113 3300005841 Ga0068863_101161116 Ga0068863_1011611161 132
114 3300005842 Ga0068858_100611386 Ga0068858_1006113862 132
115 3300009093 Ga0105240_10024963 Ga0105240_100249639 132
116 3300009551 Ga0105238_10036393 Ga0105238_100363935 132
117 3300013296 Ga0157374_10169253 Ga0157374_101692534 132
118 3300013308 Ga0157375_10134351 Ga0157375_101343512 132
119 3300014325 Ga0163163_10394698 Ga0163163_103946981 132
120 3300014968 Ga0157379_11030498 Ga0157379_110304982 132
121 3300017792 Ga0163161_10318128 Ga0163161_103181281 132
122 3300025903 Ga0207680_10241455 Ga0207680_102414552 132
123 3300025911 Ga0207654_10176013 Ga0207654_101760131 132
124 3300025913 Ga0207695_10016645 Ga0207695_100166459 132
125 3300025920 Ga0207649_10513471 Ga0207649_105134712 132
126 3300025931 Ga0207644_10017128 Ga0207644_100171287 132
127 3300025931 Ga0207644_10022189 Ga0207644_100221892 132
128 3300025933 Ga0207706_10084419 Ga0207706_100844192 132
129 3300025941 Ga0207711_10031211 Ga0207711_100312113 132
130 3300025942 Ga0207689_10633056 Ga0207689_106330561 132
131 3300025945 Ga0207679_10247065 Ga0207679_102470652 132
132 3300026023 Ga0207677_10332252 Ga0207677_103322522 132
133 3300026088 Ga0207641_10296198 Ga0207641_102961982 132
134 3300026095 Ga0207676_10026738 Ga0207676_100267384 132
135 3300026118 Ga0207675_102266252 Ga0207675_1022662521 132
136 3300026121 Ga0207683_10101009 Ga0207683_101010092 132
137 3300028379 Ga0268266_11030123 Ga0268266_110301232 132
138 3300028380 Ga0268265_10861096 Ga0268265_108610962 132
139 3300028786 Ga0307517_10094005 Ga0307517_100940052 132
140 3300031251 Ga0265327_10029919 Ga0265327_100299194 132
141 3300031824 Ga0307413_10034682 Ga0307413_100346825 132
142 3300032004 Ga0307414_10047503 Ga0307414_100475032 132
143 3300032005 Ga0307411_10299416 Ga0307411_102994162 132
144 3300035113 Ga0373936_0010319 Ga0373936_0010319_874_1365 132
145 3300035172 Ga0373955_0747167 Ga0373955_0747167_35_529 132
146 3300035691 Ga0373931_0193182 Ga0373931_0193182_694_1185 132
147 3300035695 Ga0373927_0011513 Ga0373927_0011513_1316_1792 132
148 3300037068 Ga0373925_0002384 Ga0373925_0002384_9287_9763 132
149 3300044901 Ga0466960_0057997 Ga0466960_0057997_981_1469 132
150 3300046454 Ga0495592_0097343 Ga0495592_0097343_384_878 132
151 3300046506 Ga0495583_0087502 Ga0495583_0087502_260_748 132
152 3300046523 Ga0495644_0031853 Ga0495644_0031853_1114_1602 132
153 3300046528 Ga0495642_0134164 Ga0495642_0134164_407_823 132
154 3300046616 Ga0495668_0102333 Ga0495668_0102333_992_1480 132
155 3300047445 Ga0495677_0148270 Ga0495677_0148270_89_577 132
156 3300048905 Ga0496102_0222071 Ga0496102_0222071_294_782 132
157 3300048912 Ga0496109_0072895 Ga0496109_0072895_588_1076 132
158 3300048913 Ga0496110_0657046 Ga0496110_0657046_178_666 132
159 3300048914 Ga0496111_0109958 Ga0496111_0109958_233_721 132
160 3300048915 Ga0496112_0045576 Ga0496112_0045576_226_714 132
161 3300049571 Ga0501034_0576140 Ga0501034_0576140_187_681 132
162 3300049823 Ga0501044_0397230 Ga0501044_0397230_453_950 132
163 3300053087 Ga0500643_009345 Ga0500643_009345_2016_2504 132
164 3300005340 Ga0070689_100657749 Ga0070689_1006577492 133
165 3300005471 Ga0070698_101281960 Ga0070698_1012819601 133
166 3300005616 Ga0068852_100331164 Ga0068852_1003311644 133
167 3300005618 Ga0068864_100678866 Ga0068864_1006788662 133
168 3300005718 Ga0068866_10155645 Ga0068866_101556454 133
169 3300006048 Ga0075363_100061199 Ga0075363_1000611993 133
170 3300006177 Ga0075362_10076948 Ga0075362_100769482 133
171 3300025936 Ga0207670_10379308 Ga0207670_103793082 133
172 3300026041 Ga0207639_10903371 Ga0207639_109033712 133
173 3300026142 Ga0207698_11059209 Ga0207698_110592092 133
174 3300030521 Ga0307511_10038842 Ga0307511_100388426 133
175 3300031456 Ga0307513_10006523 Ga0307513_1000652311 133
176 3300037471 Ga0395905_0214846 Ga0395905_0214846_406_897 133
177 3300046459 Ga0495629_0065446 Ga0495629_0065446_1010_1501 133
178 3300046506 Ga0495583_0074995 Ga0495583_0074995_913_1410 133
179 3300046515 Ga0495620_0027011 Ga0495620_0027011_175_672 133
180 3300046515 Ga0495620_0077197 Ga0495620_0077197_115_612 133
181 3300046522 Ga0495643_0001946 Ga0495643_0001946_8039_8530 133
182 3300046530 Ga0495654_0031793 Ga0495654_0031793_1487_1978 133
183 3300046538 Ga0495609_0018131 Ga0495609_0018131_1634_2125 133
184 3300046542 Ga0495597_0024312 Ga0495597_0024312_1488_1979 133
185 3300046557 Ga0495622_0004662 Ga0495622_0004662_734_1225 133
186 3300046616 Ga0495668_0059985 Ga0495668_0059985_137_628 133
187 3300046616 Ga0495668_0177284 Ga0495668_0177284_373_855 133
188 3300046660 Ga0495625_0193566 Ga0495625_0193566_644_1135 133
189 3300047443 Ga0495687_072276 Ga0495687_072276_380_871 133
190 3300050490 nmdc:mga03n38_635666_c1 nmdc:mga03n38_635666_c1_116_598 133
191 3300053119 Ga0500595_004337 Ga0500595_004337_2534_3025 133
192 3300053148 Ga0500590_018369 Ga0500590_018369_2999_3490 133
193 3300003794 Ga0055531_10037083 Ga0055531_100370833 134
194 3300025304 Ga0209257_1000807 Ga0209257_100080714 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

80

154

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hr7-assembly1.cif.gz_B crystal structure of biotin carboxyl carrier protein-biotin carboxylase complex from e.coli 0.9872 58 134
5gu9-assembly1.cif.gz_A structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138i mutant 0.9747 59 134
5gua-assembly1.cif.gz_A structure of biotin carboxyl carrier protein from pyrococcus horikoshi ot3 (delta n79) a138y mutant 0.965 59 134
2d5d-assembly1.cif.gz_A structure of biotin carboxyl carrier protein (74val start) from pyrococcus horikoshi ot3 ligand free form ii 0.955 59 134
2ejg-assembly1.cif.gz_C crystal structure of the biotin protein ligase (mutation r48a) and biotin carboxyl carrier protein complex from pyrococcus horikoshii ot3 0.955 59 134
ID Description Score Start End Superfamily
af_I1LWR8_198_274_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.989 58 133 2.40.50.100
af_Q58628_489_566_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9687 60 133 2.40.50.100
af_I1LWR8_198_274_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.964 58 133 2.40.50.100
af_Q2FXX0_70_148_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9612 58 131 2.40.50.100
af_P9WPQ1_4_71_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9559 60 134 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A529W1G6-F1-model_v4 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 1.003 60 134 GO:0003989
GO:0006633
GO:0009317
AF-A0A507ZU19-F1-model_v4 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 0.9979 58 134 GO:0003989
GO:0006633
GO:0009317
AF-A0A399F3B0-F1-model_v4 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 0.9963 59 134 GO:0003989
GO:0006633
GO:0009317
AF-T0HBY7-F1-model_v4 Biotin carboxyl carrier protein of acetyl-CoA carboxylase 0.9953 58 134 GO:0003989
GO:0006633
GO:0009317
AF-A0A4Y8MCD6-F1-model_v4 deleted 0.9924 59 134

Feature Viewer

pLDDT pTM Quality
87.25 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map